* incoming
@ 2016-05-05 23:21 Andrew Morton
0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2016-05-05 23:21 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits
[-- Attachment #1: Type: text/plain, Size: 987 bytes --]
14 fixes, based on c5e0666c5a3ccabdf16bb88451886cdf81849b66:
Subject: mm: thp: correct split_huge_pages file permission
Subject: mm: memcontrol: let v2 cgroups follow changes in system swappiness
Subject: rapidio/mport_cdev: fix uapi type definitions
Subject: huge pagecache: mmap_sem is unlocked when truncation splits pmd
Subject: mm: update min_free_kbytes from khugepaged after core initialization
Subject: mm, cma: prevent nr_isolated_* counters from going negative
Subject: MAINTAINERS: fix Rajendra Nayak's address
Subject: mm: thp: kvm: fix memory corruption in KVM with THP enabled
Subject: mm/zswap: provide unique zpool name
Subject: proc: prevent accessing /proc/<PID>/environ until it's ready
Subject: modpost: fix module autoloading for OF devices with generic compatible property
Subject: mm: fix kcompactd hang during memory offlining
Subject: lib/stackdepot: avoid to return 0 handle
Subject: byteswap: try to avoid __builtin_constant_p gcc bug
[-- Attachment #2: Type: application/pgp-signature, Size: 836 bytes --]
^ permalink raw reply [flat|nested] 232+ messages in thread
* incoming
@ 2016-05-09 23:28 Andrew Morton
0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2016-05-09 23:28 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits
[-- Attachment #1: Type: text/plain, Size: 302 bytes --]
3 fixes, based on 44549e8f5eea4e0a41b487b63e616cb089922b99:
Subject: Revert "proc/base: make prompt shell start from new line after executing "cat /proc/$pid/wchan""
Subject: zsmalloc: fix zs_can_compact() integer overflow
Subject: compiler-gcc: require gcc 4.8 for powerpc __builtin_bswap16()
[-- Attachment #2: Type: application/pgp-signature, Size: 836 bytes --]
^ permalink raw reply [flat|nested] 232+ messages in thread
* incoming
@ 2016-05-12 22:41 Andrew Morton
0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2016-05-12 22:41 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits
[-- Attachment #1: Type: text/plain, Size: 344 bytes --]
4 fixes, based on 422ce5a97570cb8a37d016b6bc2021ae4dac5499:
Subject: ocfs2: revert using ocfs2_acl_chmod to avoid inode cluster lock hang
Subject: ocfs2: fix posix_acl_create deadlock
Subject: ksm: fix conflict between mmput and scan_get_next_rmap_item
Subject: mm: thp: calculate the mapcount correctly for THP pages during WP faults
[-- Attachment #2: Type: application/pgp-signature, Size: 836 bytes --]
^ permalink raw reply [flat|nested] 232+ messages in thread
* incoming
@ 2016-05-20 0:07 Andrew Morton
0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2016-05-20 0:07 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits
[-- Attachment #1: Type: text/plain, Size: 7864 bytes --]
- fsnotify fix
- poll() timeout fix
- a few scripts/ tweaks
- debugobjects updates
- the (small) ocfs2 queue
- Minor fixes to kernel/padata.c
- Maybe half of the MM queue
117 patches, based on 2600a46ee0ed57c0e0a382c2a37ebac64d374d20:
Subject: fsnotify: avoid spurious EMFILE errors from inotify_init()
Subject: time: add missing implementation for timespec64_add_safe()
Subject: fs: poll/select/recvmmsg: use timespec64 for timeout events
Subject: time: remove timespec_add_safe()
Subject: scripts/decode_stacktrace.sh: handle symbols in modules
Subject: scripts/spelling.txt: add "fimware" misspelling
Subject: scripts/bloat-o-meter: print percent change
Subject: debugobjects: make fixup functions return bool instead of int
Subject: debugobjects: correct the usage of fixup call results
Subject: workqueue: update debugobjects fixup callbacks return type
Subject: timer: update debugobjects fixup callbacks return type
Subject: rcu: update debugobjects fixup callbacks return type
Subject: percpu_counter: update debugobjects fixup callbacks return type
Subject: Documentation: update debugobjects doc
Subject: debugobjects: insulate non-fixup logic related to static obj from fixup callbacks
Subject: ocfs2: fix comment in struct ocfs2_extended_slot
Subject: ocfs2: clean up an unused variable 'wants_rotate' in ocfs2_truncate_rec
Subject: ocfs2: clean up unused parameter 'count' in o2hb_read_block_input()
Subject: ocfs2: clean up an unneeded goto in ocfs2_put_slot()
Subject: kernel/padata.c: removed unused code
Subject: kernel/padata.c: hide unused functions
Subject: mm/slab: fix the theoretical race by holding proper lock
Subject: mm/slab: remove BAD_ALIEN_MAGIC again
Subject: mm/slab: drain the free slab as much as possible
Subject: mm/slab: factor out kmem_cache_node initialization code
Subject: mm/slab: clean-up kmem_cache_node setup
Subject: mm/slab: don't keep free slabs if free_objects exceeds free_limit
Subject: mm/slab: racy access/modify the slab color
Subject: mm/slab: make cache_grow() handle the page allocated on arbitrary node
Subject: mm/slab: separate cache_grow() to two parts
Subject: mm/slab: refill cpu cache through a new slab without holding a node lock
Subject: mm/slab: lockless decision to grow cache
Subject: mm/slub.c: replace kick_all_cpus_sync() with synchronize_sched() in kmem_cache_shrink()
Subject: mm: SLAB freelist randomization
Subject: mm: slab: remove ZONE_DMA_FLAG
Subject: mm/slub.c: fix sysfs filename in comment
Subject: mm/page_ref: use page_ref helper instead of direct modification of _count
Subject: mm: rename _count, field of the struct page, to _refcount
Subject: compiler.h: add support for malloc attribute
Subject: include/linux: apply __malloc attribute
Subject: include/linux/nodemask.h: create next_node_in() helper
Subject: mm/hugetlb: optimize minimum size (min_size) accounting
Subject: mm/hugetlb: introduce hugetlb_bad_size()
Subject: arm64: mm: use hugetlb_bad_size()
Subject: metag: mm: use hugetlb_bad_size()
Subject: powerpc: mm: use hugetlb_bad_size()
Subject: tile: mm: use hugetlb_bad_size()
Subject: x86: mm: use hugetlb_bad_size()
Subject: mm/hugetlb: is_vm_hugetlb_page() can return bool
Subject: mm/memory_hotplug: is_mem_section_removable() can return bool
Subject: mm/vmalloc.c: is_vmalloc_addr() can return bool
Subject: mm/mempolicy.c: vma_migratable() can return bool
Subject: mm/memcontrol.c:mem_cgroup_select_victim_node(): clarify comment
Subject: mm/page_alloc: remove useless parameter of __free_pages_boot_core
Subject: mm/hugetlb.c: use first_memory_node
Subject: mm/mempolicy.c:offset_il_node() document and clarify
Subject: mm/rmap: replace BUG_ON(anon_vma->degree) with VM_WARN_ON
Subject: mm, compaction: wrap calculating first and last pfn of pageblock
Subject: mm, compaction: reduce spurious pcplist drains
Subject: mm, compaction: skip blocks where isolation fails in async direct compaction
Subject: mm/highmem: simplify is_highmem()
Subject: mm: uninline page_mapped()
Subject: mm/hugetlb: add same zone check in pfn_range_valid_gigantic()
Subject: mm/memory_hotplug: add comment to some functions related to memory hotplug
Subject: mm/vmstat: add zone range overlapping check
Subject: mm/page_owner: add zone range overlapping check
Subject: power: add zone range overlapping check
Subject: mm/writeback: correct dirty page calculation for highmem
Subject: mm/page_alloc: correct highmem memory statistics
Subject: mm/highmem: make nr_free_highpages() handles all highmem zones by itself
Subject: mm/vmstat: make node_page_state() handles all zones by itself
Subject: mm/mmap: kill hook arch_rebalance_pgtables()
Subject: mm: update_lru_size warn and reset bad lru_size
Subject: mm: update_lru_size do the __mod_zone_page_state
Subject: mm: use __SetPageSwapBacked and dont ClearPageSwapBacked
Subject: tmpfs: preliminary minor tidyups
Subject: tmpfs: mem_cgroup charge fault to vm_mm not current mm
Subject: mm: /proc/sys/vm/stat_refresh to force vmstat update
Subject: huge mm: move_huge_pmd does not need new_vma
Subject: huge pagecache: extend mremap pmd rmap lockout to files
Subject: arch: fix has_transparent_hugepage()
Subject: memory_hotplug: introduce CONFIG_MEMORY_HOTPLUG_DEFAULT_ONLINE
Subject: memory_hotplug: introduce memhp_default_state= command line parameter
Subject: mm, oom: move GFP_NOFS check to out_of_memory
Subject: oom, oom_reaper: try to reap tasks which skip regular OOM killer path
Subject: mm, oom_reaper: clear TIF_MEMDIE for all tasks queued for oom_reaper
Subject: mm, page_alloc: only check PageCompound for high-order pages
Subject: mm, page_alloc: use new PageAnonHead helper in the free page fast path
Subject: mm, page_alloc: reduce branches in zone_statistics
Subject: mm, page_alloc: inline zone_statistics
Subject: mm, page_alloc: inline the fast path of the zonelist iterator
Subject: mm, page_alloc: use __dec_zone_state for order-0 page allocation
Subject: mm, page_alloc: avoid unnecessary zone lookups during pageblock operations
Subject: mm, page_alloc: convert alloc_flags to unsigned
Subject: mm, page_alloc: convert nr_fair_skipped to bool
Subject: mm, page_alloc: remove unnecessary local variable in get_page_from_freelist
Subject: mm, page_alloc: remove unnecessary initialisation in get_page_from_freelist
Subject: mm, page_alloc: remove unnecessary initialisation from __alloc_pages_nodemask()
Subject: mm, page_alloc: simplify last cpupid reset
Subject: mm, page_alloc: move __GFP_HARDWALL modifications out of the fastpath
Subject: mm, page_alloc: check once if a zone has isolated pageblocks
Subject: mm, page_alloc: shorten the page allocator fast path
Subject: mm, page_alloc: reduce cost of fair zone allocation policy retry
Subject: mm, page_alloc: shortcut watermark checks for order-0 pages
Subject: mm, page_alloc: avoid looking up the first zone in a zonelist twice
Subject: mm, page_alloc: remove field from alloc_context
Subject: mm, page_alloc: check multiple page fields with a single branch
Subject: mm, page_alloc: un-inline the bad part of free_pages_check
Subject: mm, page_alloc: pull out side effects from free_pages_check
Subject: mm, page_alloc: remove unnecessary variable from free_pcppages_bulk
Subject: mm, page_alloc: inline pageblock lookup in page free fast paths
Subject: cpuset: use static key better and convert to new API
Subject: mm, page_alloc: defer debugging checks of freed pages until a PCP drain
Subject: mm, page_alloc: defer debugging checks of pages allocated from the PCP
Subject: mm, page_alloc: don't duplicate code in free_pcp_prepare
Subject: mm, page_alloc: uninline the bad page part of check_new_page()
Subject: mm, page_alloc: restore the original nodemask if the fast path allocation failed
[-- Attachment #2: Type: application/pgp-signature, Size: 836 bytes --]
^ permalink raw reply [flat|nested] 232+ messages in thread
* incoming
@ 2016-05-20 23:55 Andrew Morton
0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2016-05-20 23:55 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits
[-- Attachment #1: Type: text/plain, Size: 297 bytes --]
- the rest of MM
- KASAN updates
- procfs updates
- exit, fork updates
- printk updates
- lib/ updates
- radix-tree testsuite updates
- checkpatch updates
- kprobes updates
- a few other misc bits
162 patches, based on 6eb59af580dcffc6f6982ac8ef6d27a1a5f26b27
[-- Attachment #2: Type: application/pgp-signature, Size: 836 bytes --]
^ permalink raw reply [flat|nested] 232+ messages in thread
* incoming
@ 2016-05-23 23:21 Andrew Morton
0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2016-05-23 23:21 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits
[-- Attachment #1: Type: text/plain, Size: 5691 bytes --]
- Please have a think about Oleg's "wait/ptrace: assume __WALL if the
child is traced". It's a kernel-based workaround for existing
userspace issues and is a form of non-back-compatible change.
- A few hotfixes
- befs cleanups
- nilfs2 updates
- sys_wait() changes
- kexec updates
- kdump
- scripts/gdb updates
- the last of the MM queue
- a few other misc things
84 patches, based on 7639dad93a5564579987abded4ec05e3db13659d:
Subject: m32r: fix build failure
Subject: : ELF/MIPS build fix
Subject: mm: memcontrol: fix possible css ref leak on oom
Subject: fs/befs/datastream.c:befs_read_datastream(): remove unneeded initialization to NULL
Subject: fs/befs/datastream.c:befs_read_lsymlink(): remove unneeded initialization to NULL
Subject: fs/befs/datastream.c:befs_find_brun_dblindirect(): remove unneeded initializations to NULL
Subject: fs/befs/linuxvfs.c:befs_get_block(): remove unneeded initialization to NULL
Subject: fs/befs/linuxvfs.c:befs_iget(): remove unneeded initialization to NULL
Subject: fs/befs/linuxvfs.c:befs_iget(): remove unneeded raw_inode initialization to NULL
Subject: fs/befs/linuxvfs.c:befs_iget(): remove unneeded befs_nio initialization to NULL
Subject: fs/befs/io.c:befs_bread_iaddr(): remove unneeded initialization to NULL
Subject: fs/befs/io.c:befs_bread(): remove unneeded initialization to NULL
Subject: nilfs2: constify nilfs_sc_operations structures
Subject: nilfs2: fix white space issue in nilfs_mount()
Subject: nilfs2: remove space before comma
Subject: nilfs2: remove FSF mailing address from GPL notices
Subject: nilfs2: clean up old e-mail addresses
Subject: MAINTAINERS: add web link for nilfs project
Subject: nilfs2: clarify permission to replicate the design
Subject: nilfs2: get rid of nilfs_mdt_mark_block_dirty()
Subject: nilfs2: move cleanup code of metadata file from inode routines
Subject: nilfs2: replace __attribute__((packed)) with __packed
Subject: nilfs2: add missing line spacing
Subject: nilfs2: clean trailing semicolons in macros
Subject: nilfs2: do not emit extra newline on nilfs_warning() and nilfs_error()
Subject: nilfs2: remove space before semicolon
Subject: nilfs2: fix code indent coding style issue
Subject: nilfs2: avoid bare use of 'unsigned'
Subject: nilfs2: remove unnecessary else after return or break
Subject: nilfs2: remove loops of single statement macros
Subject: nilfs2: fix block comments
Subject: wait/ptrace: assume __WALL if the child is traced
Subject: wait: allow sys_waitid() to accept __WNOTHREAD/__WCLONE/__WALL
Subject: signal: make oom_flags a bool
Subject: kernel/signal.c: convert printk(KERN_<LEVEL> ...) to pr_<level>(...)
Subject: signal: move the "sig < SIGRTMIN" check into siginmask(sig)
Subject: kernek/fork.c: allocate idle task for a CPU always on its local node
Subject: exec: remove the no longer needed remove_arg_zero()->free_arg_page()
Subject: kexec: introduce a protection mechanism for the crashkernel reserved memory
Subject: kexec: provide arch_kexec_protect(unprotect)_crashkres()
Subject: kexec: make a pair of map/unmap reserved pages in error path
Subject: kexec: do a cleanup for function kexec_load
Subject: s390/kexec: consolidate crash_map/unmap_reserved_pages() and arch_kexec_protect(unprotect)_crashkres()
Subject: kdump: fix gdb macros work work with newer and 64-bit kernels
Subject: rtsx_usb_ms: use schedule_timeout_idle() in polling loop
Subject: drivers/memstick/core/mspro_block: use kmemdup
Subject: arch/defconfig: remove CONFIG_RESOURCE_COUNTERS
Subject: scripts/gdb: Adjust module reference counter reported by lx-lsmod
Subject: scripts/gdb: provide linux constants
Subject: scripts/gdb: provide kernel list item generators
Subject: scripts/gdb: convert modules usage to lists functions
Subject: scripts/gdb: provide exception catching parser
Subject: scripts/gdb: support !CONFIG_MODULES gracefully
Subject: scripts/gdb: provide a dentry_name VFS path helper
Subject: scripts/gdb: add io resource readers
Subject: scripts/gdb: add mount point list command
Subject: scripts/gdb: add cpu iterators
Subject: scripts/gdb: cast CPU numbers to integer
Subject: scripts/gdb: add a Radix Tree Parser
Subject: scripts/gdb: add documentation example for radix tree
Subject: scripts/gdb: add lx_thread_info_by_pid helper
Subject: scripts/gdb: improve types abstraction for gdb python scripts
Subject: scripts/gdb: fix issue with dmesg.py and python 3.X
Subject: scripts/gdb: decode bytestream on dmesg for Python3
Subject: MAINTAINERS: add co-maintainer for scripts/gdb
Subject: mm: make mmap_sem for write waits killable for mm syscalls
Subject: mm: make vm_mmap killable
Subject: mm: make vm_munmap killable
Subject: mm, aout: handle vm_brk failures
Subject: mm, elf: handle vm_brk error
Subject: mm: make vm_brk killable
Subject: mm, proc: make clear_refs killable
Subject: mm, fork: make dup_mmap wait for mmap_sem for write killable
Subject: ipc, shm: make shmem attach/detach wait for mmap_sem killable
Subject: vdso: make arch_setup_additional_pages wait for mmap_sem for write killable
Subject: coredump: make coredump_wait wait for mmap_sem for write killable
Subject: aio: make aio_setup_ring killable
Subject: exec: make exec path waiting for mmap_sem killable
Subject: prctl: make PR_SET_THP_DISABLE wait for mmap_sem killable
Subject: uprobes: wait for mmap_sem for write killable
Subject: drm/i915: make i915_gem_mmap_ioctl wait for mmap_sem killable
Subject: drm/radeon: make radeon_mn_get wait for mmap_sem killable
Subject: drm/amdgpu: make amdgpu_mn_get wait for mmap_sem killable
Subject: kgdb: depends on VT
[-- Attachment #2: Type: application/pgp-signature, Size: 836 bytes --]
^ permalink raw reply [flat|nested] 232+ messages in thread
* incoming
@ 2016-05-26 22:15 Andrew Morton
0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2016-05-26 22:15 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits
[-- Attachment #1: Type: text/plain, Size: 706 bytes --]
10 fixes, based on ea8ea737c46cffa5d0ee74309f81e55a7e5e9c2a:
Subject: seqlock: fix raw_read_seqcount_latch()
Subject: mm: make CONFIG_DEFERRED_STRUCT_PAGE_INIT depends on !FLATMEM explicitly
Subject: mm: kasan: remove unused 'reserved' field from struct kasan_alloc_meta
Subject: mm: slub: remove unused virt_to_obj()
Subject: ocfs2: fix improper handling of return errno
Subject: memcg: fix mem_cgroup_out_of_memory() return value.
Subject: mm: oom_reaper: remove some bloat
Subject: dma-debug: avoid spinlock recursion when disabling dma-debug
Subject: update "mm/zsmalloc: don't fail if can't create debugfs info"
Subject: drivers/pinctrl/intel/pinctrl-baytrail.c: fix build with gcc-4.4
[-- Attachment #2: Type: application/pgp-signature, Size: 836 bytes --]
^ permalink raw reply [flat|nested] 232+ messages in thread
* incoming
@ 2016-05-27 21:26 Andrew Morton
0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2016-05-27 21:26 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits
[-- Attachment #1: Type: text/plain, Size: 1273 bytes --]
- late-breaking ocfs2 updates
- random bunch of fixes
19 patches, based on dc03c0f9d12d85286d5e3623aa96d5c2a271b8e6:
Subject: ocfs2: o2hb: add negotiate timer
Subject: ocfs2: o2hb: add NEGO_TIMEOUT message
Subject: ocfs2: o2hb: add NEGOTIATE_APPROVE message
Subject: ocfs2: o2hb: add some user/debug log
Subject: ocfs2: o2hb: don't negotiate if last hb fail
Subject: ocfs2: o2hb: fix hb hung time
Subject: ocfs2: bump up o2cb network protocol version
Subject: direct-io: fix direct write stale data exposure from concurrent buffered read
Subject: mm: oom: do not reap task if there are live threads in threadgroup
Subject: MAINTAINERS: add kexec_core.c and kexec_file.c
Subject: MAINTAINERS: Kdump maintainers update
Subject: mm: use early_pfn_to_nid in page_ext_init
Subject: mm: use early_pfn_to_nid in register_page_bootmem_info_node
Subject: oom_reaper: close race with exiting task
Subject: mm: thp: avoid false positive VM_BUG_ON_PAGE in page_move_anon_rmap()
Subject: mm/cma: silence warnings due to max() usage
Subject: mm/memcontrol.c: fix the margin computation in mem_cgroup_margin()
Subject: mm/memcontrol.c: move comments for get_mctgt_type() to proper position
Subject: mm: disable DEFERRED_STRUCT_PAGE_INIT on !NO_BOOTMEM
[-- Attachment #2: Type: application/pgp-signature, Size: 836 bytes --]
^ permalink raw reply [flat|nested] 232+ messages in thread
* incoming
@ 2016-06-03 21:51 Andrew Morton
0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2016-06-03 21:51 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits
[-- Attachment #1: Type: text/plain, Size: 880 bytes --]
11 fixes, based on 4340fa55298d17049e71c7a34e04647379c269f3:
Subject: mm: fix overflow in vm_map_ram()
Subject: kdump: fix dmesg gdbmacro to work with record based printk
Subject: mm: check the return value of lookup_page_ext for all call sites
Subject: reiserfs: avoid uninitialized variable use
Subject: memcg: add RCU locking around css_for_each_descendant_pre() in memcg_offline_kmem()
Subject: mm/z3fold.c: avoid modifying HEADLESS page and minor cleanup
Subject: checkpatch: reduce git commit description style false positives
Subject: mm, page_alloc: prevent infinite loop in buffered_rmqueue()
Subject: mm, oom_reaper: do not use siglock in try_oom_reaper()
Subject: mm, page_alloc: reset zonelist iterator after resetting fair zone allocation policy
Subject: mm, page_alloc: recalculate the preferred zoneref if the context can ignore memory policies
[-- Attachment #2: Type: application/pgp-signature, Size: 836 bytes --]
^ permalink raw reply [flat|nested] 232+ messages in thread
* incoming
@ 2016-06-08 22:33 Andrew Morton
0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2016-06-08 22:33 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits
[-- Attachment #1: Type: text/plain, Size: 552 bytes --]
7 fixes, based on c8ae067f2635be0f8c7e5db1bb74b757d623e05b:
Subject: mm/hugetlb: fix huge page reserve accounting for private mappings
Subject: kasan: change memory hot-add error messages to info messages
Subject: revert "mm: memcontrol: fix possible css ref leak on oom"
Subject: mm: thp: broken page count after commit aa88b68c
Subject: kernel/relay.c: fix potential memory leak
Subject: mm: introduce dedicated WQ_MEM_RECLAIM workqueue to do lru_add_drain_all
Subject: mm/fadvise.c: do not discard partial pages with POSIX_FADV_DONTNEED
[-- Attachment #2: Type: application/pgp-signature, Size: 836 bytes --]
^ permalink raw reply [flat|nested] 232+ messages in thread
* incoming
@ 2016-06-24 21:48 Andrew Morton
0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2016-06-24 21:48 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits
[-- Attachment #1: Type: text/plain, Size: 2596 bytes --]
Two weeks worth of fixes here.
41 fixes, based on 63c04ee7d3b7c8d8e2726cb7c5f8a5f6fcc1e3b2:
Subject: mm,oom_reaper: don't call mmput_async() without atomic_inc_not_zero()
Subject: oom_reaper: avoid pointless atomic_inc_not_zero usage.
Subject: selftests/vm/compaction_test: fix write to restore nr_hugepages
Subject: tmpfs: don't undo fallocate past its last page
Subject: tree wide: get rid of __GFP_REPEAT for order-0 allocations part I
Subject: x86: get rid of superfluous __GFP_REPEAT
Subject: x86/efi: get rid of superfluous __GFP_REPEAT
Subject: arm64: get rid of superfluous __GFP_REPEAT
Subject: arc: get rid of superfluous __GFP_REPEAT
Subject: mips: get rid of superfluous __GFP_REPEAT
Subject: nios2: get rid of superfluous __GFP_REPEAT
Subject: parisc: get rid of superfluous __GFP_REPEAT
Subject: score: get rid of superfluous __GFP_REPEAT
Subject: powerpc: get rid of superfluous __GFP_REPEAT
Subject: sparc: get rid of superfluous __GFP_REPEAT
Subject: s390: get rid of superfluous __GFP_REPEAT
Subject: sh: get rid of superfluous __GFP_REPEAT
Subject: tile: get rid of superfluous __GFP_REPEAT
Subject: unicore32: get rid of superfluous __GFP_REPEAT
Subject: jbd2: get rid of superfluous __GFP_REPEAT
Subject: MAINTAINERS: update Calgary IOMMU
Subject: mm: mempool: kasan: don't poot mempool objects in quarantine
Subject: mm, sl[au]b: add __GFP_ATOMIC to the GFP reclaim mask
Subject: mailmap: add Antoine Tenart's email
Subject: mailmap: add Boris Brezillon's email
Subject: Revert "mm: make faultaround produce old ptes"
Subject: Revert "mm: disable fault around on emulated access bit architecture"
Subject: hugetlb: fix nr_pmds accounting with shared page tables
Subject: memcg: mem_cgroup_migrate() may be called with irq disabled
Subject: memcg: css_alloc should return an ERR_PTR value on error
Subject: mm/swap.c: flush lru pvecs on compound page arrival
Subject: mm/hugetlb: clear compound_mapcount when freeing gigantic pages
Subject: mm: prevent KASAN false positives in kmemleak
Subject: mm, compaction: abort free scanner if split fails
Subject: ocfs2: disable BUG assertions in reading blocks
Subject: oom, suspend: fix oom_reaper vs. oom_killer_disable race
Subject: fs/nilfs2: fix potential underflow in call to crc32_le
Subject: tools/vm/slabinfo: fix spelling mistake: "Ocurrences" -> "Occurrences"
Subject: mm/page_owner: avoid null pointer dereference
Subject: autofs: don't get stuck in a loop if vfs_write() returns an error
Subject: init/main.c: fix initcall_blacklisted on ia64, ppc64 and parisc64
[-- Attachment #2: Type: application/pgp-signature, Size: 836 bytes --]
^ permalink raw reply [flat|nested] 232+ messages in thread
* incoming
@ 2016-07-14 19:06 Andrew Morton
0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2016-07-14 19:06 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits
[-- Attachment #1: Type: text/plain, Size: 1338 bytes --]
20 fixes, based on f97d10454e4da2aceb44dfa7c59bb43ba9f50199:
Subject: mm, compaction: prevent VM_BUG_ON when terminating freeing scanner
Subject: kasan: add newline to messages
Subject: scripts/gdb: silence 'nothing to do' message
Subject: scripts/gdb: rebuild constants.py on dependancy change
Subject: scripts/gdb: add constants.py to .gitignore
Subject: scripts/gdb: Perform path expansion to lx-symbol's arguments
Subject: Revert "scripts/gdb: add a Radix Tree Parser"
Subject: Revert "scripts/gdb: add documentation example for radix tree"
Subject: madvise_free, thp: fix madvise_free_huge_pmd return value after splitting
Subject: uapi: export lirc.h header
Subject: kasan/quarantine: fix bugs on qlist_move_cache()
Subject: mm, meminit: always return a valid node from early_pfn_to_nid
Subject: mm, meminit: ensure node is online before checking whether pages are uninitialised
Subject: gcov: add support for gcc version >= 6
Subject: vmlinux.lds: account for destructor sections
Subject: mm: thp: move pmd check inside ptl for freeze_page()
Subject: mm: rmap: call page_check_address() with sync enabled to avoid racy check
Subject: mm: thp: refix false positive BUG in page_move_anon_rmap()
Subject: mm: workingset: printk missing log level, use pr_info()
Subject: m32r: fix build warning about putc
[-- Attachment #2: Type: application/pgp-signature, Size: 836 bytes --]
^ permalink raw reply [flat|nested] 232+ messages in thread
* incoming
@ 2016-07-20 22:44 Andrew Morton
0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2016-07-20 22:44 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits
[-- Attachment #1: Type: text/plain, Size: 378 bytes --]
5 fixes, based on 47ef4ad2684d380dd6d596140fb79395115c3950:
Subject: mm: memcontrol: fix cgroup creation failure after many small jobs
Subject: radix-tree: fix radix_tree_iter_retry() for tagged iterators.
Subject: testing/radix-tree: fix a macro expansion bug
Subject: tools/vm/slabinfo: fix an unintentional printf
Subject: pps: do not crash when failed to register
[-- Attachment #2: Type: application/pgp-signature, Size: 836 bytes --]
^ permalink raw reply [flat|nested] 232+ messages in thread
* incoming
@ 2016-07-26 22:16 Andrew Morton
0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2016-07-26 22:16 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits
[-- Attachment #1: Type: text/plain, Size: 7441 bytes --]
- a few misc bits
- ocfs2
- most(?) of MM
126 patches, based on e65805251f2db69c9f67ed8062ab82526be5a374:
Subject: arm: get rid of superfluous __GFP_REPEAT
Subject: dax: some small updates to dax.txt documentation
Subject: dax: remote unused fault wrappers
Subject: dma-debug: track bucket lock state for static checkers
Subject: fbmon: remove unused function argument
Subject: CFLAGS: add -Wunused-but-set-parameter
Subject: kbuild: abort build on bad stack protector flag
Subject: scripts/bloat-o-meter: fix percent on <1% changes
Subject: m32r: add __ucmpdi2 to fix build failure
Subject: debugobjects.h: fix trivial kernel doc warning
Subject: ocfs2: fix a redundant re-initialization
Subject: ocfs2: improve recovery performance
Subject: ocfs2: cleanup unneeded goto in ocfs2_create_new_inode_locks
Subject: ocfs2/dlm: fix memory leak of dlm_debug_ctxt
Subject: ocfs2: cleanup implemented prototypes
Subject: ocfs2: remove obscure BUG_ON in dlmglue
Subject: ocfs2/cluster: clean up unnecessary assignment for 'ret'
Subject: fs/fs-writeback.c: add a new writeback list for sync
Subject: fs/fs-writeback.c: inode writeback list tracking tracepoints
Subject: mm: reorganize SLAB freelist randomization
Subject: mm: SLUB freelist randomization
Subject: slab: make GFP_SLAB_BUG_MASK information more human readable
Subject: slab: do not panic on invalid gfp_mask
Subject: mm: faster kmalloc_array(), kcalloc()
Subject: mm/slab: use list_move instead of list_del/list_add
Subject: mm/memcontrol.c: remove the useless parameter for mc_handle_swap_pte
Subject: mm/init: fix zone boundary creation
Subject: memory-hotplug: add move_pfn_range()
Subject: memory-hotplug: more general validation of zone during online
Subject: memory-hotplug: use zone_can_shift() for sysfs valid_zones attribute
Subject: mm: zap ZONE_OOM_LOCKED
Subject: mm: oom: add memcg to oom_control
Subject: include/linux/mmdebug.h: add VM_WARN which maps to WARN()
Subject: powerpc/mm: check for irq disabled() only if DEBUG_VM is enabled
Subject: zram: rename zstrm find-release functions
Subject: zram: switch to crypto compress API
Subject: zram: use crypto api to check alg availability
Subject: zram: cosmetic: cleanup documentation
Subject: zram: delete custom lzo/lz4
Subject: zram: add more compression algorithms
Subject: zram: drop gfp_t from zcomp_strm_alloc()
Subject: mm: use put_page() to free page instead of putback_lru_page()
Subject: mm: migrate: support non-lru movable page migration
Subject: mm: balloon: use general non-lru movable page feature
Subject: zsmalloc: keep max_object in size_class
Subject: zsmalloc: use bit_spin_lock
Subject: zsmalloc: use accessor
Subject: zsmalloc: factor page chain functionality out
Subject: zsmalloc: introduce zspage structure
Subject: zsmalloc: separate free_zspage from putback_zspage
Subject: zsmalloc: use freeobj for index
Subject: zsmalloc: page migration support
Subject: zram: use __GFP_MOVABLE for memory allocation
Subject: zsmalloc: use OBJ_TAG_BIT for bit shifter
Subject: mm/compaction: split freepages without holding the zone lock
Subject: mm/page_owner: initialize page owner without holding the zone lock
Subject: mm/page_owner: copy last_migrate_reason in copy_page_owner()
Subject: mm/page_owner: introduce split_page_owner and replace manual handling
Subject: tools/vm/page_owner: increase temporary buffer size
Subject: mm/page_owner: use stackdepot to store stacktrace
Subject: mm/page_alloc: introduce post allocation processing on page allocator
Subject: mm/page_isolation: clean up confused code
Subject: mm: thp: check pmd_trans_unstable() after split_huge_pmd()
Subject: mm/hugetlb: simplify hugetlb unmap
Subject: mm: change the interface for __tlb_remove_page()
Subject: mm/mmu_gather: track page size with mmu gather and force flush if page size change
Subject: mm: remove pointless struct in struct page definition
Subject: mm: clean up non-standard page->_mapcount users
Subject: mm: memcontrol: cleanup kmem charge functions
Subject: mm: charge/uncharge kmemcg from generic page allocator paths
Subject: mm: memcontrol: teach uncharge_list to deal with kmem pages
Subject: arch: x86: charge page tables to kmemcg
Subject: pipe: account to kmemcg
Subject: af_unix: charge buffers to kmemcg
Subject: mm,oom: remove unused argument from oom_scan_process_thread().
Subject: mm, frontswap: convert frontswap_enabled to static key
Subject: mm: add NR_ZSMALLOC to vmstat
Subject: include/linux/memblock.h: Clean up code for several trivial details
Subject: mm, oom_reaper: make sure that mmput_async is called only when memory was reaped
Subject: mm, memcg: use consistent gfp flags during readahead
Subject: mm/memblock.c:memblock_add_range(): if nr_new is 0 just return
Subject: mm: make optimistic check for swapin readahead
Subject: mm: make swapin readahead to improve thp collapse rate
Subject: mm, thp: make swapin readahead under down_read of mmap_sem
Subject: mm, thp: fix locking inconsistency in collapse_huge_page
Subject: khugepaged: recheck pmd after mmap_sem re-acquired
Subject: thp, mlock: update unevictable-lru.txt
Subject: mm: do not pass mm_struct into handle_mm_fault
Subject: mm: introduce fault_env
Subject: mm: postpone page table allocation until we have page to map
Subject: rmap: support file thp
Subject: mm: introduce do_set_pmd()
Subject: thp, vmstats: add counters for huge file pages
Subject: thp: support file pages in zap_huge_pmd()
Subject: thp: handle file pages in split_huge_pmd()
Subject: thp: handle file COW faults
Subject: thp: skip file huge pmd on copy_huge_pmd()
Subject: thp: prepare change_huge_pmd() for file thp
Subject: thp: run vma_adjust_trans_huge() outside i_mmap_rwsem
Subject: thp: file pages support for split_huge_page()
Subject: thp, mlock: do not mlock PTE-mapped file huge pages
Subject: vmscan: split file huge pages before paging them out
Subject: page-flags: relax policy for PG_mappedtodisk and PG_reclaim
Subject: radix-tree: implement radix_tree_maybe_preload_order()
Subject: filemap: prepare find and delete operations for huge pages
Subject: truncate: handle file thp
Subject: mm, rmap: account shmem thp pages
Subject: shmem: prepare huge= mount option and sysfs knob
Subject: shmem: get_unmapped_area align huge page
Subject: shmem: add huge pages support
Subject: shmem, thp: respect MADV_{NO,}HUGEPAGE for file mappings
Subject: thp: extract khugepaged from mm/huge_memory.c
Subject: khugepaged: move up_read(mmap_sem) out of khugepaged_alloc_page()
Subject: shmem: make shmem_inode_info::lock irq-safe
Subject: khugepaged: add support of collapse for tmpfs/shmem pages
Subject: thp: introduce CONFIG_TRANSPARENT_HUGE_PAGECACHE
Subject: shmem: split huge pages beyond i_size under memory pressure
Subject: thp: update Documentation/{vm/transhuge,filesystems/proc}.txt
Subject: mm, thp: fix comment inconsistency for swapin readahead functions
Subject: mm, thp: convert from optimistic swapin collapsing to conservative
Subject: mm: fix build warnings in <linux/compaction.h>
Subject: mm: memcontrol: remove BUG_ON in uncharge_list
Subject: mm: memcontrol: fix documentation for compound parameter
Subject: cgroup: fix idr leak for the first cgroup root
Subject: cgroup: remove unnecessary 0 check from css_from_id()
Subject: thp: fix comments of __pmd_trans_huge_lock()
[-- Attachment #2: Type: application/pgp-signature, Size: 836 bytes --]
^ permalink raw reply [flat|nested] 232+ messages in thread
* incoming
@ 2016-07-28 22:42 Andrew Morton
0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2016-07-28 22:42 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits
[-- Attachment #1: Type: text/plain, Size: 6861 bytes --]
- the rest of MM
101 patches, based on 194dc870a5890e855ecffb30f3b80ba7c88f96d6:
Subject: proc, oom: drop bogus task_lock and mm check
Subject: proc, oom: drop bogus sighand lock
Subject: proc, oom_adj: extract oom_score_adj setting into a helper
Subject: mm, oom_adj: make sure processes sharing mm have same view of oom_score_adj
Subject: mm, oom: skip vforked tasks from being selected
Subject: mm, oom: kill all tasks sharing the mm
Subject: mm, oom: fortify task_will_free_mem()
Subject: mm, oom: task_will_free_mem should skip oom_reaped tasks
Subject: mm, oom_reaper: do not attempt to reap a task more than twice
Subject: mm, oom: hide mm which is shared with kthread or global init
Subject: mm, oom: tighten task_will_free_mem() locking
Subject: mm: update the comment in __isolate_free_page
Subject: mm: fix vm-scalability regression in cgroup-aware workingset code
Subject: mm/compaction: remove unnecessary order check in try_to_compact_pages()
Subject: freezer, oom: check TIF_MEMDIE on the correct task
Subject: cpuset, mm: fix TIF_MEMDIE check in cpuset_change_task_nodemask
Subject: mm, meminit: remove early_page_nid_uninitialised
Subject: mm, vmstat: add infrastructure for per-node vmstats
Subject: mm, vmscan: move lru_lock to the node
Subject: mm, vmscan: move LRU lists to node
Subject: mm, mmzone: clarify the usage of zone padding
Subject: mm, vmscan: begin reclaiming pages on a per-node basis
Subject: mm, vmscan: have kswapd only scan based on the highest requested zone
Subject: mm, vmscan: make kswapd reclaim in terms of nodes
Subject: mm, vmscan: remove balance gap
Subject: mm, vmscan: simplify the logic deciding whether kswapd sleeps
Subject: mm, vmscan: by default have direct reclaim only shrink once per node
Subject: mm, vmscan: remove duplicate logic clearing node congestion and dirty state
Subject: mm: vmscan: do not reclaim from kswapd if there is any eligible zone
Subject: mm, vmscan: make shrink_node decisions more node-centric
Subject: mm, memcg: move memcg limit enforcement from zones to nodes
Subject: mm, workingset: make working set detection node-aware
Subject: mm, page_alloc: consider dirtyable memory in terms of nodes
Subject: mm: move page mapped accounting to the node
Subject: mm: rename NR_ANON_PAGES to NR_ANON_MAPPED
Subject: mm: move most file-based accounting to the node
Subject: mm: move vmscan writes and file write accounting to the node
Subject: mm, vmscan: only wakeup kswapd once per node for the requested classzone
Subject: mm, page_alloc: wake kswapd based on the highest eligible zone
Subject: mm: convert zone_reclaim to node_reclaim
Subject: mm, vmscan: avoid passing in classzone_idx unnecessarily to shrink_node
Subject: mm, vmscan: avoid passing in classzone_idx unnecessarily to compaction_ready
Subject: mm, vmscan: avoid passing in `remaining' unnecessarily to prepare_kswapd_sleep()
Subject: mm, vmscan: Have kswapd reclaim from all zones if reclaiming and buffer_heads_over_limit
Subject: mm, vmscan: add classzone information to tracepoints
Subject: mm, page_alloc: remove fair zone allocation policy
Subject: mm: page_alloc: cache the last node whose dirty limit is reached
Subject: mm: vmstat: replace __count_zone_vm_events with a zone id equivalent
Subject: mm: vmstat: account per-zone stalls and pages skipped during reclaim
Subject: mm, vmstat: print node-based stats in zoneinfo file
Subject: mm, vmstat: remove zone and node double accounting by approximating retries
Subject: mm, page_alloc: fix dirtyable highmem calculation
Subject: mm, pagevec: release/reacquire lru_lock on pgdat change
Subject: mm: show node_pages_scanned per node, not zone
Subject: mm, vmscan: Update all zone LRU sizes before updating memcg
Subject: mm, vmscan: remove redundant check in shrink_zones()
Subject: mm, vmscan: release/reacquire lru_lock on pgdat change
Subject: mm: add per-zone lru list stat
Subject: mm, vmscan: remove highmem_file_pages
Subject: mm: remove reclaim and compaction retry approximations
Subject: mm: consider whether to decivate based on eligible zones inactive ratio
Subject: mm, vmscan: account for skipped pages as a partial scan
Subject: mm: bail out in shrink_inactive_list()
Subject: mm/zsmalloc: use obj_index to keep consistent with others
Subject: mm/zsmalloc: take obj index back from find_alloced_obj
Subject: mm/zsmalloc: use class->objs_per_zspage to get num of max objects
Subject: mm/zsmalloc: avoid calculate max objects of zspage twice
Subject: mm/zsmalloc: keep comments consistent with code
Subject: mm/zsmalloc: add __init,__exit attribute
Subject: mm/zsmalloc: use helper to clear page->flags bit
Subject: mm, THP: clean up return value of madvise_free_huge_pmd
Subject: memblock: include <asm/sections.h> instead of <asm-generic/sections.h>
Subject: mm: CONFIG_ZONE_DEVICE stop depending on CONFIG_EXPERT
Subject: mm: cleanup ifdef guards for vmem_altmap
Subject: mm: track NR_KERNEL_STACK in KiB instead of number of stacks
Subject: mm: fix memcg stack accounting for sub-page stacks
Subject: kdb: use task_cpu() instead of task_thread_info()->cpu
Subject: printk: when dumping regs, show the stack, not thread_info
Subject: mm/memblock.c: add new infrastructure to address the mem limit issue
Subject: arm64:acpi: fix the acpi alignment exception when 'mem=' specified
Subject: kmemleak: don't hang if user disables scanning early
Subject: make __section_nr() more efficient
Subject: mm: hwpoison: remove incorrect comments
Subject: mm, compaction: don't isolate PageWriteback pages in MIGRATE_SYNC_LIGHT mode
Subject: Revert "mm, mempool: only set __GFP_NOMEMALLOC if there are free elements"
Subject: mm: add cond_resched() to generic_swapfile_activate()
Subject: mm: optimize copy_page_to/from_iter_iovec
Subject: mem-hotplug: alloc new page from a nearest neighbor node when mem-offline
Subject: mm/memblock.c: fix index adjustment error in __next_mem_range_rev()
Subject: zsmalloc: Delete an unnecessary check before the function call "iput"
Subject: mm: fix use-after-free if memory allocation failed in vma_adjust()
Subject: mm, kasan: account for object redzone in SLUB's nearest_obj()
Subject: mm, kasan: switch SLUB to stackdepot, enable memory quarantine for SLUB
Subject: lib/stackdepot.c: use __GFP_NOWARN for stack allocations
Subject: mm, page_alloc: set alloc_flags only once in slowpath
Subject: mm, page_alloc: don't retry initial attempt in slowpath
Subject: mm, page_alloc: restructure direct compaction handling in slowpath
Subject: mm, page_alloc: make THP-specific decisions more generic
Subject: mm, thp: remove __GFP_NORETRY from khugepaged and madvised allocations
Subject: mm, compaction: introduce direct compaction priority
Subject: mm, compaction: simplify contended compaction handling
[-- Attachment #2: Type: application/pgp-signature, Size: 836 bytes --]
^ permalink raw reply [flat|nested] 232+ messages in thread
* incoming
@ 2016-08-02 21:01 Andrew Morton
0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2016-08-02 21:01 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits
[-- Attachment #1: Type: text/plain, Size: 7166 bytes --]
- the rest of ocfs2
- various hotfixes, mainly MM
- quite a bit of misc stuff - drivers, fork, exec, signals, etc.
- printk updates
- firmware
- checkpatch
- nilfs2
- more kexec stuff than usual
- rapidio updates
- w1 things
111 patches, based on f7b32e4c021fd788f13f6785e17efbc3eb05b351:
Subject: ocfs2: ensure that dlm lockspace is created by kernel module
Subject: ocfs2: retry on ENOSPC if sufficient space in truncate log
Subject: ocfs2/dlm: disable BUG_ON when DLM_LOCK_RES_DROPPING_REF is cleared before dlm_deref_lockres_done_handler
Subject: ocfs2/dlm: solve a BUG when deref failed in dlm_drop_lockres_ref
Subject: ocfs2/dlm: continue to purge recovery lockres when recovery master goes down
Subject: mm: fail prefaulting if page table allocation fails
Subject: mm: move swap-in anonymous page into active list
Subject: tools/testing/radix-tree/linux/gfp.h: fix bitrotted value
Subject: mm/hugetlb: avoid soft lockup in set_max_huge_pages()
Subject: mm, hugetlb: fix huge_pte_alloc BUG_ON
Subject: memcg: put soft limit reclaim out of way if the excess tree is empty
Subject: mm/kasan: fix corruptions and false positive reports
Subject: mm/kasan: don't reduce quarantine in atomic contexts
Subject: mm/kasan, slub: don't disable interrupts when object leaves quarantine
Subject: mm/kasan: get rid of ->alloc_size in struct kasan_alloc_meta
Subject: mm/kasan: get rid of ->state in struct kasan_alloc_meta
Subject: kasan: improve double-free reports
Subject: kasan: avoid overflowing quarantine size on low memory systems
Subject: radix-tree: account nodes to memcg only if explicitly requested
Subject: mm: vmscan: fix memcg-aware shrinkers not called on global reclaim
Subject: sysv, ipc: fix security-layer leaking
Subject: UBSAN: fix typo in format string
Subject: cgroup: update cgroup's document path
Subject: MAINTAINERS: befs: add new maintainers
Subject: proc_oom_score: remove tasklist_lock and pid_alive()
Subject: procfs: avoid 32-bit time_t in /proc/*/stat
Subject: fs/proc/task_mmu.c: suppress compilation warnings with W=1
Subject: init/Kconfig: make COMPILE_TEST depend on !UML
Subject: memstick: don't allocate unused major for ms_block
Subject: treewide: replace obsolete _refok by __ref
Subject: uapi: move forward declarations of internal structures
Subject: mailmap: add Linus L_ssing
Subject: include: mman: use bool instead of int for the return value of arch_validate_prot
Subject: task_work: use READ_ONCE/lockless_dereference, avoid pi_lock if !task_works
Subject: dynamic_debug: only add header when used
Subject: printk: do not include interrupt.h
Subject: printk: create pr_<level> functions
Subject: printk: introduce suppress_message_printing()
Subject: printk: include <asm/sections.h> instead of <asm-generic/sections.h>
Subject: fbdev/bfin_adv7393fb: move DRIVER_NAME before its first use
Subject: ratelimit: extend to print suppressed messages on release
Subject: printk: add kernel parameter to control writes to /dev/kmsg
Subject: get_maintainer.pl: reduce need for command-line option -f
Subject: lib/iommu-helper: skip to next segment
Subject: crc32: use ktime_get_ns() for measurement
Subject: radix-tree: fix comment about "exceptional" bits
Subject: firmware: consolidate kmap/read/write logic
Subject: firmware: provide infrastructure to make fw caching optional
Subject: firmware: support loading into a pre-allocated buffer
Subject: checkpatch: skip long lines that use an EFI_GUID macro
Subject: checkpatch: allow c99 style // comments
Subject: checkpatch: yet another commit id improvement
Subject: checkpatch: don't complain about BIT macro in uapi
Subject: checkpatch: improve 'bare use of' signed/unsigned types warning
Subject: checkpatch: check signoff when reading stdin
Subject: checkpatch: if no filenames then read stdin
Subject: binfmt_elf: fix calculations for bss padding
Subject: mm: refuse wrapped vm_brk requests
Subject: fs/binfmt_em86.c: fix incompatible pointer type
Subject: nilfs2: hide function name argument from nilfs_error()
Subject: nilfs2: add nilfs_msg() message interface
Subject: nilfs2: embed a back pointer to super block instance in nilfs object
Subject: nilfs2: reduce bare use of printk() with nilfs_msg()
Subject: nilfs2: replace nilfs_warning() with nilfs_msg()
Subject: nilfs2: emit error message when I/O error is detected
Subject: nilfs2: do not use yield()
Subject: nilfs2: refactor parser of snapshot mount option
Subject: nilfs2: fix misuse of a semaphore in sysfs code
Subject: nilfs2: use BIT() macro
Subject: nilfs2: move ioctl interface and disk layout to uapi separately
Subject: reiserfs: fix "new_insert_key may be used uninitialized ..."
Subject: signal: consolidate {TS,TLF}_RESTORE_SIGMASK code
Subject: kernel/exit.c: quieten greatest stack depth printk
Subject: cpumask: fix code comment
Subject: kexec: return error number directly
Subject: ARM: kdump: advertise boot aliased crash kernel resource
Subject: ARM: kexec: advertise location of bootable RAM
Subject: kexec: don't invoke OOM-killer for control page allocation
Subject: kexec: ensure user memory sizes do not wrap
Subject: kdump: arrange for paddr_vmcoreinfo_note() to return phys_addr_t
Subject: kexec: allow architectures to override boot mapping
Subject: ARM: keystone: dts: add psci command definition
Subject: ARM: kexec: fix kexec for Keystone 2
Subject: kexec: use core_param for crash_kexec_post_notifiers boot option
Subject: kexec: add a kexec_crash_loaded() function
Subject: kexec: allow kdump with crash_kexec_post_notifiers
Subject: kexec: add restriction on kexec_load() segment sizes
Subject: rapidio: add RapidIO channelized messaging driver
Subject: rapidio: remove unnecessary 0x prefixes before %pa extension uses
Subject: rapidio/documentation: fix mangled paragraph in mport_cdev
Subject: rapidio: fix return value description for dma_prep functions
Subject: rapidio/tsi721_dma: add channel mask and queue size parameters
Subject: rapidio/tsi721: add PCIe MRRS override parameter
Subject: rapidio/tsi721: add messaging mbox selector parameter
Subject: rapidio/tsi721_dma: advance queue processing from transfer submit call
Subject: rapidio: fix error handling in mbox request/release functions
Subject: rapidio/idt_gen2: fix locking warning
Subject: rapidio: change inbound window size type to u64
Subject: rapidio: modify for rev.3 specification changes
Subject: powerpc/fsl_rio: apply changes for RIO spec rev 3
Subject: rapidio/switches: add driver for IDT gen3 switches
Subject: w1: remove need for ida and use PLATFORM_DEVID_AUTO
Subject: w1: add helper macro module_w1_family
Subject: w1:omap_hdq: fix regression
Subject: init: allow blacklisting of module_init functions
Subject: relay: add global mode support for buffer-only channels
Subject: init/Kconfig: ban CONFIG_LOCALVERSION_AUTO with allmodconfig
Subject: config: add android config fragments
Subject: init/Kconfig: add clarification for out-of-tree modules
Subject: kcov: allow more fine-grained coverage instrumentation
Subject: ipc: delete "nr_ipc_ns"
[-- Attachment #2: Type: application/pgp-signature, Size: 836 bytes --]
^ permalink raw reply [flat|nested] 232+ messages in thread
* incoming
@ 2016-08-03 20:45 Andrew Morton
0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2016-08-03 20:45 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits
[-- Attachment #1: Type: text/plain, Size: 1288 bytes --]
- dma-mapping API cleanup
- a few cleanups and misc things
- use jump labels in dynamic-debug
18 patches, based on bf0f500bd0199aab613eb0ecb3412edd5472740d:
Subject: drivers/fpga/Kconfig: fix build failure
Subject: tree-wide: replace config_enabled() with IS_ENABLED()
Subject: include/linux/bitmap.h: cleanup
Subject: media: mtk-vcodec: remove unused dma_attrs
Subject: dma-mapping: use unsigned long for dma_attrs
Subject: samples/kprobe: convert the printk to pr_info/pr_err
Subject: samples/jprobe: convert the printk to pr_info/pr_err
Subject: samples/kretprobe: convert the printk to pr_info/pr_err
Subject: samples/kretprobe: fix the wrong type
Subject: block: remove BLK_DEV_DAX config option
Subject: MAINTAINERS: update email and list of Samsung HW driver maintainers
Subject: drivers/media/dvb-frontends/cxd2841er.c: avoid misleading gcc warning
Subject: powerpc: add explicit #include <asm/asm-compat.h> for jump label
Subject: sparc: support static_key usage in non-module __exit sections
Subject: tile: support static_key usage in non-module __exit sections
Subject: arm: jump label may reference text in __exit
Subject: jump_label: remove bug.h, atomic.h dependencies for HAVE_JUMP_LABEL
Subject: dynamic_debug: add jump label support
[-- Attachment #2: Type: application/pgp-signature, Size: 836 bytes --]
^ permalink raw reply [flat|nested] 232+ messages in thread
* incoming
@ 2016-08-04 22:31 Andrew Morton
0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2016-08-04 22:31 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits
A few late-breaking fixes.
7 fixes, based on c1ece76719205690f4b448460d9b85c130e8021b:
Subject: mm: disable CONFIG_MEMORY_HOTPLUG when KASAN is enabled
Subject: mm/memblock: fix a typo in a comment
Subject: mm: initialise per_cpu_nodestats for all online pgdats at boot
Subject: powerpc/fsl_rio: fix a missing error code
Subject: slub: drop bogus inline for fixup_red_left()
Subject: MAINTAINERS: update cgroup's document path
Subject: mm/memblock.c: fix NULL dereference error
^ permalink raw reply [flat|nested] 232+ messages in thread
* incoming
@ 2016-08-11 22:32 Andrew Morton
0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2016-08-11 22:32 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits
[-- Attachment #1: Type: text/plain, Size: 579 bytes --]
7 fixes, based on 85e97be32c6242c98dbbc7a241b4a78c1b93327b:
Subject: mm/hugetlb: fix incorrect hugepages count during mem hotplug
Subject: proc, meminfo: use correct helpers for calculating LRU sizes in meminfo
Subject: mm: memcontrol: fix swap counter leak on swapout from offline cgroup
Subject: mm: memcontrol: fix memcg id ref counter on swap charge move
Subject: kasan: remove the unnecessary WARN_ONCE from quarantine.c
Subject: mm, oom: fix uninitialized ret in task_will_free_mem()
Subject: mm/memory_hotplug.c: initialize per_cpu_nodestats for hotadded pgdats
[-- Attachment #2: Type: application/pgp-signature, Size: 836 bytes --]
^ permalink raw reply [flat|nested] 232+ messages in thread
* incoming
@ 2016-08-25 22:16 Andrew Morton
0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2016-08-25 22:16 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits
[-- Attachment #1: Type: text/plain, Size: 738 bytes --]
12 fixes, based on 61c04572de404e52a655a36752e696bbcb483cf5:
Subject: byteswap: don't use __builtin_bswap*() with sparse
Subject: get_maintainer: quiet noisy implicit -f vcs_file_exists checking
Subject: sysctl: handle error writing UINT_MAX to u32 fields
Subject: stackdepot: fix mempolicy use-after-free
Subject: soft_dirty: fix soft_dirty during THP split
Subject: printk: fix parsing of "brl=" option
Subject: treewide: replace config_enabled() with IS_ENABLED() (2nd round)
Subject: mm: clarify COMPACTION Kconfig text
Subject: mm: memcontrol: avoid unused function warning
Subject: fs/seq_file: fix out-of-bounds read
Subject: dax: fix device-dax region base
Subject: mm: silently skip readahead for DAX inodes
[-- Attachment #2: Type: application/pgp-signature, Size: 836 bytes --]
^ permalink raw reply [flat|nested] 232+ messages in thread
* incoming
@ 2016-09-01 23:14 Andrew Morton
0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2016-09-01 23:14 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits
[-- Attachment #1: Type: text/plain, Size: 1144 bytes --]
14 fixes, based on 071e31e254e0e0c438eecba3dba1d6e2d0da36c2:
Subject: mm, oom: prevent premature OOM killer invocation for high order request
Subject: kexec: fix double-free when failing to relocate the purgatory
Subject: kconfig: tinyconfig: provide whole choice blocks to avoid warnings
Subject: lib/test_hash.c: fix warning in two-dimensional array init
Subject: lib/test_hash.c: fix warning in preprocessor symbol evaluation
Subject: mm, vmscan: only allocate and reclaim from zones with pages managed by the buddy allocator
Subject: drivers/scsi/wd719x.c: remove last declaration using DEFINE_PCI_DEVICE_TABLE
Subject: treewide: remove references to the now unnecessary DEFINE_PCI_DEVICE_TABLE
Subject: printk/nmi: avoid direct printk()-s from __printk_nmi_flush()
Subject: mm, mempolicy: task->mempolicy must be NULL before dropping final reference
Subject: MAINTAINERS: Vladimir has moved
Subject: kernel/fork: fix CLONE_CHILD_CLEARTID regression in nscd
Subject: rapidio/documentation/mport_cdev: add missing parameter description
Subject: rapidio/tsi721: fix incorrect detection of address translation condition
[-- Attachment #2: Type: application/pgp-signature, Size: 836 bytes --]
^ permalink raw reply [flat|nested] 232+ messages in thread
* incoming
@ 2016-09-19 21:43 Andrew Morton
0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2016-09-19 21:43 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits
[-- Attachment #1: Type: text/plain, Size: 1326 bytes --]
20 fixes, based on 3be7988674ab33565700a37b210f502563d932e6:
Subject: mem-hotplug: don't clear the only node in new_node_page()
Subject: ocfs2/dlm: fix race between convert and migration
Subject: MAINTAINERS: Maik has moved
Subject: khugepaged: fix use-after-free in collapse_huge_page()
Subject: mm, thp: fix leaking mapped pte in __collapse_huge_page_swapin()
Subject: mm: avoid endless recursion in dump_page()
Subject: MAINTAINERS: update email for VLYNQ bus entry
Subject: autofs: use dentry flags to block walks during expire
Subject: mm: fix the page_swap_info() BUG_ON check
Subject: ipc/shm: fix crash if CONFIG_SHMEM is not set
Subject: ocfs2: fix trans extend while flush truncate log
Subject: ocfs2: fix trans extend while free cached blocks
Subject: fsnotify: add a way to stop queueing events on group shutdown
Subject: fanotify: fix list corruption in fanotify_get_response()
Subject: ocfs2: fix double unlock in case retry after free truncate log
Subject: mm: memcontrol: make per-cpu charge cache IRQ-safe for socket accounting
Subject: cgroup: duplicate cgroup reference when cloning sockets
Subject: ocfs2: fix start offset to ocfs2_zero_range_for_truncate()
Subject: Revert "ocfs2: bump up o2cb network protocol version"
Subject: rapidio/rio_cm: avoid GFP_KERNEL in atomic context
[-- Attachment #2: Type: application/pgp-signature, Size: 836 bytes --]
^ permalink raw reply [flat|nested] 232+ messages in thread
* incoming
@ 2016-09-28 22:22 Andrew Morton
0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2016-09-28 22:22 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits
[-- Attachment #1: Type: text/plain, Size: 393 bytes --]
5 fixes, based on 8ab293e3a1376574e11f9059c09cc0db212546cb:
Subject: mm,ksm: fix endless looping in allocating memory when ksm enable
Subject: dma-mapping.h: preserve unmap info for CONFIG_DMA_API_DEBUG
Subject: scripts/recordmcount.c: account for .softirqentry.text
Subject: mem-hotplug: use nodes that contain memory as mask in new_node_page()
Subject: MAINTAINERS: Mark has moved
[-- Attachment #2: Type: application/pgp-signature, Size: 836 bytes --]
^ permalink raw reply [flat|nested] 232+ messages in thread
* incoming
@ 2016-09-30 22:11 Andrew Morton
0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2016-09-30 22:11 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits
[-- Attachment #1: Type: text/plain, Size: 338 bytes --]
4 fixes, based on e3b3656ca63e23b5755183718df36fb9ff518b02:
Subject: mm: workingset: fix crash in shadow node shrinker caused by replace_page_cache_page()
Subject: ocfs2: fix deadlock on mmapped page in ocfs2_write_begin_nolock()
Subject: include/linux/property.h: fix typo/compile error
Subject: MAINTAINERS: Javi has moved
[-- Attachment #2: Type: application/pgp-signature, Size: 836 bytes --]
^ permalink raw reply [flat|nested] 232+ messages in thread
* incoming
@ 2016-10-07 23:53 Andrew Morton
0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2016-10-07 23:53 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits
- fsnotify updates
- ocfs2 updates
- all of MM
127 patches, based on 87840a2b7e048018d18d60bdac5c09224de85370:
Subject: fsnotify: drop notification_mutex before destroying event
Subject: fsnotify: convert notification_mutex to a spinlock
Subject: fanotify: use notification_lock instead of access_lock
Subject: fanotify: fix possible false warning when freeing events
Subject: fsnotify: clean up spinlock assertions
Subject: jiffies: add time comparison functions for 64 bit jiffies
Subject: fs/ocfs2/dlmfs: remove deprecated create_singlethread_workqueue()
Subject: fs/ocfs2/cluster: remove deprecated create_singlethread_workqueue()
Subject: fs/ocfs2/super: remove deprecated create_singlethread_workqueue()
Subject: fs/ocfs2/dlm: remove deprecated create_singlethread_workqueue()
Subject: ocfs2: fix undefined struct variable in inode.h
Subject: mm: oom: deduplicate victim selection code for memcg and global oom
Subject: mm/vmalloc.c: fix align value calculation error
Subject: mm: memcontrol: add sanity checks for memcg->id.ref on get/put
Subject: mm/oom_kill.c: fix task_will_free_mem() comment
Subject: mm, compaction: make whole_zone flag ignore cached scanner positions
Subject: mm, compaction: cleanup unused functions
Subject: mm, compaction: rename COMPACT_PARTIAL to COMPACT_SUCCESS
Subject: mm, compaction: don't recheck watermarks after COMPACT_SUCCESS
Subject: mm, compaction: add the ultimate direct compaction priority
Subject: mm, compaction: use correct watermark when checking compaction success
Subject: mm, compaction: create compact_gap wrapper
Subject: mm, compaction: use proper alloc_flags in __compaction_suitable()
Subject: mm, compaction: require only min watermarks for non-costly orders
Subject: mm, vmscan: make compaction_ready() more accurate and readable
Subject: mem-hotplug: fix node spanned pages when we have a movable node
Subject: mm: fix set pageblock migratetype in deferred struct page init
Subject: mm, vmscan: get rid of throttle_vm_writeout
Subject: mm/debug_pagealloc.c: clean-up guard page handling code
Subject: mm/debug_pagealloc.c: don't allocate page_ext if we don't use guard page
Subject: mm/page_owner: move page_owner specific function to page_owner.c
Subject: mm/page_ext: rename offset to index
Subject: mm/page_ext: support extra space allocation by page_ext user
Subject: mm/page_owner: don't define fields on struct page_ext by hard-coding
Subject: do_generic_file_read(): fail immediately if killed
Subject: mm: pagewalk: fix the comment for test_walk
Subject: mm: unrig VMA cache hit ratio
Subject: mm, swap: add swap_cluster_list
Subject: mm,oom_reaper: reduce find_lock_task_mm() usage
Subject: mm,oom_reaper: do not attempt to reap a task twice
Subject: oom: keep mm of the killed task available
Subject: kernel, oom: fix potential pgd_lock deadlock from __mmdrop
Subject: mm, oom: get rid of signal_struct::oom_victims
Subject: oom, suspend: fix oom_killer_disable vs. pm suspend properly
Subject: mm, oom: enforce exit_oom_victim on current task
Subject: mm: make sure that kthreads will not refault oom reaped memory
Subject: oom, oom_reaper: allow to reap mm shared by the kthreads
Subject: mm: use zonelist name instead of using hardcoded index
Subject: mm: introduce arch_reserved_kernel_pages()
Subject: mm/memblock.c: expose total reserved memory
Subject: powerpc: implement arch_reserved_kernel_pages
Subject: mm/nobootmem.c: remove duplicate macro ARCH_LOW_ADDRESS_LIMIT statements
Subject: mm/bootmem.c: replace kzalloc() by kzalloc_node()
Subject: mm: don't use radix tree writeback tags for pages in swap cache
Subject: oom: warn if we go OOM for higher order and compaction is disabled
Subject: mm: mlock: check against vma for actual mlock() size
Subject: mm: mlock: avoid increase mm->locked_vm on mlock() when already mlock2(,MLOCK_ONFAULT)
Subject: selftest: split mlock2_ funcs into separate mlock2.h
Subject: selftests/vm: add test for mlock() when areas are intersected
Subject: selftest: move seek_to_smaps_entry() out of mlock2-tests.c
Subject: selftests: expanding more mlock selftest
Subject: thp, dax: add thp_get_unmapped_area for pmd mappings
Subject: ext2/4, xfs: call thp_get_unmapped_area() for pmd mappings
Subject: cpu: fix node state for whether it contains CPU
Subject: fs/proc/task_mmu.c: make the task_mmu walk_page_range() limit in clear_refs_write() obvious
Subject: thp: reduce usage of huge zero page's atomic counter
Subject: mm/memcontrol.c: make the walk_page_range() limit obvious
Subject: memory-hotplug: fix store_mem_state() return value
Subject: mm: fix cache mode tracking in vm_insert_mixed()
Subject: mm, swap: use offset of swap entry as key of swap cache
Subject: mm: remove page_file_index
Subject: Revert "mm, oom: prevent premature OOM killer invocation for high order request"
Subject: mm, compaction: more reliably increase direct compaction priority
Subject: mm, compaction: restrict full priority to non-costly orders
Subject: mm, compaction: make full priority ignore pageblock suitability
Subject: mm, page_alloc: pull no_progress_loops update to should_reclaim_retry()
Subject: mm, compaction: ignore fragindex from compaction_zonelist_suitable()
Subject: mm, compaction: restrict fragindex to costly orders
Subject: mm: don't emit warning from pagefault_out_of_memory()
Subject: mm/page_io.c: replace some BUG_ON()s with VM_BUG_ON_PAGE()
Subject: mm: move phys_mem_access_prot_allowed() declaration to pgtable.h
Subject: mm: memcontrol: consolidate cgroup socket tracking
Subject: mm/shmem.c: constify anon_ops
Subject: mm: nobootmem: move the comment of free_all_bootmem
Subject: mm/hugetlb: fix memory offline with hugepage size > memory block size
Subject: mm/hugetlb: check for reserved hugepages during memory offline
Subject: mm/hugetlb: improve locking in dissolve_free_huge_pages()
Subject: mm/page_isolation: fix typo: "paes" -> "pages"
Subject: mm,ksm: add __GFP_HIGH to the allocation in alloc_stable_node()
Subject: mm: vm_page_prot: update with WRITE_ONCE/READ_ONCE
Subject: mm: vma_adjust: remove superfluous confusing update in remove_next == 1 case
Subject: mm: vma_merge: fix vm_page_prot SMP race condition against rmap_walk
Subject: mm: vma_adjust: remove superfluous check for next not NULL
Subject: mm: vma_adjust: minor comment correction
Subject: mm: vma_merge: correct false positive from __vma_unlink->validate_mm_rb
Subject: mm: clarify why we avoid page_mapcount() for slab pages in dump_page()
Subject: oom: print nodemask in the oom report
Subject: mm/hugetlb: introduce ARCH_HAS_GIGANTIC_PAGE
Subject: arm64 Kconfig: select gigantic page
Subject: vfs,mm: fix a dead loop in truncate_inode_pages_range()
Subject: mm: consolidate warn_alloc_failed users
Subject: mm: warn about allocations which stall for too long
Subject: mm: remove unnecessary condition in remove_inode_hugepages
Subject: linux/mm.h: canonicalize macro PAGE_ALIGNED() definition
Subject: ia64: implement atomic64_dec_if_positive
Subject: atomic64: no need for CONFIG_ARCH_HAS_ATOMIC64_DEC_IF_POSITIVE
Subject: proc: much faster /proc/vmstat
Subject: proc: faster /proc/*/status
Subject: seq/proc: modify seq_put_decimal_[u]ll to take a const char *, not char
Subject: meminfo: break apart a very long seq_printf with #ifdefs
Subject: proc: relax /proc/<tid>/timerslack_ns capability requirements
Subject: proc: add LSM hook checks to /proc/<tid>/timerslack_ns
Subject: proc: fix timerslack_ns CAP_SYS_NICE check when adjusting self
Subject: mm, proc: fix region lost in /proc/self/smaps
Subject: Documentation/filesystems/proc.txt: add more description for maps/smaps
Subject: min/max: remove sparse warnings when they're nested
Subject: nmi_backtrace: add more trigger_*_cpu_backtrace() methods
Subject: nmi_backtrace: do a local dump_stack() instead of a self-NMI
Subject: arch/tile: adopt the new nmi_backtrace framework
Subject: nmi_backtrace: generate one-line reports for idle cpus
Subject: spelling.txt: "modeled" is spelt correctly
Subject: uprobes: remove function declarations from arch/{mips,s390}
Subject: .gitattributes: set git diff driver for C source code files
Subject: mailmap: add Johan Hovold
Subject: CREDITS: update Pavel's information, add GPG key, remove snail mail address
Subject: cred: simpler, 1D supplementary groups
Subject: console: don't prefer first registered if DT specifies stdout-path
^ permalink raw reply [flat|nested] 232+ messages in thread
* incoming
@ 2016-10-11 20:49 Andrew Morton
0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2016-10-11 20:49 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits
- a few block updates that fell in my lap
- lib/ updates
- checkpatch
- autofs
- ipc
- A ton of misc other things
102 patches, based on 1689c73a739d094b544c680b0dfdebe52ffee8fb:
Subject: ocfs2: fix memory leak in dlm_migrate_request_handler()
Subject: block: invalidate the page cache when issuing BLKZEROOUT
Subject: block: require write_same and discard requests align to logical block size
Subject: block: implement (some of) fallocate for block devices
Subject: fs/select: add vmalloc fallback for select(2)
Subject: radix-tree: 'slot' can be NULL in radix_tree_next_slot()
Subject: radix-tree tests: add iteration test
Subject: radix-tree tests: properly initialize mutex
Subject: lib: harden strncpy_from_user
Subject: include/linux/ctype.h: make isdigit() table lookupless
Subject: lib/kstrtox.c: smaller _parse_integer()
Subject: lib/bitmap.c: enhance bitmap syntax
Subject: include/linux: provide a safe version of container_of()
Subject: llist: introduce llist_entry_safe()
Subject: checkpatch: see if modified files are marked obsolete in MAINTAINERS
Subject: checkpatch: look for symbolic permissions and suggest octal instead
Subject: checkpatch: test multiple line block comment alignment
Subject: checkpatch: don't test for prefer ether_addr_<foo>
Subject: checkpatch: externalize the structs that should be const
Subject: const_structs.checkpatch: add frequently used from Julia Lawall's list
Subject: checkpatch: speed up checking for filenames in sections marked obsolete
Subject: checkpatch: improve the block comment * alignment test
Subject: checkpatch: add --strict test for macro argument reuse
Subject: checkpatch: add --strict test for precedence challenged macro arguments
Subject: checkpatch: improve MACRO_ARG_PRECEDENCE test
Subject: checkpatch: add warning for unnamed function definition arguments
Subject: checkpatch: improve the octal permissions tests
Subject: kprobes: include <asm/sections.h> instead of <asm-generic/sections.h>
Subject: autofs: fix typos in Documentation/filesystems/autofs4.txt
Subject: autofs: drop unnecessary extern in autofs_i.h
Subject: autofs: test autofs versions first on sb initialization
Subject: autofs: fix autofs4_fill_super() error exit handling
Subject: autofs: add WARN_ON(1) for non dir/link inode case
Subject: autofs: remove ino free in autofs4_dir_symlink()
Subject: autofs: use autofs4_free_ino() to kfree dentry data
Subject: autofs: remove obsolete sb fields
Subject: autofs: don't fail to free_dev_ioctl(param)
Subject: autofs: remove AUTOFS_DEVID_LEN
Subject: autofs: fix Documentation regarding devid on ioctl
Subject: autofs: update struct autofs_dev_ioctl in Documentation
Subject: autofs: fix pr_debug() message
Subject: autofs: fix dev ioctl number range check
Subject: autofs: add autofs_dev_ioctl_version() for AUTOFS_DEV_IOCTL_VERSION_CMD
Subject: autofs: fix print format for ioctl warning message
Subject: autofs: move inclusion of linux/limits.h to uapi
Subject: autofs4: move linux/auto_dev-ioctl.h to uapi/linux
Subject: autofs: remove possibly misleading /* #define DEBUG */
Subject: autofs: refactor ioctl fn vector in iookup_dev_ioctl()
Subject: pipe: relocate round_pipe_size() above pipe_set_size()
Subject: pipe: move limit checking logic into pipe_set_size()
Subject: pipe: refactor argument for account_pipe_buffers()
Subject: pipe: fix limit checking in pipe_set_size()
Subject: pipe: simplify logic in alloc_pipe_info()
Subject: pipe: fix limit checking in alloc_pipe_info()
Subject: pipe: make account_pipe_buffers() return a value, and use it
Subject: pipe: cap initial pipe capacity according to pipe-max-size limit
Subject: ptrace: clear TIF_SYSCALL_TRACE on ptrace detach
Subject: rapidio/rio_cm: use memdup_user() instead of duplicating code
Subject: random: simplify API for random address requests
Subject: x86: use simpler API for random address requests
Subject: ARM: use simpler API for random address requests
Subject: arm64: use simpler API for random address requests
Subject: tile: use simpler API for random address requests
Subject: unicore32: use simpler API for random address requests
Subject: random: remove unused randomize_range()
Subject: dma-mapping: introduce the DMA_ATTR_NO_WARN attribute
Subject: powerpc: implement the DMA_ATTR_NO_WARN attribute
Subject: nvme: use the DMA_ATTR_NO_WARN attribute
Subject: x86/panic: replace smp_send_stop() with kdump friendly version in panic path
Subject: mips/panic: replace smp_send_stop() with kdump friendly version in panic path
Subject: pps: kc: fix non-tickless system config dependency
Subject: relay: Use irq_work instead of plain timer for deferred wakeup
Subject: config/android: Remove CONFIG_IPV6_PRIVACY
Subject: config: android: move device mapper options to recommended
Subject: config: android: set SELinux as default security mode
Subject: config: android: enable CONFIG_SECCOMP
Subject: kcov: do not instrument lib/stackdepot.c
Subject: ipc/sem.c: fix complex_count vs. simple op race
Subject: ipc/msg: implement lockless pipelined wakeups
Subject: ipc/msg: batch queue sender wakeups
Subject: ipc/msg: make ss_wakeup() kill arg boolean
Subject: ipc/msg: avoid waking sender upon full queue
Subject: ipc/sem.c: Add cond_resched in exit_sme
Subject: kdump, vmcoreinfo: report memory sections virtual addresses
Subject: mm: kmemleak: avoid using __va() on addresses that don't have a lowmem mapping
Subject: scripts/tags.sh: enable code completion in VIM
Subject: kthread: rename probe_kthread_data() to kthread_probe_data()
Subject: kthread: kthread worker API cleanup
Subject: kthread/smpboot: do not park in kthread_create_on_cpu()
Subject: kthread: allow to call __kthread_create_on_node() with va_list args
Subject: kthread: add kthread_create_worker*()
Subject: kthread: add kthread_destroy_worker()
Subject: kthread: detect when a kthread work is used by more workers
Subject: kthread: initial support for delayed kthread work
Subject: kthread: allow to cancel kthread work
Subject: kthread: allow to modify delayed kthread work
Subject: kthread: better support freezable kthread workers
Subject: kthread: add kerneldoc for kthread_create()
Subject: hung_task: allow hung_task_panic when hung_task_warnings is 0
Subject: treewide: remove redundant #include <linux/kconfig.h>
Subject: fs: use mapping_set_error instead of opencoded set_bit
Subject: mm: split gfp_mask and mapping flags into separate fields
^ permalink raw reply [flat|nested] 232+ messages in thread
* incoming
@ 2016-11-10 18:45 Andrew Morton
0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2016-11-10 18:45 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits
15 fixes, based on 27bcd37e0240bbe33f0efe244b5aad52104115b3:
Subject: mm: remove extra newline from allocation stall warning
Subject: mm, frontswap: make sure allocated frontswap map is assigned
Subject: shmem: fix pageflags after swapping DMA32 object
Subject: scripts/bloat-o-meter: fix SIGPIPE
Subject: mm/cma.c: check the max limit for cma allocation
Subject: swapfile: fix memory corruption via malformed swapfile
Subject: mm: hwpoison: fix thp split handling in memory_failure()
Subject: Revert "console: don't prefer first registered if DT specifies stdout-path"
Subject: ocfs2: fix not enough credit panic
Subject: mm/hugetlb: fix huge page reservation leak in private mapping error paths
Subject: mm/filemap: don't allow partially uptodate page for pipes
Subject: coredump: fix unfreezable coredumping task
Subject: memcg: prevent memcg caches to be both OFF_SLAB & OBJFREELIST_SLAB
Subject: mm: kmemleak: scan .data.ro_after_init
Subject: lib/stackdepot: export save/fetch stack for drivers
^ permalink raw reply [flat|nested] 232+ messages in thread
* incoming
@ 2016-11-30 23:53 Andrew Morton
0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2016-11-30 23:53 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits
7 fixes, based on ded6e842cf499ef04b0d611d92b859d5b846c497:
Subject: mm, thp: propagation of conditional compilation in khugepaged.c
Subject: thp: fix corner case of munlock() of PTE-mapped THPs
Subject: zram: fix unbalanced idr management at hot removal
Subject: lib/debugobjects: export for use in modules
Subject: kasan: update kasan_global for gcc 7
Subject: kasan: support use-after-scope detection
Subject: mm: fix false-positive WARN_ON() in truncate/invalidate for hugetlb
^ permalink raw reply [flat|nested] 232+ messages in thread
* incoming
@ 2016-12-03 1:26 Andrew Morton
0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2016-12-03 1:26 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits
2 fixes, based on 8dc0f265d39a3933f4c1f846c7c694f12a2ab88a:
Subject: mm: workingset: fix NULL ptr in count_shadow_nodes
Subject: mm, vmscan: add cond_resched() into shrink_node_memcg()
^ permalink raw reply [flat|nested] 232+ messages in thread
* incoming
@ 2016-12-07 22:44 Andrew Morton
0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2016-12-07 22:44 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits
3 fixes, based on ea5a9eff96fed8252f3a8c94a84959f981a93cae:
Subject: zram: restrict add/remove attributes to root only
Subject: radix tree test suite: fix compilation
Subject: kcov: add missing #include <linux/sched.h>
^ permalink raw reply [flat|nested] 232+ messages in thread
* incoming
@ 2016-12-13 0:40 Andrew Morton
0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2016-12-13 0:40 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits
- various misc bits
- most of MM (quite a lot of MM material is awaiting the merge of
linux-next dependencies)
- kasan
- printk updates
- procfs updates
- MAINTAINERS
- /lib updates
- checkpatch updates
123 patches, based on df5f0f0a028c9bf43949398a175dbaafaf513e14:
Subject: kthread: add __printf attributes
Subject: prctl: remove one-shot limitation for changing exe link
Subject: scripts/bloat-o-meter: don't use readlines()
Subject: scripts/bloat-o-meter: compile .NUMBER regex
Subject: scripts/tags.sh: handle OMAP platforms properly
Subject: m32r: add simple dma
Subject: m32r: fix build warning
Subject: drivers/pcmcia/m32r_pcc.c: check return from request_irq
Subject: drivers/pcmcia/m32r_pcc.c: use common error path
Subject: drivers/pcmcia/m32r_pcc.c: check return from add_pcc_socket
Subject: ocfs2/dlm: clean up useless BUG_ON default case in dlm_finalize_reco_handler()
Subject: ocfs2: delete redundant code and set the node bit into maybe_map directly
Subject: ocfs2/dlm: clean up deadcode in dlm_master_request_handler()
Subject: ocfs2: clean up unused 'page' parameter in ocfs2_write_end_nolock()
Subject: ocfs2: fix double put of recount tree in ocfs2_lock_refcount_tree()
Subject: ocfs2: use time64_t to represent orphan scan times
Subject: ocfs2: replace CURRENT_TIME macro
Subject: mm: memcontrol: use special workqueue for creating per-memcg caches
Subject: slub: move synchronize_sched out of slab_mutex on shrink
Subject: slub: avoid false-postive warning
Subject: mm/slab_common.c: check kmem_create_cache flags are common
Subject: mm, slab: faster active and free stats
Subject: mm, slab: maintain total slab count instead of active count
Subject: mm/mprotect.c: don't touch single threaded PTEs which are on the right node
Subject: mm/vmscan.c: set correct defer count for shrinker
Subject: mm/gup.c: make unnecessarily global vma_permits_fault() static
Subject: mm/hugetlb.c: use the right pte val for compare in hugetlb_cow
Subject: mm/hugetlb.c: use huge_pte_lock instead of opencoding the lock
Subject: kmemleak: fix reference to Documentation
Subject: mm: don't steal highatomic pageblock
Subject: mm: prevent double decrease of nr_reserved_highatomic
Subject: mm: try to exhaust highatomic reserve before the OOM
Subject: mm: make unreserve highatomic functions reliable
Subject: mm/vmalloc.c: simplify /proc/vmallocinfo implementation
Subject: mm, thp: avoid unlikely branches for split_huge_pmd
Subject: mm, mempolicy: clean up __GFP_THISNODE confusion in policy_zonelist
Subject: mm, compaction: fix NR_ISOLATED_* stats for pfn based migration
Subject: shmem: avoid maybe-uninitialized warning
Subject: mm: use the correct page size when removing the page
Subject: mm: update mmu_gather range correctly
Subject: mm/hugetlb: add tlb_remove_hugetlb_entry for handling hugetlb pages
Subject: mm: add tlb_remove_check_page_size_change to track page size change
Subject: mm: remove the page size change check in tlb_remove_page
Subject: mm: fix up get_user_pages* comments
Subject: mm/mempolicy.c: forbid static or relative flags for local NUMA mode
Subject: powerpc/mm: allow memory hotplug into a memoryless node
Subject: mm: remove x86-only restriction of movable_node
Subject: mm: enable CONFIG_MOVABLE_NODE on non-x86 arches
Subject: of/fdt: mark hotpluggable memory
Subject: dt: add documentation of "hotpluggable" memory property
Subject: mm/pkeys: generate pkey system call code only if ARCH_HAS_PKEYS is selected
Subject: mm: disable numa migration faults for dax vmas
Subject: mm: cma: make linux/cma.h standalone includible
Subject: mm/filemap.c: add comment for confusing logic in page_cache_tree_insert()
Subject: fs/fs-writeback.c: remove redundant if check
Subject: shmem: fix compilation warnings on unused functions
Subject: mm: don't cap request size based on read-ahead setting
Subject: include/linux/backing-dev-defs.h: shrink struct backing_dev_info
Subject: mm: khugepaged: close use-after-free race during shmem collapsing
Subject: mm: khugepaged: fix radix tree node leak in shmem collapse error path
Subject: mm: workingset: turn shadow node shrinker bugs into warnings
Subject: lib: radix-tree: native accounting of exceptional entries
Subject: lib: radix-tree: check accounting of existing slot replacement users
Subject: lib: radix-tree: add entry deletion support to __radix_tree_replace()
Subject: lib: radix-tree: update callback for changing leaf nodes
Subject: mm: workingset: move shadow entry tracking to radix tree exceptional tracking
Subject: mm: workingset: restore refault tracking for single-page files
Subject: mm: workingset: update shadow limit to reflect bigger active list
Subject: mm: remove free_unmap_vmap_area_noflush()
Subject: mm: remove free_unmap_vmap_area_addr()
Subject: mm: refactor __purge_vmap_area_lazy()
Subject: mm: add vfree_atomic()
Subject: kernel/fork: use vfree_atomic() to free thread stack
Subject: x86/ldt: use vfree_atomic() to free ldt entries
Subject: mm: mark all calls into the vmalloc subsystem as potentially sleeping
Subject: mm: turn vmap_purge_lock into a mutex
Subject: mm: add preempt points into __purge_vmap_area_lazy()
Subject: mm: move vma_is_anonymous check within pmd_move_must_withdraw
Subject: mm: THP page cache support for ppc64
Subject: mm, debug: print raw struct page data in __dump_page()
Subject: mm, rmap: handle anon_vma_prepare() common case inline
Subject: mm, page_alloc: keep pcp count and list contents in sync if struct page is corrupted
Subject: mm: add three more cond_resched() in swapoff
Subject: mm: add cond_resched() in gather_pte_stats()
Subject: mm: make transparent hugepage size public
Subject: kasan: support panic_on_warn
Subject: kasan: eliminate long stalls during quarantine reduction
Subject: kasan: turn on -fsanitize-address-use-after-scope
Subject: mm/percpu.c: fix panic triggered by BUG_ON() falsely
Subject: proc: report no_new_privs state
Subject: proc: make struct pid_entry::len unsigned
Subject: proc: make struct struct map_files_info::len unsigned int
Subject: proc: just list_del() struct pde_opener
Subject: proc: fix type of struct pde_opener::closing field
Subject: proc: kmalloc struct pde_opener
Subject: proc: tweak comments about 2 stage open and everything
Subject: fs/proc/array.c: slightly improve render_sigset_t
Subject: fs/proc/base.c: save decrement during lookup/readdir in /proc/$PID
Subject: fs/proc: calculate /proc/* and /proc/*/task/* nlink at init time
Subject: hung_task: decrement sysctl_hung_task_warnings only if it is positive
Subject: compiler-gcc.h: use "proved" instead of "proofed"
Subject: printk/NMI: fix up handling of the full nmi log buffer
Subject: printk/NMI: handle continuous lines and missing newline
Subject: printk/kdb: handle more message headers
Subject: printk/btrfs: handle more message headers
Subject: printk/sound: handle more message headers
Subject: printk: add Kconfig option to set default console loglevel
Subject: get_maintainer: look for arbitrary letter prefixes in sections
Subject: MAINTAINERS: add "B:" for URI where to file bugs
Subject: MAINTAINERS: add drm and drm/i915 bug filing info
Subject: MAINTAINERS: add "C:" for URI for chat where developers hang out
Subject: MAINTAINERS: add drm and drm/i915 irc channels
Subject: lib/Kconfig.debug: make CONFIG_STRICT_DEVMEM depend on CONFIG_DEVMEM
Subject: lib/rbtree.c: fix typo in comment of ____rb_erase_color
Subject: lib/ida: document locking requirements a bit better
Subject: checkpatch: don't try to get maintained status when --no-tree is given
Subject: scripts/checkpatch.pl: fix spelling
Subject: checkpatch: don't check .pl files, improve absolute path commit log test
Subject: checkpatch: avoid multiple line dereferences
Subject: checkpatch: don't check c99 types like uint8_t under tools
Subject: checkpatch: don't emit unified-diff error for rename-only patches
Subject: binfmt_elf: use vmalloc() for allocation of vma_filesz
Subject: init: reduce rootwait polling interval time to 5ms
^ permalink raw reply [flat|nested] 232+ messages in thread
* incoming
@ 2016-12-14 23:04 Andrew Morton
0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2016-12-14 23:04 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits
- a few misc things
- kexec updates
- DMA-mapping updates to better support networking DMA operations
- IPC updates
- various MM changes to improve DAX fault handling
- lots of radix-tree changes, mainly to the test suite. All leading
up to reimplementing the IDA/IDR code to be a wrapper layer over the
radix-tree. However the final trigger-pulling patch is held off for
4.11.
114 patches, based on 775a2e29c3bbcf853432f47d3caa9ff8808807ad:
Subject: btrfs: better handle btrfs_printk() defaults
Subject: kernel/watchdog: use nmi registers snapshot in hardlockup handler
Subject: mm, compaction: allow compaction for GFP_NOFS requests
Subject: signals: avoid unnecessary taking of sighand->siglock
Subject: coredump: clarify "unsafe core_pattern" warning
Subject: Revert "kdump, vmcoreinfo: report memory sections virtual addresses"
Subject: kexec: export the value of phys_base instead of symbol address
Subject: kexec: add cond_resched into kimage_alloc_crash_control_pages
Subject: sysctl: add KERN_CONT to deprecated_sysctl_warning()
Subject: arch/arc: add option to skip sync on DMA mapping
Subject: arch/arm: add option to skip sync on DMA map and unmap
Subject: arch/avr32: add option to skip sync on DMA map
Subject: arch/blackfin: add option to skip sync on DMA map
Subject: arch/c6x: add option to skip sync on DMA map and unmap
Subject: arch/frv: add option to skip sync on DMA map
Subject: arch/hexagon: Add option to skip DMA sync as a part of mapping
Subject: arch/m68k: add option to skip DMA sync as a part of mapping
Subject: arch/metag: add option to skip DMA sync as a part of map and unmap
Subject: arch/microblaze: add option to skip DMA sync as a part of map and unmap
Subject: arch/mips: add option to skip DMA sync as a part of map and unmap
Subject: arch/nios2: add option to skip DMA sync as a part of map and unmap
Subject: arch/openrisc: add option to skip DMA sync as a part of mapping
Subject: arch/parisc: add option to skip DMA sync as a part of map and unmap
Subject: arch/powerpc: add option to skip DMA sync as a part of mapping
Subject: arch/sh: add option to skip DMA sync as a part of mapping
Subject: arch/sparc: add option to skip DMA sync as a part of map and unmap
Subject: arch/tile: add option to skip DMA sync as a part of map and unmap
Subject: arch/xtensa: add option to skip DMA sync as a part of mapping
Subject: dma: add calls for dma_map_page_attrs and dma_unmap_page_attrs
Subject: mm: add support for releasing multiple instances of a page
Subject: igb: update driver to make use of DMA_ATTR_SKIP_CPU_SYNC
Subject: igb: update code to better handle incrementing page count
Subject: relay: check array offset before using it
Subject: Kconfig: lib/Kconfig.debug: fix references to Documenation
Subject: Kconfig: lib/Kconfig.ubsan fix reference to ubsan documentation
Subject: kcov: add more missing includes
Subject: kernel/debug/debug_core.c: more properly delay for secondary CPUs
Subject: kdb: remove unused kdb_event handling
Subject: kdb: properly synchronize vkdb_printf() calls with other CPUs
Subject: kdb: call vkdb_printf() from vprintk_default() only when wanted
Subject: initramfs: select builtin initram compression algorithm on KConfig instead of Makefile
Subject: initramfs: allow again choice of the embedded initram compression algorithm
Subject: ipc: msg, make msgrcv work with LONG_MIN
Subject: ipc/shm.c: coding style fixes
Subject: posix-timers: give lazy compilers some help optimizing code away
Subject: drivers/net/wireless/intel/iwlwifi/dvm/calib.c: simplfy min() expression
Subject: ktest.pl: fix english
Subject: kernel/watchdog.c: move shared definitions to nmi.h
Subject: kernel/watchdog.c: move hardlockup detector to separate file
Subject: sparc: implement watchdog_nmi_enable and watchdog_nmi_disable
Subject: ipc/sem: do not call wake_sem_queue_do() prematurely
Subject: ipc/sem: rework task wakeups
Subject: ipc/sem: optimize perform_atomic_semop()
Subject: ipc/sem: explicitly inline check_restart
Subject: ipc/sem: use proper list api for pending_list wakeups
Subject: ipc/sem: simplify wait-wake loop
Subject: ipc/sem: avoid idr tree lookup for interrupted semop
Subject: mm: add locked parameter to get_user_pages_remote()
Subject: mm: unexport __get_user_pages_unlocked()
Subject: mm: join struct fault_env and vm_fault
Subject: mm: use vmf->address instead of of vmf->virtual_address
Subject: mm: use pgoff in struct vm_fault instead of passing it separately
Subject: mm: use passed vm_fault structure in __do_fault()
Subject: mm: trim __do_fault() arguments
Subject: mm: use passed vm_fault structure for in wp_pfn_shared()
Subject: mm: add orig_pte field into vm_fault
Subject: mm: allow full handling of COW faults in ->fault handlers
Subject: mm: factor out functionality to finish page faults
Subject: mm: move handling of COW faults into DAX code
Subject: mm: factor out common parts of write fault handling
Subject: mm: pass vm_fault structure into do_page_mkwrite()
Subject: mm: use vmf->page during WP faults
Subject: mm: move part of wp_page_reuse() into the single call site
Subject: mm: provide helper for finishing mkwrite faults
Subject: mm: change return values of finish_mkwrite_fault()
Subject: mm: export follow_pte()
Subject: dax: make cache flushing protected by entry lock
Subject: dax: protect PTE modification on WP fault by radix tree entry lock
Subject: dax: clear dirty entry tags on cache flush
Subject: tools: add WARN_ON_ONCE
Subject: radix tree test suite: allow GFP_ATOMIC allocations to fail
Subject: radix tree test suite: track preempt_count
Subject: radix tree test suite: free preallocated nodes
Subject: radix tree test suite: make runs more reproducible
Subject: radix tree test suite: iteration test misuses RCU
Subject: radix tree test suite: benchmark for iterator
Subject: radix tree test suite: use rcu_barrier
Subject: radix tree test suite: handle exceptional entries
Subject: radix tree test suite: record order in each item
Subject: tools: add more bitmap functions
Subject: radix tree test suite: use common find-bit code
Subject: radix-tree: fix typo
Subject: radix-tree: move rcu_head into a union with private_list
Subject: radix-tree: create node_tag_set()
Subject: radix-tree: make radix_tree_find_next_bit more useful
Subject: radix-tree: improve dump output
Subject: btrfs: fix race in btrfs_free_dummy_fs_info()
Subject: radix-tree: improve multiorder iterators
Subject: radix-tree: delete radix_tree_locate_item()
Subject: radix-tree: delete radix_tree_range_tag_if_tagged()
Subject: radix-tree: add radix_tree_join
Subject: radix-tree: add radix_tree_split
Subject: radix-tree: add radix_tree_split_preload()
Subject: radix-tree: fix replacement for multiorder entries
Subject: radix tree test suite: check multiorder iteration
Subject: idr: add ida_is_empty
Subject: tpm: use idr_find(), not idr_find_slowpath()
Subject: rxrpc: abstract away knowledge of IDR internals
Subject: idr: reduce the number of bits per level from 8 to 6
Subject: radix tree test suite: add some more functionality
Subject: radix tree test suite: cache recently freed objects
Subject: radix-tree: ensure counts are initialised
Subject: radix tree test suite: add new tag check
Subject: radix tree test suite: delete unused rcupdate.c
^ permalink raw reply [flat|nested] 232+ messages in thread
* incoming
@ 2016-12-20 0:22 Andrew Morton
0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2016-12-20 0:22 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits
- a series to make IMA play better across kexec
- a handful of random fixes
15 patches, based on e93b1cc8a8965da137ffea0b88e5f62fa1d2a9e6:
Subject: powerpc: ima: get the kexec buffer passed by the previous kernel
Subject: ima: on soft reboot, restore the measurement list
Subject: ima: permit duplicate measurement list entries
Subject: ima: maintain memory size needed for serializing the measurement list
Subject: powerpc: ima: send the kexec buffer to the next kernel
Subject: ima: on soft reboot, save the measurement list
Subject: ima: store the builtin/custom template definitions in a list
Subject: ima: support restoring multiple template formats
Subject: ima: define a canonical binary_runtime_measurements list format
Subject: ima: platform-independent hash value
Subject: mm: fadvise: avoid expensive remote LRU cache draining after FADV_DONTNEED
Subject: arm64: setup: introduce kaslr_offset()
Subject: kcov: make kcov work properly with KASLR enabled
Subject: ratelimit: fix WARN_ON_RATELIMIT return value
Subject: printk: fix typo in CONSOLE_LOGLEVEL_DEFAULT help text
^ permalink raw reply [flat|nested] 232+ messages in thread
* incoming
@ 2017-01-11 0:57 Andrew Morton
0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2017-01-11 0:57 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits
27 fixes, based on bd5d7428f5e50cc10b98cf0abc13ccac391e1e33:
The three patches
Subject: mm: rename __alloc_page_frag to page_frag_alloc and __free_page_frag to page_frag_free
Subject: mm: rename __page_frag functions to __page_frag_cache, drop order from drain
Subject: mm: add documentation for page fragment APIs
aren't actually fixes. They're simple function renamings which are
nice-to-have in mainline as ongoing net development depends on them.
Subject: MAINTAINERS: remove duplicate bug filling description
Subject: dax: fix deadlock with DAX 4k holes
Subject: mm/thp/pagecache/collapse: free the pte page table on collapse for thp page cache.
Subject: mm: add follow_pte_pmd()
Subject: dax: wrprotect pmd_t in dax_mapping_entry_mkclean
Subject: mm, slab: make sure that KMALLOC_MAX_SIZE will fit into MAX_ORDER
Subject: bpf: do not use KMALLOC_SHIFT_MAX
Subject: ocfs2: fix crash caused by stale lvb with fsdlm plugin
Subject: mm: fix devm_memremap_pages crash, use mem_hotplug_{begin, done}
Subject: mm: fix remote numa hits statistics
Subject: mm: get rid of __GFP_OTHER_NODE
Subject: lib/Kconfig.debug: fix frv build failure
Subject: ipc/sem.c: fix incorrect sem_lock pairing
Subject: mm: pmd dirty emulation in page fault handler
Subject: signal: protect SIGNAL_UNKILLABLE from unintentional clearing.
Subject: mailmap: add codeaurora.org names for nameless email commits
Subject: mm: don't dereference struct page fields of invalid pages
Subject: mm, memcg: fix the active list aging for lowmem requests when memcg is enabled
Subject: mm: rename __alloc_page_frag to page_frag_alloc and __free_page_frag to page_frag_free
Subject: mm: rename __page_frag functions to __page_frag_cache, drop order from drain
Subject: mm: add documentation for page fragment APIs
Subject: mm: support anonymous stable page
Subject: zram: revalidate disk under init_lock
Subject: zram: support BDI_CAP_STABLE_WRITES
Subject: mm/slab.c: fix SLAB freelist randomization duplicate entries
Subject: mm/hugetlb.c: fix reservation race when freeing surplus pages
Subject: timerfd: export defines to userspace
^ permalink raw reply [flat|nested] 232+ messages in thread
* incoming
@ 2017-01-24 23:17 Andrew Morton
0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2017-01-24 23:17 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits
26 fixes, based on a4685d2f58e2230d4e27fb2ee581d7ea35e5d046:
Subject: memory_hotplug: make zone_can_shift() return a boolean value
Subject: mm/huge_memory.c: respect FOLL_FORCE/FOLL_COW for thp
Subject: dax: fix build warnings with FS_DAX and !FS_IOMAP
Subject: kernel/watchdog: prevent false hardlockup on overloaded system
Subject: drivers/memstick/core/memstick.c: avoid -Wnonnull warning
Subject: userfaultfd: fix SIGBUS resulting from false rwsem wakeups
Subject: mm/slub.c: trace free objects at KERN_INFO
Subject: mm: alloc_contig: re-allow CMA to compact FS pages
Subject: proc: add a schedule point in proc_pid_readdir()
Subject: mm, memcg: do not retry precharge charges
Subject: Documentation/filesystems/proc.txt: add VmPin
Subject: radix-tree: fix private list warnings
Subject: mm/mempolicy.c: do not put mempolicy before using its nodemask
Subject: frv: add atomic64_add_unless()
Subject: fbdev: color map copying bounds checking
Subject: kernel/panic.c: add missing \n
Subject: mm, page_alloc: fix check for NULL preferred_zone
Subject: mm, page_alloc: fix fast-path race with cpuset update or removal
Subject: mm, page_alloc: move cpuset seqcount checking to slowpath
Subject: mm, page_alloc: fix premature OOM when racing with cpuset mems update
Subject: frv: add missing atomic64 operations
Subject: romfs: use different way to generate fsid for BLOCK or MTD
Subject: mn10300: fix build error of missing fpu_save()
Subject: mm: do not export ioremap_page_range symbol for external module
Subject: MAINTAINERS: add Dan Streetman to zswap maintainers
Subject: MAINTAINERS: add Dan Streetman to zbud maintainers
^ permalink raw reply [flat|nested] 232+ messages in thread
* incoming
@ 2017-02-08 22:30 Andrew Morton
0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2017-02-08 22:30 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits
4 fixes, based on 926af6273fc683cd98cd0ce7bf0d04a02eed6742:
Subject: kernel/ucount.c: mark user_header with kmemleak_ignore()
Subject: mm: avoid returning VM_FAULT_RETRY from ->page_mkwrite handlers
Subject: cpumask: use nr_cpumask_bits for parsing functions
Subject: mm/slub.c: fix random_seq offset destruction
^ permalink raw reply [flat|nested] 232+ messages in thread
* incoming
@ 2017-02-18 11:42 Andrew Morton
0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2017-02-18 11:42 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits
1 fix, based on 2fe1e8a7b2f4dcac3fcb07ff06b0ae7396201fd6:
Subject: printk: use rcuidle console tracepoint
^ permalink raw reply [flat|nested] 232+ messages in thread
* incoming
@ 2017-02-22 23:38 Andrew Morton
0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2017-02-22 23:38 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits
142 patches, based on 37c85961c3f87f2141c84e53df31e59db072fd2e:
- DAX updates
- various misc bits
- OCFS2 updates
- most of MM
Subject: tracing: add __print_flags_u64()
Subject: dax: add tracepoint infrastructure, PMD tracing
Subject: dax: update MAINTAINERS entries for FS DAX
Subject: dax: add tracepoints to dax_pmd_load_hole()
Subject: dax: add tracepoints to dax_pmd_insert_mapping()
Subject: mm, dax: make pmd_fault() and friends be the same as fault()
Subject: mm, dax: change pmd_fault() to take only vmf parameter
Subject: dma-debug: add comment for failed to check map error
Subject: tools/vm: add missing Makefile rules
Subject: scripts/spelling.txt: add several more common spelling mistakes
Subject: scripts/spelling.txt: fix incorrect typo-words
Subject: scripts/Lindent: clean up and optimize
Subject: scripts/checkstack.pl: add support for nios2
Subject: scripts/checkincludes.pl: add exit message for no duplicates found
Subject: scripts/tags.sh: include arch/Kconfig* for tags generation
Subject: m32r: use generic current.h
Subject: m32r: fix build warning
Subject: score: remove asm/current.h
Subject: ocfs2/dlmglue: prepare tracking logic to avoid recursive cluster lock
Subject: ocfs2: fix deadlock issue when taking inode lock at vfs entry points
Subject: parisc: use generic current.h
Subject: block: use for_each_thread() in sys_ioprio_set()/sys_ioprio_get()
Subject: 9p: fix a potential acl leak
Subject: kernel/watchdog.c: do not hardcode CPU 0 as the initial thread
Subject: slub: do not merge cache if slub_debug contains a never-merge flag
Subject: mm/slub: add a dump_stack() to the unexpected GFP check
Subject: mm, slab: rename kmalloc-node cache to kmalloc-<size>
Subject: Revert "slub: move synchronize_sched out of slab_mutex on shrink"
Subject: slub: separate out sysfs_slab_release() from sysfs_slab_remove()
Subject: slab: remove synchronous rcu_barrier() call in memcg cache release path
Subject: slab: reorganize memcg_cache_params
Subject: slab: link memcg kmem_caches on their associated memory cgroup
Subject: slab: implement slab_root_caches list
Subject: slab: introduce __kmemcg_cache_deactivate()
Subject: slab: remove synchronous synchronize_sched() from memcg cache deactivation path
Subject: slab: remove slub sysfs interface files early for empty memcg caches
Subject: slab: use memcg_kmem_cache_wq for slab destruction operations
Subject: slub: make sysfs directories for memcg sub-caches optional
Subject: tmpfs: change shmem_mapping() to test shmem_aops
Subject: mm: throttle show_mem() from warn_alloc()
Subject: mm, page_alloc: don't convert pfn to idx when merging
Subject: mm, page_alloc: avoid page_to_pfn() when merging buddies
Subject: mm/vmalloc.c: use rb_entry_safe
Subject: mm, trace: extract COMPACTION_STATUS and ZONE_TYPE to a common header
Subject: oom, trace: add oom detection tracepoints
Subject: oom, trace: add compaction retry tracepoint
Subject: userfaultfd: document _IOR/_IOW
Subject: userfaultfd: correct comment about UFFD_FEATURE_PAGEFAULT_FLAG_WP
Subject: userfaultfd: convert BUG() to WARN_ON_ONCE()
Subject: userfaultfd: use vma_is_anonymous
Subject: userfaultfd: non-cooperative: Split the find_userfault() routine
Subject: userfaultfd: non-cooperative: add ability to report non-PF events from uffd descriptor
Subject: userfaultfd: non-cooperative: report all available features to userland
Subject: userfaultfd: non-cooperative: Add fork() event
Subject: userfaultfd: non-cooperative: dup_userfaultfd: use mm_count instead of mm_users
Subject: userfaultfd: non-cooperative: add mremap() event
Subject: userfaultfd: non-cooperative: optimize mremap_userfaultfd_complete()
Subject: userfaultfd: non-cooperative: add madvise() event for MADV_DONTNEED request
Subject: userfaultfd: non-cooperative: avoid MADV_DONTNEED race condition
Subject: userfaultfd: non-cooperative: wake userfaults after UFFDIO_UNREGISTER
Subject: userfaultfd: hugetlbfs: add copy_huge_page_from_user for hugetlb userfaultfd support
Subject: userfaultfd: hugetlbfs: add hugetlb_mcopy_atomic_pte for userfaultfd support
Subject: userfaultfd: hugetlbfs: add __mcopy_atomic_hugetlb for huge page UFFDIO_COPY
Subject: userfaultfd: hugetlbfs: fix __mcopy_atomic_hugetlb retry/error processing
Subject: userfaultfd: hugetlbfs: add userfaultfd hugetlb hook
Subject: userfaultfd: hugetlbfs: allow registration of ranges containing huge pages
Subject: userfaultfd: hugetlbfs: add userfaultfd_hugetlb test
Subject: userfaultfd: hugetlbfs: userfaultfd_huge_must_wait for hugepmd ranges
Subject: userfaultfd: hugetlbfs: gup: support VM_FAULT_RETRY
Subject: userfaultfd: hugetlbfs: reserve count on error in __mcopy_atomic_hugetlb
Subject: userfaultfd: hugetlbfs: UFFD_FEATURE_MISSING_HUGETLBFS
Subject: userfaultfd: introduce vma_can_userfault
Subject: userfaultfd: shmem: add shmem_mcopy_atomic_pte for userfaultfd support
Subject: userfaultfd: shmem: introduce vma_is_shmem
Subject: userfaultfd: shmem: add tlbflush.h header for microblaze
Subject: userfaultfd: shmem: use shmem_mcopy_atomic_pte for shared memory
Subject: userfaultfd: shmem: add userfaultfd hook for shared memory faults
Subject: userfaultfd: shmem: allow registration of shared memory ranges
Subject: userfaultfd: hugetlbfs: add UFFDIO_COPY support for shared mappings
Subject: userfaultfd: shmem: add userfaultfd_shmem test
Subject: userfaultfd: shmem: lock the page before adding it to pagecache
Subject: userfaultfd: shmem: avoid a lockup resulting from corrupted page->flags
Subject: userfaultfd: shmem: avoid leaking blocks and used blocks in UFFDIO_COPY
Subject: userfaultfd: hugetlbfs: UFFD_FEATURE_MISSING_SHMEM
Subject: userfaultfd: non-cooperative: selftest: introduce userfaultfd_open
Subject: userfaultfd: non-cooperative: selftest: add ufd parameter to copy_page
Subject: userfaultfd: non-cooperative: selftest: add test for FORK, MADVDONTNEED and REMAP events
Subject: userfaultfd: selftest: test UFFDIO_ZEROPAGE on all memory types
Subject: mm: mprotect: use pmd_trans_unstable instead of taking the pmd_lock
Subject: mm, vmscan: remove unused mm_vmscan_memcg_isolate
Subject: mm, vmscan: add active list aging tracepoint
Subject: mm, vmscan: show the number of skipped pages in mm_vmscan_lru_isolate
Subject: mm, vmscan: show LRU name in mm_vmscan_lru_isolate tracepoint
Subject: mm, vmscan: extract shrink_page_list reclaim counters into a struct
Subject: mm, vmscan: enhance mm_vmscan_lru_shrink_inactive tracepoint
Subject: mm, vmscan: add mm_vmscan_inactive_list_is_low tracepoint
Subject: trace-vmscan-postprocess: sync with tracepoints updates
Subject: nfs: no PG_private waiters remain, remove waker
Subject: mm: un-export wake_up_page functions
Subject: mm: fix filemap.c kernel-doc warnings
Subject: mm/mmzone.c: swap likely to unlikely as code logic is different for next_zones_zonelist()
Subject: mm, compaction: add vmstats for kcompactd work
Subject: mm: page_alloc: skip over regions of invalid pfns where possible
Subject: mm,compaction: serialize waitqueue_active() checks
Subject: mm/bootmem.c: cosmetic improvement of code readability
Subject: mm: fix some typos in mm/zsmalloc.c
Subject: mm/memblock.c: trivial code refine in memblock_is_region_memory()
Subject: mm/memblock.c: check return value of memblock_reserve() in memblock_virt_alloc_internal()
Subject: mm/sparse: use page_private() to get page->private value
Subject: mm/memory_hotplug: set magic number to page->freelist instead of page->lru.next
Subject: powerpc: do not make the entire heap executable
Subject: mm/swap: fix kernel message in swap_info_get()
Subject: mm/swap: add cluster lock
Subject: mm/swap: split swap cache into 64MB trunks
Subject: mm/swap: skip readahead for unreferenced swap slots
Subject: mm/swap: allocate swap slots in batches
Subject: mm/swap: free swap slots in batch
Subject: mm/swap: add cache for swap slots allocation
Subject: mm/swap: enable swap slots cache usage
Subject: mm/swap: skip readahead only when swap slot cache is enabled
Subject: mm, thp: add new defer+madvise defrag option
Subject: mm/backing-dev.c: use rb_entry()
Subject: mm, vmscan: do not count freed pages as PGDEACTIVATE
Subject: mm, vmscan: cleanup lru size claculations
Subject: mm, vmscan: consider eligible zones in get_scan_count
Subject: Revert "mm: bail out in shrink_inactive_list()"
Subject: mm, page_alloc: do not report all nodes in show_mem
Subject: mm, page_alloc: warn_alloc print nodemask
Subject: arch, mm: remove arch specific show_mem
Subject: lib/show_mem.c: teach show_mem to work with the given nodemask
Subject: mm: consolidate GFP_NOFAIL checks in the allocator slowpath
Subject: mm, oom: do not enforce OOM killer for __GFP_NOFAIL automatically
Subject: mm: help __GFP_NOFAIL allocations which do not trigger OOM killer
Subject: mm, page_alloc: warn_alloc nodemask is NULL when cpusets are disabled
Subject: mm: drop zap_details::ignore_dirty
Subject: mm: drop zap_details::check_swap_entries
Subject: mm: drop unused argument of zap_page_range()
Subject: oom-reaper: use madvise_dontneed() logic to decide if unmap the VMA
Subject: mm/memblock.c: remove unnecessary log and clean up
Subject: zram: remove obsolete sysfs attrs
Subject: mm: fix <linux/pagemap.h> stray kernel-doc notation
Subject: mm/z3fold.c: limit first_num to the actual range of possible buddy indexes
^ permalink raw reply [flat|nested] 232+ messages in thread
* incoming
@ 2017-02-24 22:55 Andrew Morton
0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2017-02-24 22:55 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits
- almost all of the rest of MM
- misc bits
- KASAN updates
- procfs
- lib/ updates
- checkpatch updates
124 patches, based on f1ef09fde17f9b77ca1435a5b53a28b203afb81c:
Subject: cris: use generic current.h
Subject: mm/ksm: improve deduplication of zero pages with colouring
Subject: mm, oom: header nodemask is NULL when cpusets are disabled
Subject: mm, devm_memremap_pages: hold device_hotplug lock over mem_hotplug_{begin, done}
Subject: mm: validate device_hotplug is held for memory hotplug
Subject: mm/memory_hotplug.c: unexport __remove_pages()
Subject: memblock: let memblock_type_name know about physmem type
Subject: memblock: also dump physmem list within __memblock_dump_all
Subject: memblock: embed memblock type name within struct memblock_type
Subject: userfaultfd: non-cooperative: rename *EVENT_MADVDONTNEED to *EVENT_REMOVE
Subject: userfaultfd: non-cooperative: add madvise() event for MADV_REMOVE request
Subject: userfaultfd: non-cooperative: selftest: enable REMOVE event test for shmem
Subject: mm: vmscan: scan dirty pages even in laptop mode
Subject: mm: vmscan: kick flushers when we encounter dirty pages on the LRU
Subject: mm: vmscan: remove old flusher wakeup from direct reclaim path
Subject: mm: vmscan: only write dirty pages that the scanner has seen twice
Subject: mm: vmscan: move dirty pages out of the way until they're flushed
Subject: mm, page_alloc: split buffered_rmqueue()
Subject: mm, page_alloc: split alloc_pages_nodemask()
Subject: mm, page_alloc: drain per-cpu pages from workqueue context
Subject: mm, page_alloc: do not depend on cpu hotplug locks inside the allocator
Subject: mm, page_alloc: only use per-cpu allocator for irq-safe requests
Subject: mm, fs: reduce fault, page_mkwrite, and pfn_mkwrite to take only vmf
Subject: mm: fix comments for mmap_init()
Subject: zram: remove waitqueue for IO done
Subject: mm, page_alloc: remove redundant checks from alloc fastpath
Subject: mm, page_alloc: don't check cpuset allowed twice in fast-path
Subject: mm, page_alloc: use static global work_struct for draining per-cpu pages
Subject: mm,fs,dax: change ->pmd_fault to ->huge_fault
Subject: mm, x86: add support for PUD-sized transparent hugepages
Subject: dax: support for transparent PUD pages for device DAX
Subject: mm: replace FAULT_FLAG_SIZE with parameter to huge_fault
Subject: mm: fix get_user_pages() vs device-dax pud mappings
Subject: z3fold: make pages_nr atomic
Subject: z3fold: fix header size related issues
Subject: z3fold: extend compaction function
Subject: z3fold: use per-page spinlock
Subject: z3fold: add kref refcounting
Subject: mm/migration: make isolate_movable_page() return int type
Subject: mm/migration: make isolate_movable_page always defined
Subject: HWPOISON: soft offlining for non-lru movable page
Subject: mm/hotplug: enable memory hotplug for non-lru movable pages
Subject: uprobes: split THPs before trying to replace them
Subject: mm: introduce page_vma_mapped_walk()
Subject: mm: fix handling PTE-mapped THPs in page_referenced()
Subject: mm: fix handling PTE-mapped THPs in page_idle_clear_pte_refs()
Subject: mm, rmap: check all VMAs that PTE-mapped THP can be part of
Subject: mm: convert page_mkclean_one() to use page_vma_mapped_walk()
Subject: mm: convert try_to_unmap_one() to use page_vma_mapped_walk()
Subject: mm, ksm: convert write_protect_page() to use page_vma_mapped_walk()
Subject: mm, uprobes: convert __replace_page() to use page_vma_mapped_walk()
Subject: mm: convert page_mapped_in_vma() to use page_vma_mapped_walk()
Subject: mm: drop page_check_address{,_transhuge}
Subject: mm: convert remove_migration_pte() to use page_vma_mapped_walk()
Subject: mm: call vm_munmap in munmap syscall instead of using open coded version
Subject: userfaultfd: non-cooperative: add event for memory unmaps
Subject: userfaultfd: non-cooperative: add event for exit() notification
Subject: userfaultfd: mcopy_atomic: return -ENOENT when no compatible VMA found
Subject: userfaultfd_copy: return -ENOSPC in case mm has gone
Subject: userfaultfd: documentation update
Subject: mm: alloc_contig_range: allow to specify GFP mask
Subject: mm: cma_alloc: allow to specify GFP mask
Subject: mm: wire up GFP flag passing in dma_alloc_from_contiguous
Subject: mm, madvise: fail with ENOMEM when splitting vma will hit max_map_count
Subject: mm: cma: print allocation failure reason and bitmap status
Subject: vmalloc: back off when the current task is killed
Subject: mm/page_alloc.c: remove duplicate inclusion of page_ext.h
Subject: mm/memory.c: use NULL instead of literal 0
Subject: mm: codgin-style fixes
Subject: drm: remove unnecessary fault wrappers
Subject: mm, vmscan: clear PGDAT_WRITEBACK when zone is balanced
Subject: mm/shmem.c: fix unlikely() test of info->seals to test only for WRITE and GROW
Subject: mm/autonuma: don't use set_pte_at when updating protnone ptes
Subject: mm/autonuma: let architecture override how the write bit should be stashed in a protnone pte.
Subject: mm/ksm: handle protnone saved writes when making page write protect
Subject: powerpc/mm/autonuma: switch ppc64 to its own implementation of saved write
Subject: mm/page-writeback.c: place "not" inside of unlikely() statement in wb_domain_writeout_inc()
Subject: zram: extend zero pages to same element pages
Subject: mm/memory_hotplug.c: fix overflow in test_pages_in_a_zone()
Subject: mm/page_alloc: fix nodes for reclaim in fast path
Subject: mm: remove shmem_mapping() shmem_zero_setup() duplicates
Subject: mm: vmpressure: fix sending wrong events on underflow
Subject: mm/zsmalloc: remove redundant SetPagePrivate2 in create_page_chain
Subject: mm/page_alloc.c: remove redundant init code for ZONE_MOVABLE
Subject: mm/zsmalloc: fix comment in zsmalloc
Subject: mm: cleanups for printing phys_addr_t and dma_addr_t
Subject: mm/gup: check for protnone only if it is a PTE entry
Subject: mm/thp/autonuma: use TNF flag instead of vm fault
Subject: mm: do not access page->mapping directly on page_endio
Subject: memory-hotplug: use dev_online for memhp_auto_online
Subject: kasan: drain quarantine of memcg slab objects
Subject: kasan: add memcg kmem_cache test
Subject: arch/frv/mb93090-mb00/pci-frv.c: fix build warning
Subject: alpha: use generic current.h
Subject: proc: use rb_entry()
Subject: proc: less code duplication in /proc/*/cmdline
Subject: procfs: use an enum for possible hidepid values
Subject: uapi: mqueue.h: add missing linux/types.h include
Subject: include/linux/iopoll.h: include <linux/ktime.h> instead of <linux/hrtimer.h>
Subject: compiler-gcc.h: add a new macro to wrap gcc attribute
Subject: m68k: replace gcc specific macros with ones from compiler.h
Subject: bug: switch data corruption check to __must_check
Subject: mm balloon: umount balloon_mnt when removing vb device
Subject: kernel/notifier.c: simplify expression
Subject: kernel/ksysfs.c: add __ro_after_init to bin_attribute structure
Subject: lib: add module support to crc32 tests
Subject: lib: add module support to glob tests
Subject: lib: add module support to atomic64 tests
Subject: lib/find_bit.c: micro-optimise find_next_*_bit
Subject: linux/kernel.h: fix DIV_ROUND_CLOSEST to support negative divisors
Subject: rbtree: use designated initializers
Subject: lib: add CONFIG_TEST_SORT to enable self-test of sort()
Subject: lib/test_sort.c: make it explicitly non-modular
Subject: lib: update LZ4 compressor module
Subject: lib/decompress_unlz4: change module to work with new LZ4 module version
Subject: crypto: change LZ4 modules to work with new LZ4 module version
Subject: fs/pstore: fs/squashfs: change usage of LZ4 to work with new LZ4 version
Subject: lib/lz4: remove back-compat wrappers
Subject: checkpatch: warn on embedded function names
Subject: checkpatch: warn on logging continuations
Subject: checkpatch: update $logFunctions
Subject: checkpatch: add another old address for the FSF
Subject: checkpatch: notice unbalanced else braces in a patch
Subject: checkpatch: remove false unbalanced braces warning
^ permalink raw reply [flat|nested] 232+ messages in thread
* incoming
@ 2017-02-27 22:25 Andrew Morton
0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2017-02-27 22:25 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits
- a few MM remainders
- misc things
- autofs updates
- signals
- affs updates
- ipc
- nilfs2
- spelling.txt updates
78 patches, based on e5d56efc97f8240d0b5d66c03949382b6d7e5570:
Subject: mm,fs,dax: mark dax_iomap_pmd_fault as const
Subject: zswap: allow initialization at boot without pool
Subject: zswap: clear compressor or zpool param if invalid at init
Subject: zswap: don't param_set_charp while holding spinlock
Subject: kprobes: move kprobe declarations to asm-generic/kprobes.h
Subject: autofs: remove wrong comment
Subject: autofs: fix typo in Documentation
Subject: autofs: fix wrong ioctl documentation regarding devid
Subject: autofs: update ioctl documentation regarding struct autofs_dev_ioctl
Subject: autofs: add command enum/macros for root-dir ioctls
Subject: autofs: remove duplicated AUTOFS_DEV_IOCTL_SIZE definition
Subject: autofs: take more care to not update last_used on path walk
Subject: hfsplus: atomically read inode size
Subject: fs/reiserfs: atomically read inode size
Subject: sigaltstack: support SS_AUTODISARM for CONFIG_COMPAT
Subject: tools/testing/selftests/sigaltstack/sas.c: improve output of sigaltstack testcase
Subject: /proc/kcore: update physical address for kcore ram and text
Subject: rapidio: use get_user_pages_unlocked()
Subject: include/linux/pid.h: use for_each_thread() in do_each_pid_thread()
Subject: fs,eventpoll: Don't test for bitfield with stack value
Subject: fs/affs: remove reference to affs_parent_ino()
Subject: fs/affs: add validation block function
Subject: fs/affs: make affs exportable
Subject: fs/affs: use octal for permissions
Subject: fs/affs: add prefix to some functions
Subject: fs/affs/namei.c: forward declarations clean-up
Subject: fs/affs: make export work with cold dcache
Subject: config: android-recommended: disable aio support
Subject: config: android-base: enable hardened usercopy and kernel ASLR
Subject: lib/fonts/Kconfig: keep non-Sparc fonts listed together
Subject: initramfs: finish fput() before accessing any binary from initramfs
Subject: ipc/sem.c: avoid using spin_unlock_wait()
Subject: ipc/sem: add hysteresis
Subject: ipc/mqueue: add missing sparse annotation
Subject: ipc/shm: Fix shmat mmap nil-page protection
Subject: scatterlist: reorder compound boolean expression
Subject: scatterlist: do not disable IRQs in sg_copy_buffer
Subject: fs: add i_blocksize()
Subject: nilfs2: use nilfs_btree_node_size()
Subject: nilfs2: use i_blocksize()
Subject: scripts/spelling.txt: add "swith" pattern and fix typo instances
Subject: scripts/spelling.txt: add "swithc" pattern and fix typo instances
Subject: scripts/spelling.txt: add "an user" pattern and fix typo instances
Subject: scripts/spelling.txt: add "an union" pattern and fix typo instances
Subject: scripts/spelling.txt: add "an one" pattern and fix typo instances
Subject: scripts/spelling.txt: add "partiton" pattern and fix typo instances
Subject: scripts/spelling.txt: add "aligment" pattern and fix typo instances
Subject: scripts/spelling.txt: add "algined" pattern and fix typo instances
Subject: scripts/spelling.txt: add "efective" pattern and fix typo instances
Subject: scripts/spelling.txt: add "varible" pattern and fix typo instances
Subject: scripts/spelling.txt: add "embeded" pattern and fix typo instances
Subject: scripts/spelling.txt: add "againt" pattern and fix typo instances
Subject: scripts/spelling.txt: add "neded" pattern and fix typo instances
Subject: scripts/spelling.txt: add "unneded" pattern and fix typo instances
Subject: scripts/spelling.txt: add "intialization" pattern and fix typo instances
Subject: scripts/spelling.txt: add "initialiazation" pattern and fix typo instances
Subject: scripts/spelling.txt: add "comsume(r)" pattern and fix typo instances
Subject: scripts/spelling.txt: add "overrided" pattern and fix typo instances
Subject: scripts/spelling.txt: add "configuartion" pattern and fix typo instances
Subject: scripts/spelling.txt: add "applys" pattern and fix typo instances
Subject: scripts/spelling.txt: add "explictely" pattern and fix typo instances
Subject: scripts/spelling.txt: add "omited" pattern and fix typo instances
Subject: scripts/spelling.txt: add "disassocation" pattern and fix typo instances
Subject: scripts/spelling.txt: add "deintialize(d)" pattern and fix typo instances
Subject: scripts/spelling.txt: add "overwritting" pattern and fix typo instances
Subject: scripts/spelling.txt: add "overwriten" pattern and fix typo instances
Subject: scripts/spelling.txt: add "therfore" pattern and fix typo instances
Subject: scripts/spelling.txt: add "followings" pattern and fix typo instances
Subject: scripts/spelling.txt: add some typo-words
Subject: lib/vsprintf.c: remove %Z support
Subject: checkpatch: warn when formats use %Z and suggest %z
Subject: mm: add new mmgrab() helper
Subject: mm: add new mmget() helper
Subject: mm: use mmget_not_zero() helper
Subject: mm: clarify mm_struct.mm_{users,count} documentation
Subject: hfs: atomically read inode size
Subject: mm: add arch-independent testcases for RODATA
Subject: mm, x86: fix HIGHMEM64 && PARAVIRT build config for native_pud_clear()
^ permalink raw reply [flat|nested] 232+ messages in thread
* incoming
@ 2017-03-10 0:15 Andrew Morton
0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2017-03-10 0:15 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits
26 fixes, based on ea6200e84182989a3cce9687cf79a23ac44ec4db:
Subject: userfaultfd: shmem: __do_fault requires VM_FAULT_NOPAGE
Subject: scripts/spelling.txt: add "disble(d)" pattern and fix typo instances
Subject: scripts/spelling.txt: add "overide" pattern and fix typo instances
Subject: powerpc/mm: handle protnone ptes on fork
Subject: power/mm: update pte_write and pte_wrprotect to handle savedwrite
Subject: x86, mm: fix gup_pte_range() vs DAX mappings
Subject: x86, mm: unify exit paths in gup_pte_range()
Subject: userfaultfd: non-cooperative: rollback userfaultfd_exit
Subject: userfaultfd: non-cooperative: robustness check
Subject: userfaultfd: non-cooperative: release all ctx in dup_userfaultfd_complete
Subject: include/linux/fs.h: fix unsigned enum warning with gcc-4.2
Subject: mm/vmstats: add thp_split_pud event for clarity
Subject: drivers/md/bcache/util.h: remove duplicate inclusion of blkdev.h
Subject: mm/cgroup: avoid panic when init with low memory
Subject: userfaultfd: non-cooperative: fix fork fctx->new memleak
Subject: userfaultfd: non-cooperative: userfaultfd_remove revalidate vma in MADV_DONTNEED
Subject: userfaultfd: selftest: vm: allow to build in vm/ directory
Subject: mm/memblock.c: fix memblock_next_valid_pfn()
Subject: rmap: fix NULL-pointer dereference on THP munlocking
Subject: thp: fix another corner case of munlock() vs. THPs
Subject: mm: do not call mem_cgroup_free() from within mem_cgroup_alloc()
Subject: kasan: resched in quarantine_remove_cache()
Subject: kasan: fix races in quarantine_remove_cache()
Subject: sh: cayman: IDE support fix
Subject: fat: fix using uninitialized fields of fat_inode/fsinfo_inode
Subject: userfaultfd: remove wrong comment from userfaultfd_ctx_get()
^ permalink raw reply [flat|nested] 232+ messages in thread
* incoming
@ 2017-03-16 23:40 Andrew Morton
0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2017-03-16 23:40 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits
6 fixes, based on 69eea5a4ab9c705496e912b55a9d312325de19e6:
Subject: z3fold: fix spinlock unlocking in page reclaim
Subject: kasan: add a prototype of task_struct to avoid warning
Subject: mm, x86: fix native_pud_clear build error
Subject: mm: don't warn when vmalloc() fails due to a fatal signal
Subject: mm: add private lock to serialize memory hotplug operations
Subject: drivers core: remove assert_held_device_hotplug()
^ permalink raw reply [flat|nested] 232+ messages in thread
* incoming
@ 2017-03-31 22:11 Andrew Morton
0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2017-03-31 22:11 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits
11 fixes, based on d4562267b995fa3917717cc7773dad9c1f1ca658:
Subject: mm: migrate: fix remove_migration_pte() for ksm pages
Subject: mm: move mm_percpu_wq initialization earlier
Subject: mm: rmap: fix huge file mmap accounting in the memcg stats
Subject: mm: workingset: fix premature shadow node shrinking with cgroups
Subject: mm, hugetlb: use pte_present() instead of pmd_present() in follow_huge_pmd()
Subject: mm: fix section name for .data..ro_after_init
Subject: hugetlbfs: initialize shared policy as part of inode allocation
Subject: kasan: report only the first error by default
Subject: mm/hugetlb.c: don't call region_abort if region_chg fails
Subject: drivers/rapidio/devices/tsi721.c: make module parameter variable name unique
Subject: kasan: do not sanitize kexec purgatory
^ permalink raw reply [flat|nested] 232+ messages in thread
* incoming
@ 2017-04-07 23:04 Andrew Morton
0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2017-04-07 23:04 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits
10 fixes, based on 81d4bab4ce87228c37ab14a885438544af5c9ce6:
Subject: mm: fix page_vma_mapped_walk() for ksm pages
Subject: userfaultfd: report actual registered features in fdinfo
Subject: mm/page_alloc.c: fix print order in show_free_areas()
Subject: vmlinux.lds: add missing VMLINUX_SYMBOL macros
Subject: ptrace: fix PTRACE_LISTEN race corrupting task->state
Subject: mm, thp: fix setting of defer+madvise thp defrag mode
Subject: dax: fix radix tree insertion race
Subject: mm, swap_cgroup: reschedule when neeed in swap_cgroup_swapoff()
Subject: mailmap: update Yakir Yang email address
Subject: mm: move pcp and lru-pcp draining into single wq
^ permalink raw reply [flat|nested] 232+ messages in thread
* incoming
@ 2017-04-13 21:56 Andrew Morton
0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2017-04-13 21:56 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits
11 fixes, based on 2760078203a6b46b96307f4b06030ab0b801c97e:
Subject: z3fold: fix page locking in z3fold_alloc()
Subject: thp: reduce indentation level in change_huge_pmd()
Subject: thp: fix MADV_DONTNEED vs. numa balancing race
Subject: mm: drop unused pmdp_huge_get_and_clear_notify()
Subject: thp: fix MADV_DONTNEED vs. MADV_FREE race
Subject: thp: fix MADV_DONTNEED vs clear soft dirty race
Subject: hugetlbfs: fix offset overflow in hugetlbfs mmap
Subject: zram: fix operator precedence to get offset
Subject: zram: do not use copy_page with non-page aligned address
Subject: zsmalloc: expand class bit
Subject: mailmap: add Martin Kepplinger's email
The presence of "thp: reduce indentation level in change_huge_pmd()" is
unfortunate. But the patchset had been decently reviewed and tested
before we decided it was needed in -stable and I felt it best not to
churn things at the last minute.
^ permalink raw reply [flat|nested] 232+ messages in thread
* incoming
@ 2017-04-20 21:37 Andrew Morton
0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2017-04-20 21:37 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits
2 fixes, based on f61143c45077df4fa78e2f1ba455a00bbe1d5b8c:
Subject: Revert "mm, page_alloc: only use per-cpu allocator for irq-safe requests"
Subject: mm: prevent NR_ISOLATE_* stats from going negative
^ permalink raw reply [flat|nested] 232+ messages in thread
* incoming
@ 2017-05-03 21:50 Andrew Morton
0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2017-05-03 21:50 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits
- a few misc things
- most of MM
- KASAN updates
102 patches, based on 46f0537b1ecf672052007c97f102a7e6bf0791e4:
Subject: lib/dma-debug.c: make locking work for RT
Subject: scripts/spelling.txt: add several more common spelling mistakes
Subject: blackfin: bf609: let clk_disable() return immediately if clk is NULL
Subject: fs/ocfs2/cluster: use setup_timer
Subject: ocfs2: o2hb: revert hb threshold to keep compatible
Subject: fs/ocfs2/cluster: use offset_in_page() macro
Subject: slab: avoid IPIs when creating kmem caches
Subject: mm: fix 100% CPU kswapd busyloop on unreclaimable nodes
Subject: mm: fix check for reclaimable pages in PF_MEMALLOC reclaim throttling
Subject: mm: remove seemingly spurious reclaimability check from laptop_mode gating
Subject: mm: remove unnecessary reclaimability check from NUMA balancing target
Subject: mm: don't avoid high-priority reclaim on unreclaimable nodes
Subject: mm: don't avoid high-priority reclaim on memcg limit reclaim
Subject: mm: delete NR_PAGES_SCANNED and pgdat_reclaimable()
Subject: Revert "mm, vmscan: account for skipped pages as a partial scan"
Subject: mm: remove unnecessary back-off function when retrying page reclaim
Subject: mm/page-writeback.c: use setup_deferrable_timer
Subject: mm: delete unnecessary TTU_* flags
Subject: mm: don't assume anonymous pages have SwapBacked flag
Subject: mm: move MADV_FREE pages into LRU_INACTIVE_FILE list
Subject: mm: reclaim MADV_FREE pages
Subject: mm: fix lazyfree BUG_ON check in try_to_unmap_one()
Subject: mm: enable MADV_FREE for swapless system
Subject: proc: show MADV_FREE pages info in smaps
Subject: mm: memcontrol: provide shmem statistics
Subject: mm, swap: Fix a race in free_swap_and_cache()
Subject: mm: use is_migrate_highatomic() to simplify the code
Subject: mm: use is_migrate_isolate_page() to simplify the code
Subject: mm, vmstat: print non-populated zones in zoneinfo
Subject: mm, vmstat: suppress pcp stats for unpopulated zones in zoneinfo
Subject: lockdep: teach lockdep about memalloc_noio_save
Subject: lockdep: allow to disable reclaim lockup detection
Subject: xfs: abstract PF_FSTRANS to PF_MEMALLOC_NOFS
Subject: mm: introduce memalloc_nofs_{save,restore} API
Subject: xfs: use memalloc_nofs_{save,restore} instead of memalloc_noio*
Subject: jbd2: mark the transaction context with the scope GFP_NOFS context
Subject: jbd2: make the whole kjournald2 kthread NOFS safe
Subject: mm: tighten up the fault path a little
Subject: mm: remove rodata_test_data export, add pr_fmt
Subject: mm: do not use double negation for testing page flags
Subject: mm, vmscan: fix zone balance check in prepare_kswapd_sleep
Subject: mm, vmscan: only clear pgdat congested/dirty/writeback state when balanced
Subject: mm, vmscan: prevent kswapd sleeping prematurely due to mismatched classzone_idx
Subject: mm: page_alloc: __GFP_NOWARN shouldn't suppress stall warnings
Subject: mm/sparse: refine usemap_size() a little
Subject: mm/compaction: ignore block suitable after check large free page
Subject: mm/vmscan: more restrictive condition for retry in do_try_to_free_pages
Subject: mm: remove unncessary ret in page_referenced
Subject: mm: remove SWAP_DIRTY in ttu
Subject: mm: remove SWAP_MLOCK check for SWAP_SUCCESS in ttu
Subject: mm: make try_to_munlock() return void
Subject: mm: remove SWAP_MLOCK in ttu
Subject: mm: remove SWAP_AGAIN in ttu
Subject: mm: make ttu's return boolean
Subject: mm: make rmap_walk() return void
Subject: mm: make rmap_one boolean function
Subject: mm: remove SWAP_[SUCCESS|AGAIN|FAIL]
Subject: mm, swap: fix comment in __read_swap_cache_async
Subject: mm, swap: improve readability via make spin_lock/unlock balanced
Subject: mm, swap: avoid lock swap_avail_lock when held cluster lock
Subject: mm: enable page poisoning early at boot
Subject: include/linux/migrate.h: add arg names to prototype
Subject: mm/swap_slots.c: add warning if swap slots cache failed to initialize
Subject: mm: fix spelling error
Subject: userfaultfd: selftest: combine all cases into a single executable
Subject: oom: improve oom disable handling
Subject: mm/mmap: replace SHM_HUGE_MASK with MAP_HUGE_MASK inside mmap_pgoff
Subject: mm: vmscan: fix IO/refault regression in cache workingset transition
Subject: mm: memcontrol: clean up memory.events counting function
Subject: mm: memcontrol: re-use global VM event enum
Subject: mm: memcontrol: re-use node VM page state enum
Subject: mm: memcontrol: use node page state naming scheme for memcg
Subject: mm, swap: remove unused function prototype
Subject: Documentation: vm, add hugetlbfs reservation overview
Subject: mm/madvise.c: clean up MADV_SOFT_OFFLINE and MADV_HWPOISON
Subject: mm/madvise: move up the behavior parameter validation
Subject: mm/memory-failure.c: add page flag description in error paths
Subject: mm, page_alloc: remove debug_guardpage_minorder() test in warn_alloc()
Subject: zram: handle multiple pages attached bio's bvec
Subject: zram: partial IO refactoring
Subject: zram: use zram_slot_lock instead of raw bit_spin_lock op
Subject: zram: remove zram_meta structure
Subject: zram: introduce zram data accessor
Subject: zram: use zram_free_page instead of open-coded
Subject: zram: reduce load operation in page_same_filled
Subject: fs: fix data invalidation in the cleancache during direct IO
Subject: fs/block_dev: always invalidate cleancache in invalidate_bdev()
Subject: mm/truncate: bail out early from invalidate_inode_pages2_range() if mapping is empty
Subject: mm/truncate: avoid pointless cleancache_invalidate_inode() calls.
Subject: mm/gup.c: fix access_ok() argument type
Subject: mm/swapfile.c: fix swap space leak in error path of swap_free_entries()
Subject: mm: hwpoison: call shake_page() unconditionally
Subject: mm: hwpoison: call shake_page() after try_to_unmap() for mlocked page
Subject: kasan: introduce helper functions for determining bug type
Subject: kasan: unify report headers
Subject: kasan: change allocation and freeing stack traces headers
Subject: kasan: simplify address description logic
Subject: kasan: change report header
Subject: kasan: improve slab object description
Subject: kasan: print page description after stacks
Subject: kasan: improve double-free report format
Subject: kasan: separate report parts by empty lines
^ permalink raw reply [flat|nested] 232+ messages in thread
* incoming
@ 2017-05-08 22:53 Andrew Morton
0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2017-05-08 22:53 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits
- the rest of MM
- various misc things
- procfs updates
- lib/ updates
- checkpatch updates
- kdump/kexec updates
- add kvmalloc helpers, use them
- time helper updates for Y2038 issues. We're almost ready to remove
current_fs_time() but that awaits a btrfs merge.
- add tracepoints to DAX.
114 patches, based on 13e0988140374123bead1dd27c287354cb95108e:
Subject: mm, compaction: reorder fields in struct compact_control
Subject: mm, compaction: remove redundant watermark check in compact_finished()
Subject: mm, page_alloc: split smallest stolen page in fallback
Subject: mm, page_alloc: count movable pages when stealing from pageblock
Subject: mm, compaction: change migrate_async_suitable() to suitable_migration_source()
Subject: mm, compaction: add migratetype to compact_control
Subject: mm, compaction: restrict async compaction to pageblocks of same migratetype
Subject: mm, compaction: finish whole pageblock to reduce fragmentation
Subject: fs/proc/inode.c: remove cast from memory allocation
Subject: proc/sysctl: fix the int overflow for jiffies conversion
Subject: drivers/virt/fsl_hypervisor.c: use get_user_pages_unlocked()
Subject: jiffies.h: declare jiffies and jiffies_64 with ____cacheline_aligned_in_smp
Subject: make help: add tools help target
Subject: kernel/hung_task.c: defer showing held locks
Subject: drivers/misc/vmw_vmci/vmci_queue_pair.c: fix a couple integer overflow tests
Subject: drivers/misc/c2port/c2port-duramar2150.c: checking for NULL instead of IS_ERR()
Subject: Revert "lib/test_sort.c: make it explicitly non-modular"
Subject: lib: add module support to array-based sort tests
Subject: lib: add module support to linked list sorting tests
Subject: firmware/Makefile: force recompilation if makefile changes
Subject: checkpatch: remove obsolete CONFIG_EXPERIMENTAL checks
Subject: checkpatch: add ability to find bad uses of vsprintf %p<foo> extensions
Subject: checkpatch: improve EMBEDDED_FUNCTION_NAME test
Subject: checkpatch: allow space leading blank lines in email headers
Subject: checkpatch: avoid suggesting struct definitions should be const
Subject: checkpatch: improve MULTISTATEMENT_MACRO_USE_DO_WHILE test
Subject: checkpatch: clarify the EMBEDDED_FUNCTION_NAME message
Subject: checkpatch: special audit for revert commit line
Subject: checkpatch: improve k.alloc with multiplication and sizeof test
Subject: checkpatch: add --typedefsfile
Subject: checkpatch: improve the embedded function name test for patch contexts
Subject: checkpatch: improve the SUSPECT_CODE_INDENT test
Subject: reiserfs: use designated initializers
Subject: fork: free vmapped stacks in cache when cpus are offline
Subject: cpumask: make "nr_cpumask_bits" unsigned
Subject: crash: move crashkernel parsing and vmcore related code under CONFIG_CRASH_CORE
Subject: ia64: reuse append_elf_note() and final_note() functions
Subject: powerpc/fadump: remove dependency with CONFIG_KEXEC
Subject: powerpc/fadump: reuse crashkernel parameter for fadump memory reservation
Subject: powerpc/fadump: update documentation about crashkernel parameter reuse
Subject: pidns: disable pid allocation if pid_ns_prepare_proc() is failed in alloc_pid()
Subject: ns: allow ns_entries to have custom symlink content
Subject: pidns: expose task pid_ns_for_children to userspace
Subject: taskstats: add e/u/stime for TGID command
Subject: kcov: simplify interrupt check
Subject: lib/fault-inject.c: use correct check for interrupts
Subject: lib/zlib_inflate/inftrees.c: fix potential buffer overflow
Subject: initramfs: provide a way to ignore image provided by bootloader
Subject: initramfs: use vfs_stat/lstat directly
Subject: ipc/shm: some shmat cleanups
Subject: sysv,ipc: cacheline align kern_ipc_perm
Subject: mm: introduce kv[mz]alloc helpers
Subject: mm, vmalloc: properly track vmalloc users
Subject: mm: support __GFP_REPEAT in kvmalloc_node for >32kB
Subject: lib/rhashtable.c: simplify a strange allocation pattern
Subject: net/ipv6/ila/ila_xlat.c: simplify a strange allocation pattern
Subject: fs/xattr.c: zero out memory copied to userspace in getxattr
Subject: treewide: use kv[mz]alloc* rather than opencoded variants
Subject: net: use kvmalloc with __GFP_REPEAT rather than open coded variant
Subject: drivers/md/dm-ioctl.c: use kvmalloc rather than opencoded variant
Subject: drivers/md/bcache/super.c: use kvmalloc
Subject: mm, swap: use kvzalloc to allocate some swap data structures
Subject: mm, vmalloc: use __GFP_HIGHMEM implicitly
Subject: scripts/spelling.txt: add "memory" pattern and fix typos
Subject: scripts/spelling.txt: add regsiter -> register spelling mistake
Subject: scripts/spelling.txt: add "intialise(d)" pattern and fix typo instances
Subject: treewide: spelling: correct diffrent[iate] and banlance typos
Subject: treewide: move set_memory_* functions away from cacheflush.h
Subject: arm: use set_memory.h header
Subject: arm64: use set_memory.h header
Subject: s390: use set_memory.h header
Subject: x86: use set_memory.h header
Subject: agp: use set_memory.h header
Subject: drm: use set_memory.h header
Subject: drivers/hwtracing/intel_th/msu.c: use set_memory.h header
Subject: drivers/watchdog/hpwdt.c: use set_memory.h header
Subject: include/linux/filter.h: use set_memory.h header
Subject: kernel/module.c: use set_memory.h header
Subject: kernel/power/snapshot.c: use set_memory.h header
Subject: alsa: use set_memory.h header
Subject: drivers/misc/sram-exec.c: use set_memory.h header
Subject: drivers/video/fbdev/vermilion/vermilion.c: use set_memory.h header
Subject: drivers/staging/media/atomisp/pci/atomisp2: use set_memory.h
Subject: treewide: decouple cacheflush.h and set_memory.h
Subject: kref: remove WARN_ON for NULL release functions
Subject: drivers/scsi/megaraid: remove expensive inline from megasas_return_cmd
Subject: include/linux/uaccess.h: remove expensive WARN_ON in pagefault_disabled_dec
Subject: fs: semove set but not checked AOP_FLAG_UNINTERRUPTIBLE flag
Subject: Documentation/vm/transhuge.txt: fix trivial typos
Subject: format-security: move static strings to const
Subject: fs: f2fs: use ktime_get_real_seconds for sit_info times
Subject: trace: make trace_hwlat timestamp y2038 safe
Subject: fs: cifs: replace CURRENT_TIME by other appropriate apis
Subject: fs: ceph: CURRENT_TIME with ktime_get_real_ts()
Subject: fs: ufs: use ktime_get_real_ts64() for birthtime
Subject: fs: ubifs: replace CURRENT_TIME_SEC with current_time
Subject: lustre: replace CURRENT_TIME macro
Subject: apparmorfs: replace CURRENT_TIME with current_time()
Subject: gfs2: replace CURRENT_TIME with current_time
Subject: time: delete CURRENT_TIME_SEC and CURRENT_TIME
Subject: mm/huge_memory.c: use zap_deposited_table() more
Subject: mm/huge_memory.c: deposit a pgtable for DAX PMD faults when required
Subject: mm: prevent potential recursive reclaim due to clearing PF_MEMALLOC
Subject: mm: introduce memalloc_noreclaim_{save,restore}
Subject: treewide: convert PF_MEMALLOC manipulations to new helpers
Subject: mtd: nand: nandsim: convert to memalloc_noreclaim_*()
Subject: dax: add tracepoints to dax_iomap_pte_fault()
Subject: dax: add tracepoints to dax_pfn_mkwrite()
Subject: dax: add tracepoints to dax_load_hole()
Subject: dax: add tracepoints to dax_writeback_mapping_range()
Subject: dax: add tracepoint to dax_writeback_one()
Subject: dax: add tracepoint to dax_insert_mapping()
Subject: selftests/vm: add a test for virtual address range mapping
Subject: drivers/staging/ccree/ssi_hash.c: fix build with gcc-4.4.4
^ permalink raw reply [flat|nested] 232+ messages in thread
* incoming
@ 2017-05-12 22:45 Andrew Morton
0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2017-05-12 22:45 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits
15 fixes, based on deac8429d62ca19c1571853e2a18f60e760ee04c:
Subject: hwpoison, memcg: forcibly uncharge LRU pages
Subject: time: delete current_fs_time()
Subject: mm, vmstat: Remove spurious WARN() during zoneinfo print
Subject: gcov: support GCC 7.1
Subject: mm/khugepaged: add missed tracepoint for collapse_huge_page_swapin
Subject: mm, vmalloc: fix vmalloc users tracking properly
Subject: Tigran has moved
Subject: dax: prevent invalidation of mapped DAX entries
Subject: mm: fix data corruption due to stale mmap reads
Subject: ext4: return to starting transaction in ext4_dax_huge_fault()
Subject: dax: fix data corruption when fault races with write
Subject: dax: fix PMD data corruption when fault races with write
Subject: mm, thp: copying user pages must schedule on collapse
Subject: mm: vmscan: scan until it finds eligible pages
Subject: mm, docs: update memory.stat description with workingset* entries
^ permalink raw reply [flat|nested] 232+ messages in thread
* incoming
@ 2017-06-02 21:45 Andrew Morton
0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2017-06-02 21:45 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits
15 fixes, baed on c531577bcdac51225f50033e0c89644873f4dc6d:
Subject: ksm: prevent crash after write_protect_page fails
Subject: include/linux/gfp.h: fix ___GFP_NOLOCKDEP value
Subject: frv: declare jiffies to be located in the .data section
Subject: mm: clarify why we want kmalloc before falling backto vmallock
Subject: initramfs: fix disabling of initramfs (and its compression)
Subject: slub/memcg: cure the brainless abuse of sysfs attributes
Subject: pcmcia: remove left-over %Z format
Subject: mm/page_alloc.c: make sure OOM victim can try allocations with no watermarks once
Subject: mm: avoid spurious 'bad pmd' warning messages
Subject: dax: fix race between colliding PMD & PTE entries
Subject: mm/migrate: fix refcount handling when !hugepage_migration_supported()
Subject: mlock: fix mlock count can not decrease in race condition
Subject: mm/hugetlb: report -EHWPOISON not -EFAULT when FOLL_HWPOISON is specified
Subject: mm: consider memblock reservations for deferred memory initialization sizing
Subject: scripts/gdb: make lx-dmesg command work (reliably)
^ permalink raw reply [flat|nested] 232+ messages in thread
* incoming
@ 2017-06-16 21:02 Andrew Morton
0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2017-06-16 21:02 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits
5 fixes, based on ab2789b72df3cf7a01e30636ea86cbbf44ba2e99:
Subject: mm/memory-failure.c: use compound_head() flags for huge pages
Subject: swap: cond_resched in swap_cgroup_prepare()
Subject: mm: numa: avoid waiting on freed migrated pages
Subject: userfaultfd: shmem: handle coredumping in handle_userfault()
Subject: mm: correct the comment when reclaimed pages exceed the scanned pages
^ permalink raw reply [flat|nested] 232+ messages in thread
* incoming
@ 2017-06-23 22:08 Andrew Morton
0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2017-06-23 22:08 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits
8 fixes, based on a38371cba67539ce6a5d5324db34bc2ddaf66cc1:
Subject: mm, thp: remove cond_resched from __collapse_huge_page_copy
Subject: mm/vmalloc.c: huge-vmap: fail gracefully on unexpected huge vmap mappings
Subject: autofs: sanity check status reported with AUTOFS_DEV_IOCTL_FAIL
Subject: fs/dax.c: fix inefficiency in dax_writeback_mapping_range()
Subject: lib/cmdline.c: fix get_options() overflow while parsing ranges
Subject: slub: make sysfs file removal asynchronous
Subject: ocfs2: fix deadlock caused by recursive locking in xattr
Subject: fs/exec.c: account for argv/envp pointers
^ permalink raw reply [flat|nested] 232+ messages in thread
* incoming
@ 2017-07-06 22:34 Andrew Morton
0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2017-07-06 22:34 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits
- a few hotfixes
- various misc updates
- ocfs2 updates
- most of MM
108 patches, based on 9ced560b82606b35adb33a27012a148d418a4c1f:
Subject: compiler, clang: always inline when CONFIG_OPTIMIZE_INLINING is disabled
Subject: thp, mm: fix crash due race in MADV_FREE handling
Subject: kernel/extable.c: mark core_kernel_text notrace
Subject: mn10300: remove wrapper header for asm/device.h
Subject: mn10300: use generic fb.h
Subject: tile: provide default ioremap declaration
Subject: scripts/gen_initramfs_list.sh: teach INITRAMFS_ROOT_UID and INITRAMFS_ROOT_GID that -1 means "current user".
Subject: ramfs: clarify help text that compression applies to ramfs as well as legacy ramdisk.
Subject: scripts/spelling.txt: add a bunch more spelling mistakes
Subject: provide linux/set_memory.h
Subject: kernel/power/snapshot.c: use linux/set_memory.h
Subject: kernel/module.c: use linux/set_memory.h
Subject: include/linux/filter.h: use linux/set_memory.h
Subject: drivers/sh/intc/virq.c: delete an error message for a failed memory allocation in add_virq_to_pirq()
Subject: ocfs2: fix a static checker warning
Subject: ocfs2: use magic.h
Subject: ocfs2: free 'dummy_sc' in sc_fop_release() to prevent memory leak
Subject: ocfs2: constify attribute_group structures
Subject: fs/file.c: replace alloc_fdmem() with kvmalloc() alternative
Subject: mm/slub.c: remove a redundant assignment in ___slab_alloc()
Subject: mm/slub: reset cpu_slab's pointer in deactivate_slab()
Subject: mm/slub.c: pack red_left_pad with another int to save a word
Subject: mm/slub.c: wrap cpu_slab->partial in CONFIG_SLUB_CPU_PARTIAL
Subject: mm/slub.c: wrap kmem_cache->cpu_partial in config CONFIG_SLUB_CPU_PARTIAL
Subject: mm/slab.c: replace open-coded round-up code with ALIGN
Subject: mm: allow slab_nomerge to be set at build time
Subject: mm, sparsemem: break out of loops early
Subject: mm/mmap.c: mark protection_map as __ro_after_init
Subject: mm/vmscan.c: fix unsequenced modification and access warning
Subject: mm/nobootmem.c: return 0 when start_pfn equals end_pfn
Subject: ksm: introduce ksm_max_page_sharing per page deduplication limit
Subject: ksm: fix use after free with merge_across_nodes = 0
Subject: ksm: cleanup stable_node chain collapse case
Subject: ksm: swap the two output parameters of chain/chain_prune
Subject: ksm: optimize refile of stable_node_dup at the head of the chain
Subject: zram: count same page write as page_stored
Subject: mm/vmstat.c: standardize file operations variable names
Subject: mm, THP, swap: delay splitting THP during swap out
Subject: mm, THP, swap: unify swap slot free functions to put_swap_page
Subject: mm, THP, swap: move anonymous THP split logic to vmscan
Subject: mm, THP, swap: check whether THP can be split firstly
Subject: mm, THP, swap: enable THP swap optimization only if has compound map
Subject: mm: remove return value from init_currently_empty_zone
Subject: mm, memory_hotplug: use node instead of zone in can_online_high_movable
Subject: mm: drop page_initialized check from get_nid_for_pfn
Subject: mm, memory_hotplug: get rid of is_zone_device_section
Subject: mm, memory_hotplug: split up register_one_node()
Subject: mm, memory_hotplug: consider offline memblocks removable
Subject: mm: consider zone which is not fully populated to have holes
Subject: mm, compaction: skip over holes in __reset_isolation_suitable
Subject: mm: __first_valid_page skip over offline pages
Subject: mm, vmstat: skip reporting offline pages in pagetypeinfo
Subject: mm, memory_hotplug: do not associate hotadded memory to zones until online
Subject: mm, memory_hotplug: fix MMOP_ONLINE_KEEP behavior
Subject: mm, memory_hotplug: do not assume ZONE_NORMAL is default kernel zone
Subject: mm, memory_hotplug: replace for_device by want_memblock in arch_add_memory
Subject: mm, memory_hotplug: fix the section mismatch warning
Subject: mm, memory_hotplug: remove unused cruft after memory hotplug rework
Subject: kernel/exit.c: don't include unused userfaultfd_k.h
Subject: fs/userfaultfd.c: drop dead code
Subject: mm/madvise: enable (soft|hard) offline of HugeTLB pages at PGD level
Subject: mm/hugetlb/migration: use set_huge_pte_at instead of set_pte_at
Subject: mm/follow_page_mask: split follow_page_mask to smaller functions.
Subject: mm/hugetlb: export hugetlb_entry_migration helper
Subject: mm/follow_page_mask: add support for hugetlb pgd entries
Subject: mm/hugetlb: move default definition of hugepd_t earlier in the header
Subject: mm/follow_page_mask: add support for hugepage directory entry
Subject: powerpc/hugetlb: add follow_huge_pd implementation for ppc64
Subject: powerpc/mm/hugetlb: remove follow_huge_addr for powerpc
Subject: powerpc/hugetlb: enable hugetlb migration for ppc64
Subject: mm: zero hash tables in allocator
Subject: mm: update callers to use HASH_ZERO flag
Subject: mm: adaptive hash table scaling
Subject: mm/hugetlb: clean up ARCH_HAS_GIGANTIC_PAGE
Subject: powerpc/mm/hugetlb: add support for 1G huge pages
Subject: mm/page_alloc.c: mark bad_range() and meminit_pfn_in_nid() as __maybe_unused
Subject: mm: drop NULL return check of pte_offset_map_lock()
Subject: arm64: hugetlb: refactor find_num_contig()
Subject: arm64: hugetlb: remove spurious calls to huge_ptep_offset()
Subject: mm, gup: remove broken VM_BUG_ON_PAGE compound check for hugepages
Subject: mm, gup: ensure real head page is ref-counted when using hugepages
Subject: mm/hugetlb: add size parameter to huge_pte_offset()
Subject: mm/hugetlb: allow architectures to override huge_pte_clear()
Subject: mm/hugetlb: introduce set_huge_swap_pte_at() helper
Subject: mm: rmap: use correct helper when poisoning hugepages
Subject: mm, page_alloc: fix more premature OOM due to race with cpuset update
Subject: mm, mempolicy: stop adjusting current->il_next in mpol_rebind_nodemask()
Subject: mm, page_alloc: pass preferred nid instead of zonelist to allocator
Subject: mm, mempolicy: simplify rebinding mempolicies when updating cpusets
Subject: mm, cpuset: always use seqlock when changing task's nodemask
Subject: mm, mempolicy: don't check cpuset seqlock where it doesn't matter
Subject: mm: kmemleak: slightly reduce the size of some structures on 64-bit architectures
Subject: mm: kmemleak: factor object reference updating out of scan_block()
Subject: mm: kmemleak: treat vm_struct as alternative reference to vmalloc'ed objects
Subject: mm: per-cgroup memory reclaim stats
Subject: mm/oom_kill: count global and memory cgroup oom kills
Subject: mm/swapfile.c: sort swap entries before free
Subject: mm/zswap.c: delete an error message for a failed memory allocation in zswap_pool_create()
Subject: mm/zswap.c: improve a size determination in zswap_frontswap_init()
Subject: mm/zswap.c: delete an error message for a failed memory allocation in zswap_dstmem_prepare()
Subject: mm: vmstat: move slab statistics from zone to node counters
Subject: mm: memcontrol: use the node-native slab memory counters
Subject: mm: memcontrol: use generic mod_memcg_page_state for kmem pages
Subject: mm: memcontrol: per-lruvec stats infrastructure
Subject: mm: memcontrol: account slab stats per lruvec
Subject: mm, memory_hotplug: drop artificial restriction on online/offline
Subject: mm, memory_hotplug: drop CONFIG_MOVABLE_NODE
Subject: mm, memory_hotplug: move movable_node to the hotplug proper
^ permalink raw reply [flat|nested] 232+ messages in thread
* incoming
@ 2017-07-10 22:46 Andrew Morton
0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2017-07-10 22:46 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits
- most of the rest of MM
- KASAN updates
- lib/ updates
- checkpatch updates
- some binfmt_elf changes
- various misc bits
115 patches, based on 9eb788800510ae1a6bc419636a66071ee4deafd5:
Subject: swap: add block io poll in swapin path
Subject: mm, page_alloc: fallback to smallest page when not stealing whole pageblock
Subject: mm/memory.c: convert to DEFINE_DEBUGFS_ATTRIBUTE
Subject: mm, vmscan: avoid thrashing anon lru when free + file is low
Subject: mm/memory_hotplug.c: add NULL check to avoid potential NULL pointer dereference
Subject: mm/zsmalloc.c: fix -Wunneeded-internal-declaration warning
Subject: fs/buffer.c: make bh_lru_install() more efficient
Subject: mm: hugetlb: prevent reuse of hwpoisoned free hugepages
Subject: mm: hugetlb: return immediately for hugetlb page in __delete_from_page_cache()
Subject: mm: hwpoison: change PageHWPoison behavior on hugetlb pages
Subject: mm: hugetlb: soft-offline: dissolve source hugepage after successful migration
Subject: mm: soft-offline: dissolve free hugepage if soft-offlined
Subject: mm: hwpoison: introduce memory_failure_hugetlb()
Subject: mm: hwpoison: dissolve in-use hugepage in unrecoverable memory error
Subject: mm: hugetlb: delete dequeue_hwpoisoned_huge_page()
Subject: mm: hwpoison: introduce idenfity_page_state
Subject: mm, vmpressure: pass-through notification support
Subject: mm: make PR_SET_THP_DISABLE immediately active
Subject: mm/memcontrol: exclude @root from checks in mem_cgroup_low
Subject: vmalloc: show lazy-purged vma info in vmallocinfo
Subject: mm/cma.c: warn if the CMA area could not be activated
Subject: mm/hugetlb.c: warn the user when issues arise on boot due to hugepages
Subject: oom, trace: remove ENUM evaluation of COMPACTION_FEEDBACK
Subject: mm: improve readability of transparent_hugepage_enabled()
Subject: mm: always enable thp for dax mappings
Subject: include/linux/page_ref.h: ensure page_ref_unfreeze is ordered against prior accesses
Subject: mm/migrate.c: stabilise page count when migrating transparent hugepages
Subject: zram: use __sysfs_match_string() helper
Subject: mm, memory_hotplug: support movable_node for hotpluggable nodes
Subject: mm, memory_hotplug: simplify empty node mask handling in new_node_page
Subject: hugetlb, memory_hotplug: prefer to use reserved pages for migration
Subject: mm: unify new_node_page and alloc_migrate_target
Subject: mm, hugetlb: schedule when potentially allocating many hugepages
Subject: mm, memcg: fix potential undefined behavior in mem_cgroup_event_ratelimit()
Subject: mm/hugetlb.c: replace memfmt with string_get_size
Subject: mm/truncate.c: fix THP handling in invalidate_mapping_pages()
Subject: userfaultfd: non-cooperative: add madvise() event for MADV_FREE request
Subject: mm/oom_kill.c: add tracepoints for oom reaper-related events
Subject: mm, hugetlb: unclutter hugetlb allocation layers
Subject: hugetlb: add support for preferred node to alloc_huge_page_nodemask
Subject: mm, hugetlb, soft_offline: use new_page_nodemask for soft offline migration
Subject: mm: avoid taking zone lock in pagetypeinfo_showmixed()
Subject: mm: drop useless local parameters of __register_one_node()
Subject: fs/proc/task_mmu.c: remove obsolete comment in show_map_vma()
Subject: mm/page_alloc.c: eliminate unsigned confusion in __rmqueue_fallback
Subject: mm/swap_slots.c: don't disable preemption while taking the per-CPU cache
Subject: include/linux/mmzone.h: remove ancient/ambiguous comment
Subject: include/linux/backing-dev.h: simplify wb_stat_sum
Subject: mm: document highmem_is_dirtyable sysctl
Subject: mm/memory_hotplug.c: remove unused local zone_type from __remove_zone()
Subject: cma: fix calculation of aligned offset
Subject: mm/balloon_compaction.c: enqueue zero page to balloon device
Subject: mm/mmap.c: do not blow on PROT_NONE MAP_FIXED holes in the stack
Subject: mm/mmap.c: expand_downwards: don't require the gap if !vm_prev
Subject: mm/list_lru.c: fix list_lru_count_node() to be race free
Subject: fs/dcache.c: fix spin lockup issue on nlru->lock
Subject: mm: use dedicated helper to access rlimit value
Subject: mm: swap: provide lru_add_drain_all_cpuslocked()
Subject: mm/memory-hotplug: switch locking to a percpu rwsem
Subject: mm: disallow early_pfn_to_nid on configurations which do not implement it
Subject: zram: constify attribute_group structures.
Subject: mm/zsmalloc: simplify zs_max_alloc_size handling
Subject: mm/kasan/kasan_init.c: use kasan_zero_pud for p4d table
Subject: mm/kasan: get rid of speculative shadow checks
Subject: x86/kasan: don't allocate extra shadow memory
Subject: arm64/kasan: don't allocate extra shadow memory
Subject: mm/kasan: add support for memory hotplug
Subject: mm/kasan/kasan.c: rename XXX_is_zero to XXX_is_nonzero
Subject: kasan: make get_wild_bug_type() static
Subject: frv: remove wrapper header for asm/device.h
Subject: frv: use generic fb.h
Subject: frv: cmpxchg: implement cmpxchg64()
Subject: fs/proc/generic.c: switch to ida_simple_get/remove
Subject: asm-generic/bug.h: declare struct pt_regs; before function prototype
Subject: linux/bug.h: correct formatting of block comment
Subject: linux/bug.h: correct "(foo*)" should be "(foo *)"
Subject: linux/bug.h: correct "space required before that '-'"
Subject: bug: split BUILD_BUG stuff out into <linux/build_bug.h>
Subject: ARM: fix rd_size declaration
Subject: kernel/ksysfs.c: constify attribute_group structures.
Subject: kernel/groups.c: use sort library function
Subject: kernel/kallsyms.c: replace all_var with IS_ENABLED(CONFIG_KALLSYMS_ALL)
Subject: MAINTAINERS: give proc sysctl some maintainer love
Subject: lib/test_bitmap.c: add optimisation tests
Subject: bitmap: optimise bitmap_set and bitmap_clear of a single bit
Subject: include/linux/bitmap.h: turn bitmap_set and bitmap_clear into memset when possible
Subject: bitmap: use memcmp optimisation in more situations
Subject: lib/kstrtox.c: delete end-of-string test
Subject: lib/kstrtox.c: use "unsigned int" more
Subject: lib/interval_tree_test.c: allow the module to be compiled-in
Subject: lib/interval_tree_test.c: make test options module parameters
Subject: lib/interval_tree_test.c: allow users to limit scope of endpoint
Subject: lib/interval_tree_test.c: allow full tree search
Subject: lib/rhashtable.c: use kvzalloc() in bucket_table_alloc() when possible
Subject: lib/extable.c: use bsearch() library function in search_extable()
Subject: lib/bsearch.c: micro-optimize pivot position calculation
Subject: checkpatch: improve the unnecessary OOM message test
Subject: checkpatch: warn when a MAINTAINERS entry isn't [A-Z]:\t
Subject: checkpatch: [HLP]LIST_HEAD is also declaration
Subject: checkpatch: fix stepping through statements with $stat and ctx_statement_block
Subject: checkpatch: remove false warning for commit reference
Subject: checkpatch: improve tests for multiple line function definitions
Subject: checkpatch: silence perl 5.26.0 unescaped left brace warnings
Subject: checkpatch: change format of --color argument to --color[=WHEN]
Subject: checkpatch: improve macro reuse test
Subject: checkpatch: improve multi-line alignment test
Subject: fs, epoll: short circuit fetching events if thread has been killed
Subject: binfmt_elf: use ELF_ET_DYN_BASE only for PIE
Subject: arm: move ELF_ET_DYN_BASE to 4MB
Subject: arm64: move ELF_ET_DYN_BASE to 4GB / 4MB
Subject: powerpc: move ELF_ET_DYN_BASE to 4GB / 4MB
Subject: s390: reduce ELF_ET_DYN_BASE
Subject: binfmt_elf: safely increment argv pointers
Subject: kernel/signal.c: avoid undefined behaviour in kill_something_info
Subject: kernel/exit.c: avoid undefined behaviour when calling wait4()
^ permalink raw reply [flat|nested] 232+ messages in thread
* incoming
@ 2017-07-12 21:32 Andrew Morton
0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2017-07-12 21:32 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits
- various misc things
- kexec updates
- sysctl core updates
- scripts/gdb udpates
- checkpoint-restart updates
- ipc updates
- kernel/watchdog updates
- Kees's "rough equivalent to the glibc _FORTIFY_SOURCE=1 feature"
- "stackprotector: ascii armor the stack canary"
- more MM bits
- checkpatch updates
96 patches, based on 235b84fc862ae2637dc0dabada18d97f1bfc18e1:
Subject: include/linux/dcache.h: use unsigned chars in struct name_snapshot
Subject: kernel.h: handle pointers to arrays better in container_of()
Subject: mm/memory.c: mark create_huge_pmd() inline to prevent build failure
Subject: kernel/fork.c: virtually mapped stacks: do not disable interrupts
Subject: kexec: move vmcoreinfo out of the kernel's .bss section
Subject: powerpc/fadump: use the correct VMCOREINFO_NOTE_SIZE for phdr
Subject: kdump: protect vmcoreinfo data under the crash memory
Subject: kexec/kdump: minor Documentation updates for arm64 and Image
Subject: sysctl: fix lax sysctl_check_table() sanity check
Subject: sysctl: kdoc'ify sysctl_writes_strict
Subject: sysctl: fold sysctl_writes_strict checks into helper
Subject: sysctl: simplify unsigned int support
Subject: sysctl: add unsigned int range support
Subject: test_sysctl: add dedicated proc sysctl test driver
Subject: test_sysctl: add generic script to expand on tests
Subject: test_sysctl: test against PAGE_SIZE for int
Subject: test_sysctl: add simple proc_dointvec() case
Subject: test_sysctl: add simple proc_douintvec() case
Subject: test_sysctl: test against int proc_dointvec() array support
Subject: kernel/sysctl_binary.c: check name array length in deprecated_sysctl_warning()
Subject: random: do not ignore early device randomness
Subject: bfs: fix sanity checks for empty files
Subject: fs/Kconfig: kill CONFIG_PERCPU_RWSEM some more
Subject: scripts/gdb: add lx-fdtdump command
Subject: scripts/gdb: lx-dmesg: cast log_buf to void* for addr fetch
Subject: scripts/gdb: lx-dmesg: use explicit encoding=utf8 errors=replace
Subject: kfifo: clean up example to not use page_link
Subject: procfs: fdinfo: extend information about epoll target files
Subject: kcmp: add KCMP_EPOLL_TFD mode to compare epoll target files
Subject: kcmp: fs/epoll: wrap kcmp code with CONFIG_CHECKPOINT_RESTORE
Subject: fault-inject: support systematic fault injection
Subject: ipc/sem.c: remove sem_base, embed struct sem
Subject: ipc: merge ipc_rcu and kern_ipc_perm
Subject: include/linux/sem.h: correctly document sem_ctime
Subject: ipc: drop non-RCU allocation
Subject: ipc/sem: do not use ipc_rcu_free()
Subject: ipc/shm: do not use ipc_rcu_free()
Subject: ipc/msg: do not use ipc_rcu_free()
Subject: ipc/util: drop ipc_rcu_free()
Subject: ipc/sem: avoid ipc_rcu_alloc()
Subject: ipc/shm: avoid ipc_rcu_alloc()
Subject: ipc/msg: avoid ipc_rcu_alloc()
Subject: ipc/util: drop ipc_rcu_alloc()
Subject: ipc/sem.c: avoid ipc_rcu_putref for failed ipc_addid()
Subject: ipc/shm.c: avoid ipc_rcu_putref for failed ipc_addid()
Subject: ipc/msg.c: avoid ipc_rcu_putref for failed ipc_addid()
Subject: ipc: move atomic_set() to where it is needed
Subject: ipc/shm: remove special shm_alloc/free
Subject: ipc/msg: remove special msg_alloc/free
Subject: ipc/sem: drop __sem_free()
Subject: ipc/util.h: update documentation for ipc_getref() and ipc_putref()
Subject: net/netfilter/x_tables.c: use kvmalloc() in xt_alloc_table_info()
Subject: kernel/watchdog: remove unused declaration
Subject: kernel/watchdog: introduce arch_touch_nmi_watchdog()
Subject: kernel/watchdog: split up config options
Subject: kernel/watchdog: provide watchdog_nmi_reconfigure() for arch watchdogs
Subject: powerpc/64s: implement arch-specific hardlockup watchdog
Subject: efi: avoid fortify checks in EFI stub
Subject: kexec_file: adjust declaration of kexec_purgatory
Subject: IB/rxe: do not copy extra stack memory to skb
Subject: powerpc: don't fortify prom_init
Subject: powerpc: make feature-fixup tests fortify-safe
Subject: include/linux/string.h: add the option of fortified string.h functions
Subject: sh: mark end of BUG() implementation as unreachable
Subject: random,stackprotect: introduce get_random_canary function
Subject: fork,random: use get_random_canary() to set tsk->stack_canary
Subject: x86: ascii armor the x86_64 boot init stack canary
Subject: arm64: ascii armor the arm64 boot init stack canary
Subject: sh64: ascii armor the sh64 boot init stack canary
Subject: x86/mmap: properly account for stack randomization in mmap_base
Subject: arm64/mmap: properly account for stack randomization in mmap_base
Subject: powerpc,mmap: properly account for stack randomization in mmap_base
Subject: MIPS: do not use __GFP_REPEAT for order-0 request
Subject: mm, tree wide: replace __GFP_REPEAT by __GFP_RETRY_MAYFAIL with more useful semantic
Subject: xfs: map KM_MAYFAIL to __GFP_RETRY_MAYFAIL
Subject: mm: kvmalloc support __GFP_RETRY_MAYFAIL for all sizes
Subject: drm/i915: use __GFP_RETRY_MAYFAIL
Subject: mm, migration: do not trigger OOM killer when migrating memory
Subject: checkpatch: improve the STORAGE_CLASS test
Subject: ARM: KVM: move asmlinkage before type
Subject: ARM: HP Jornada 7XX: move inline before return type
Subject: CRIS: gpio: move inline before return type
Subject: FRV: tlbflush: move asmlinkage before return type
Subject: ia64: move inline before return type
Subject: ia64: sn: pci: move inline before type
Subject: m68k: coldfire: move inline before return type
Subject: MIPS: SMP: move asmlinkage before return type
Subject: sh: move inline before return type
Subject: x86/efi: move asmlinkage before return type
Subject: drivers: s390: move static and inline before return type
Subject: drivers: tty: serial: move inline before return type
Subject: USB: serial: safe_serial: move __inline__ before return type
Subject: video: fbdev: intelfb: move inline before return type
Subject: video: fbdev: omap: move inline before return type
Subject: ARM: samsung: usb-ohci: move inline before return type
Subject: writeback: rework wb_[dec|inc]_stat family of functions
^ permalink raw reply [flat|nested] 232+ messages in thread
* incoming
@ 2017-07-14 21:46 Andrew Morton
0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2017-07-14 21:46 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits
- a few leftovers
- fault-injector rework
- add a module loader test driver
13 patches, based on b86faee6d111294fa95a2e89b5f771b2da3c9782:
Subject: mm: fix overflow check in expand_upwards()
Subject: lib/atomic64_test.c: add a test that atomic64_inc_not_zero() returns an int
Subject: MAINTAINERS: move the befs tree to kernel.org
Subject: kernel/watchdog.c: use better pr_fmt prefix
Subject: fault-inject: automatically detect the number base for fail-nth write interface
Subject: fault-inject: parse as natural 1-based value for fail-nth write interface
Subject: fault-inject: make fail-nth read/write interface symmetric
Subject: fault-inject: simplify access check for fail-nth
Subject: fault-inject: add /proc/<pid>/fail-nth
Subject: xtensa: use generic fb.h
Subject: MAINTAINERS: give kmod some maintainer love
Subject: kmod: add test driver to stress test the module loader
Subject: kmod: throttle kmod thread limit
^ permalink raw reply [flat|nested] 232+ messages in thread
* incoming
@ 2017-08-02 20:31 Andrew Morton
0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2017-08-02 20:31 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits
16 fixes, based on 4d3f5d04d69e9479a3df88ceb0e2cd8188a49366:
Subject: mm/hugetlb.c: __get_user_pages ignores certain follow_hugetlb_page errors
Subject: pid: kill pidhash_size in pidhash_init()
Subject: mm, mprotect: flush TLB if potentially racing with a parallel reclaim leaving stale TLB entries
Subject: userfaultfd: non-cooperative: notify about unmap of destination during mremap
Subject: kasan: avoid -Wmaybe-uninitialized warning
Subject: kthread: fix documentation build warning
Subject: zram: do not free pool->size_class
Subject: fortify: use WARN instead of BUG for now
Subject: mm/page_io.c: fix oops during block io poll in swapin path
Subject: mm: take memory hotplug lock within numa_zonelist_order_handler()
Subject: userfaultfd_zeropage: return -ENOSPC in case mm has gone
Subject: cpuset: fix a deadlock due to incomplete patching of cpusets_enabled()
Subject: ipc: add missing container_of()s for randstruct
Subject: userfaultfd: non-cooperative: flush event_wqh at release time
Subject: mm: allow page_cache_get_speculative in interrupt context
Subject: ocfs2: don't clear SGID when inheriting ACLs
^ permalink raw reply [flat|nested] 232+ messages in thread
* incoming
@ 2017-08-10 22:23 Andrew Morton
0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2017-08-10 22:23 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits
21 fixes, based on 26273939ace935dd7553b31d279eab30b40f7b9a:
Subject: mm: fix global NR_SLAB_.*CLAIMABLE counter reads
Subject: mm: ratelimit PFNs busy info message
Subject: userfaultfd: hugetlbfs: remove superfluous page unlock in VM_SHARED case
Subject: test_kmod: fix spelling mistake: "EMTPY" -> "EMPTY"
Subject: test_kmod: fix bug which allows negative values on two config options
Subject: test_kmod: fix the lock in register_test_dev_kmod()
Subject: test_kmod: fix small memory leak on filesystem tests
Subject: fault-inject: fix wrong should_fail() decision in task context
Subject: mm: migrate: prevent racy access to tlb_flush_pending
Subject: mm: migrate: fix barriers around tlb_flush_pending
Subject: Revert "mm: numa: defer TLB flush for THP migration as long as possible"
Subject: mm: refactor TLB gathering API
Subject: mm: make tlb_flush_pending global
Subject: mm: fix MADV_[FREE|DONTNEED] TLB flush miss problem
Subject: mm: fix KSM data corruption
Subject: MAINTAINERS: copy virtio on balloon_compaction.c
Subject: mm/balloon_compaction.c: don't zero ballooned pages
Subject: mm: fix list corruptions on shmem shrinklist
Subject: rmap: do not call mmu_notifier_invalidate_page() under ptl
Subject: zram: rework copy of compressor name in comp_algorithm_store()
Subject: userfaultfd: replace ENOSPC with ESRCH in case mm has gone during copy/zeropage
^ permalink raw reply [flat|nested] 232+ messages in thread
* incoming
@ 2017-08-18 22:15 Andrew Morton
0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2017-08-18 22:15 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits
14 fixes, based on 039a8e38473323ed9f6c4415b4c3a36777efac34:
Subject: mm: memcontrol: fix NULL pointer crash in test_clear_page_writeback()
Subject: kernel/watchdog: fix Kconfig constraints for perf hardlockup watchdog
Subject: wait: add wait_event_killable_timeout()
Subject: kmod: fix wait on recursive loop
Subject: test_kmod: fix description for -s -and -c parameters
Subject: mm: discard memblock data later
Subject: slub: fix per memcg cache leak on css offline
Subject: mm: fix double mmap_sem unlock on MMF_UNSTABLE enforced SIGBUS
Subject: mm, oom: fix potential data corruption when oom_reaper races with writer
Subject: signal: don't remove SIGNAL_UNKILLABLE for traced tasks.
Subject: mm/cma_debug.c: fix stack corruption due to sprintf usage
Subject: mm/mempolicy: fix use after free when calling get_mempolicy
Subject: mm/vmalloc.c: don't unconditonally use __GFP_HIGHMEM
Subject: mm: revert x86_64 and arm64 ELF_ET_DYN_BASE base changes
^ permalink raw reply [flat|nested] 232+ messages in thread
* incoming
@ 2017-08-25 22:55 Andrew Morton
0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2017-08-25 22:55 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits
6 fixes, based on 90a6cd503982bfd33ce8c70eb49bd2dd33bc6325:
Subject: PM/hibernate: touch NMI watchdog when creating snapshot
Subject: mm, shmem: fix handling /sys/kernel/mm/transparent_hugepage/shmem_enabled
Subject: dax: fix deadlock due to misaligned PMD faults
Subject: mm/madvise.c: fix freeing of locked page with MADV_FREE
Subject: fork: fix incorrect fput of ->exe_file causing use-after-free
Subject: mm/memblock.c: reversed logic in memblock_discard()
^ permalink raw reply [flat|nested] 232+ messages in thread
* incoming
@ 2017-08-31 23:15 Andrew Morton
0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2017-08-31 23:15 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits
6 fixes, baed on 42ff72cf27027fa28dd79acabe01d9196f1480a7:
Subject: mm,page_alloc: don't call __node_reclaim() with oom_lock held.
Subject: kernel/kthread.c: kthread_worker: don't hog the cpu
Subject: mm, uprobes: fix multiple free of ->uprobes_state.xol_area
Subject: mm, madvise: ensure poisoned pages are removed from per-cpu lists
Subject: include/linux/compiler.h: don't perform compiletime_assert with -O0
Subject: scripts/dtc: fix '%zx' warning
^ permalink raw reply [flat|nested] 232+ messages in thread
* incoming
@ 2017-09-06 23:17 Andrew Morton
0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2017-09-06 23:17 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits
- various misc bits
- DAX updates
- OCFS2
- most of MM
119 patches, based on e7d0c41ecc2e372a81741a30894f556afec24315:
Subject: metag/numa: remove the unused parent_node() macro
Subject: mm: add vm_insert_mixed_mkwrite()
Subject: dax: relocate some dax functions
Subject: dax: use common 4k zero page for dax mmap reads
Subject: dax: remove DAX code from page_cache_tree_insert()
Subject: dax: move all DAX radix tree defs to fs/dax.c
Subject: dax: explain how read(2)/write(2) addresses are validated
Subject: dax: use PG_PMD_COLOUR instead of open coding
Subject: dax: initialize variable pfn before using it
Subject: modpost: simplify sec_name()
Subject: ocfs2: make ocfs2_set_acl() static
Subject: ocfs2: clean up some dead code
Subject: slub: tidy up initialization ordering
Subject: mm: add SLUB free list pointer obfuscation
Subject: mm/slub.c: add a naive detection of double free or corruption
Subject: mm: track actual nr_scanned during shrink_slab()
Subject: drm/i915: wire up shrinkctl->nr_scanned
Subject: mm/memory_hotplug: just build zonelist for newly added node
Subject: mm, memory_hotplug: display allowed zones in the preferred ordering
Subject: mm, memory_hotplug: remove zone restrictions
Subject: zram: clean up duplicated codes in __zram_bvec_write
Subject: zram: inline zram_compress
Subject: zram: rename zram_decompress_page to __zram_bvec_read
Subject: zram: add interface to specif backing device
Subject: zram: add free space management in backing device
Subject: zram: identify asynchronous IO's return value
Subject: zram: write incompressible pages to backing device
Subject: zram: read page from backing device
Subject: zram: add config and doc file for writeback feature
Subject: mm, page_alloc: rip out ZONELIST_ORDER_ZONE
Subject: mm, page_alloc: remove boot pageset initialization from memory hotplug
Subject: mm, page_alloc: do not set_cpu_numa_mem on empty nodes initialization
Subject: mm, memory_hotplug: drop zone from build_all_zonelists
Subject: mm, memory_hotplug: remove explicit build_all_zonelists from try_online_node
Subject: mm, page_alloc: simplify zonelist initialization
Subject: mm, page_alloc: remove stop_machine from build_all_zonelists
Subject: mm, memory_hotplug: get rid of zonelists_mutex
Subject: mm, sparse, page_ext: drop ugly N_HIGH_MEMORY branches for allocations
Subject: mm, page_owner: make init_pages_in_zone() faster
Subject: mm, page_ext: periodically reschedule during page_ext_init()
Subject: mm, page_owner: don't grab zone->lock for init_pages_in_zone()
Subject: mm/mremap: fail map duplication attempts for private mappings
Subject: mm/gup: make __gup_device_* require THP
Subject: mm/hugetlb.c: make huge_pte_offset() consistent and document behaviour
Subject: mm: always flush VMA ranges affected by zap_page_range
Subject: zsmalloc: zs_page_migrate: skip unnecessary loops but not return -EBUSY if zspage is not inuse
Subject: mm, vmscan: do not loop on too_many_isolated for ever
Subject: fscache: remove unused ->now_uncached callback
Subject: mm: make pagevec_lookup() update index
Subject: mm: implement find_get_pages_range()
Subject: fs: fix performance regression in clean_bdev_aliases()
Subject: ext4: use pagevec_lookup_range() in ext4_find_unwritten_pgoff()
Subject: ext4: use pagevec_lookup_range() in writeback code
Subject: hugetlbfs: use pagevec_lookup_range() in remove_inode_hugepages()
Subject: fs: use pagevec_lookup_range() in page_cache_seek_hole_data()
Subject: mm: use find_get_pages_range() in filemap_range_has_page()
Subject: mm: remove nr_pages argument from pagevec_lookup{,_range}()
Subject: mm, memcg: reset memory.low during memcg offlining
Subject: cgroup: revert fa06235b8eb0 ("cgroup: reset css on destruction")
Subject: mm/ksm.c: constify attribute_group structures
Subject: mm/slub.c: constify attribute_group structures
Subject: mm/page_idle.c: constify attribute_group structures
Subject: mm/huge_memory.c: constify attribute_group structures
Subject: mm/hugetlb.c: constify attribute_group structures
Subject: mm: memcontrol: use int for event/state parameter in several functions
Subject: mm, THP, swap: support to clear swap cache flag for THP swapped out
Subject: mm, THP, swap: support to reclaim swap space for THP swapped out
Subject: mm, THP, swap: make reuse_swap_page() works for THP swapped out
Subject: mm, THP, swap: don't allocate huge cluster for file backed swap device
Subject: block, THP: make block_device_operations.rw_page support THP
Subject: mm: test code to write THP to swap device as a whole
Subject: mm, THP, swap: support splitting THP for THP swap out
Subject: memcg, THP, swap: support move mem cgroup charge for THP swapped out
Subject: memcg, THP, swap: avoid to duplicated charge THP in swap cache
Subject: memcg, THP, swap: make mem_cgroup_swapout() support THP
Subject: mm, THP, swap: delay splitting THP after swapped out
Subject: mm, THP, swap: add THP swapping out fallback counting
Subject: shmem: shmem_charge: verify max_block is not exceeded before inode update
Subject: shmem: introduce shmem_inode_acct_block
Subject: userfaultfd: shmem: add shmem_mfill_zeropage_pte for userfaultfd support
Subject: userfaultfd: mcopy_atomic: introduce mfill_atomic_pte helper
Subject: userfaultfd: shmem: wire up shmem_mfill_zeropage_pte
Subject: userfaultfd: report UFFDIO_ZEROPAGE as available for shmem VMAs
Subject: userfaultfd: selftest: enable testing of UFFDIO_ZEROPAGE for shmem
Subject: fs/sync.c: remove unnecessary NULL f_mapping check in sync_file_range
Subject: include/linux/fs.h: remove unneeded forward definition of mm_struct
Subject: mm: hugetlb: define system call hugetlb size encodings in single file
Subject: mm: arch: consolidate mmap hugetlb size encodings
Subject: mm: shm: use new hugetlb size encoding definitions
Subject: mm: rename global_page_state to global_zone_page_state
Subject: mm: userfaultfd: add feature to request for a signal delivery
Subject: userfaultfd: selftest: add tests for UFFD_FEATURE_SIGBUS feature
Subject: userfaultfd: selftest: exercise UFFDIO_COPY/ZEROPAGE -EEXIST
Subject: userfaultfd: selftest: explicit failure if the SIGBUS test failed
Subject: userfaultfd: call userfaultfd_unmap_prep only if __split_vma succeeds
Subject: userfaultfd: provide pid in userfault msg
Subject: userfaultfd: provide pid in userfault msg - add feat union
Subject: mm, hugetlb: do not allocate non-migrateable gigantic pages from movable zones
Subject: mm/vmstat: fix divide error at __fragmentation_index
Subject: mm/vmalloc.c: halve the number of comparisons performed in pcpu_get_vm_areas()
Subject: mm, devm_memremap_pages: use multi-order radix for ZONE_DEVICE lookups
Subject: mm/shmem: add hugetlbfs support to memfd_create()
Subject: selftests/memfd: add memfd_create hugetlbfs selftest
Subject: mm/vmstat.c: fix wrong comment
Subject: mm/vmalloc.c: don't reinvent the wheel but use existing llist API
Subject: mm, swap: add swap readahead hit statistics
Subject: mm, swap: fix swap readahead marking
Subject: mm, swap: VMA based swap readahead
Subject: mm, swap: add sysfs interface for VMA based swap readahead
Subject: mm, swap: don't use VMA based swap readahead if HDD is used as swap
Subject: z3fold: use per-cpu unbuddied lists
Subject: mm, oom: do not rely on TIF_MEMDIE for memory reserves access
Subject: mm: replace TIF_MEMDIE checks by tsk_is_oom_victim
Subject: swap: choose swap device according to numa node
Subject: mm: oom: let oom_reap_task and exit_mmap run concurrently
Subject: mm: hugetlb: clear target sub-page last when clearing huge page
Subject: mm: add /proc/pid/smaps_rollup
Subject: x86,mpx: make mpx depend on x86-64 to free up VMA flag
Subject: mm,fork: introduce MADV_WIPEONFORK
^ permalink raw reply [flat|nested] 232+ messages in thread
* incoming
@ 2017-09-08 23:10 Andrew Morton
[not found] ` <CA+55aFwRXB5_kSuN7o+tqN6Eft6w5oZuLG3B8Rns=0ZZa2ihgA@mail.gmail.com>
0 siblings, 1 reply; 232+ messages in thread
From: Andrew Morton @ 2017-09-08 23:10 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits
126 patches, based on 015a9e66b9b8c1f28097ed09bf9350708e26249a:
- most of the rest of MM
- a small number of misc things
- lib/ updates
- checkpatch
- autofs updates
- ipc/ updates
Subject: mm: mempolicy: add queue_pages_required()
Subject: mm: x86: move _PAGE_SWP_SOFT_DIRTY from bit 7 to bit 1
Subject: mm: thp: introduce separate TTU flag for thp freezing
Subject: mm: thp: introduce CONFIG_ARCH_ENABLE_THP_MIGRATION
Subject: mm: thp: enable thp migration in generic path
Subject: mm: thp: check pmd migration entry in common path
Subject: mm: soft-dirty: keep soft-dirty bits over thp migration
Subject: mm: mempolicy: mbind and migrate_pages support thp migration
Subject: mm: migrate: move_pages() supports thp migration
Subject: mm: memory_hotplug: memory hotremove supports thp migration
Subject: hmm: heterogeneous memory management documentation
Subject: mm/hmm: heterogeneous memory management (HMM for short)
Subject: mm/hmm/mirror: mirror process address space on device with HMM helpers
Subject: mm/hmm/mirror: helper to snapshot CPU page table
Subject: mm/hmm/mirror: device page fault handler
Subject: mm/memory_hotplug: introduce add_pages
Subject: mm/ZONE_DEVICE: new type of ZONE_DEVICE for unaddressable memory
Subject: mm/ZONE_DEVICE: special case put_page() for device private pages
Subject: mm/memcontrol: allow to uncharge page without using page->lru field
Subject: mm/memcontrol: support MEMORY_DEVICE_PRIVATE
Subject: mm/hmm/devmem: device memory hotplug using ZONE_DEVICE
Subject: mm/hmm/devmem: dummy HMM device for ZONE_DEVICE memory
Subject: mm/migrate: new migrate mode MIGRATE_SYNC_NO_COPY
Subject: mm/migrate: new memory migration helper for use with device memory
Subject: mm/migrate: migrate_vma() unmap page from vma while collecting pages
Subject: mm/migrate: support un-addressable ZONE_DEVICE page in migration
Subject: mm/migrate: allow migrate_vma() to alloc new page on empty entry
Subject: mm/device-public-memory: device memory cache coherent with CPU
Subject: mm/hmm: add new helper to hotplug CDM memory region
Subject: mm/hmm: avoid bloating arch that do not make use of HMM
Subject: mm/hmm: fix build when HMM is disabled
Subject: mm: remove useless vma parameter to offset_il_node
Subject: userfaultfd: non-cooperative: closing the uffd without triggering SIGBUS
Subject: mm/memory.c: remove reduntant check for write access
Subject: mm: change the call sites of numa statistics items
Subject: mm: update NUMA counter threshold size
Subject: mm: consider the number in local CPUs when reading NUMA stats
Subject: mm/mlock.c: use page_zone() instead of page_zone_id()
Subject: mm/zsmalloc.c: change stat type parameter to int
Subject: mm: fadvise: avoid fadvise for fs without backing device
Subject: mm: memcontrol: use per-cpu stocks for socket memory uncharging
Subject: mm/memory.c: fix mem_cgroup_oom_disable() call missing
Subject: mm/sparse.c: fix typo in online_mem_sections
Subject: tools/testing/selftests/kcmp/kcmp_test.c: add KCMP_EPOLL_TFD testing
Subject: mm/page_alloc.c: apply gfp_allowed_mask before the first allocation attempt
Subject: mm: kvfree the swap cluster info if the swap file is unsatisfactory
Subject: mm/swapfile.c: fix swapon frontswap_map memory leak on error
Subject: mm/mempolicy.c: remove BUG_ON() checks for VMA inside mpol_misplaced()
Subject: fs, proc: remove priv argument from is_stack
Subject: proc: uninline proc_create()
Subject: fs, proc: unconditional cond_resched when reading smaps
Subject: linux/kernel.h: move DIV_ROUND_DOWN_ULL() macro
Subject: lib/string.c: add multibyte memset functions
Subject: lib/string.c: add testcases for memset16/32/64
Subject: x86: implement memset16, memset32 & memset64
Subject: ARM: implement memset32 & memset64
Subject: alpha: add support for memset16
Subject: drivers/block/zram/zram_drv.c: convert to using memset_l
Subject: drivers/scsi/sym53c8xx_2/sym_hipd.c: convert to use memset32
Subject: vga: optimise console scrolling
Subject: treewide: make "nr_cpu_ids" unsigned
Subject: arch: define CPU_BIG_ENDIAN for all fixed big endian archs
Subject: arch/microblaze: add choice for endianness and update Makefile
Subject: include: warn for inconsistent endian config definition
Subject: bitops: avoid integer overflow in GENMASK(_ULL)
Subject: rbtree: cache leftmost node internally
Subject: rbtree: optimize root-check during rebalancing loop
Subject: rbtree: add some additional comments for rebalancing cases
Subject: lib/rbtree_test.c: make input module parameters
Subject: lib/rbtree_test.c: add (inorder) traversal test
Subject: lib/rbtree_test.c: support rb_root_cached
Subject: sched/fair: replace cfs_rq->rb_leftmost
Subject: sched/deadline: replace earliest dl and rq leftmost caching
Subject: locking/rtmutex: replace top-waiter and pi_waiters leftmost caching
Subject: block/cfq: replace cfq_rb_root leftmost caching
Subject: lib/interval_tree: fast overlap detection
Subject: lib/interval-tree: correct comment wrt generic flavor
Subject: procfs: use faster rb_first_cached()
Subject: fs/epoll: use faster rb_first_cached()
Subject: mem/memcg: cache rightmost node
Subject: block/cfq: cache rightmost rb_node
Subject: lib/hexdump.c: return -EINVAL in case of error in hex2bin()
Subject: lib: add test module for CONFIG_DEBUG_VIRTUAL
Subject: lib/bitmap.c: make bitmap_parselist() thread-safe and much faster
Subject: lib/test_bitmap.c: add test for bitmap_parselist()
Subject: bitmap: introduce BITMAP_FROM_U64()
Subject: lib/rhashtable: fix comment on locks_mul default value
Subject: lib/string.c: check for kmalloc() failure
Subject: lib/cmdline.c: remove meaningless comment
Subject: radix-tree: must check __radix_tree_preload() return value
Subject: lib/oid_registry.c: X.509: fix the buffer overflow in the utility function for OID string
Subject: checkpatch: add --strict check for ifs with unnecessary parentheses
Subject: checkpatch: fix typo in comment
Subject: checkpatch: rename variables to avoid confusion
Subject: checkpatch: add 6 missing types to --list-types
Subject: binfmt_flat: delete two error messages for a failed memory allocation in decompress_exec()
Subject: init: move stack canary initialization after setup_arch
Subject: init/main.c: extract early boot entropy from the passed cmdline
Subject: autofs: fix AT_NO_AUTOMOUNT not being honored
Subject: autofs: make disc device user accessible
Subject: autofs: make dev ioctl version and ismountpoint user accessible
Subject: autofs: remove unused AUTOFS_IOC_EXPIRE_DIRECT/INDIRECT
Subject: autofs: non functional header inclusion cleanup
Subject: autofs: use AUTOFS_DEV_IOCTL_SIZE
Subject: autofs: drop wrong comment
Subject: autofs: use unsigned int/long instead of uint/ulong for ioctl args
Subject: vfat: deduplicate hex2bin()
Subject: test_kmod: remove paranoid UINT_MAX check on uint range processing
Subject: test_kmod: flip INT checks to be consistent
Subject: kmod: split out umh code into its own file
Subject: MAINTAINERS: clarify kmod is just a kernel module loader
Subject: kmod: split off umh headers into its own file
Subject: kmod: move #ifdef CONFIG_MODULES wrapper to Makefile
Subject: cpumask: make cpumask_next() out-of-line
Subject: drivers/pps: aesthetic tweaks to PPS-related content
Subject: drivers/pps: use surrounding "if PPS" to remove numerous dependency checks
Subject: m32r: defconfig: cleanup from old Kconfig options
Subject: mn10300: defconfig: cleanup from old Kconfig options
Subject: sh: defconfig: cleanup from old Kconfig options
Subject: kcov: support compat processes
Subject: ipc: convert ipc_namespace.count from atomic_t to refcount_t
Subject: ipc: convert sem_undo_list.refcnt from atomic_t to refcount_t
Subject: ipc: convert kern_ipc_perm.refcount from atomic_t to refcount_t
Subject: ipc/sem: drop sem_checkid helper
Subject: ipc/sem: play nicer with large nsops allocations
Subject: ipc: optimize semget/shmget/msgget for lots of keys
^ permalink raw reply [flat|nested] 232+ messages in thread
* Re: incoming
[not found] ` <CA+55aFw+z3HDT4s1C41j=d5_0QTSu8NLSSpnk_jxZ39w34xgnA@mail.gmail.com>
@ 2017-09-09 18:09 ` Andrew Morton
0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2017-09-09 18:09 UTC (permalink / raw)
To: Linus Torvalds; +Cc: Stephen Rothwell, mm-commits
On Sat, 9 Sep 2017 10:40:21 -0700 Linus Torvalds <torvalds@linux-foundation.org> wrote:
> On Fri, Sep 8, 2017 at 6:27 PM, Linus Torvalds
> <torvalds@linux-foundation.org> wrote:
> >
> > Git does all of this right. Your quilt scripts are garbage. Please
> > please start fixing this.
> >
> > I've worked around it by just editing the patch, but..
>
> .. and I just realized that your patches must obviously be ok in your
> tree, since you can apply them, and apparently Stephen can apply them
> in linux-next.
>
> I'm assuming Stephen applies them from your quilt series directly, and
> thus never saw the problem with bad locale conversion.
>
> Maybe we should just change the workflow, with you sending me a raw
> tar-ball of the quilt series (or whatever the equivalent quilt
> "bundle" is) as an attachment and we forego the traditional
> patch-bombing model?
>
> That would avoid the locale issues with email.
>
Leave it with me - I need to sit down and have fiddle for a while. For
some reason I can't recall I had LOCALE=C set, and using en_US.UTF-8
changes things quite a lot.
And I need to figure out why the heck I did this:
iconv -f latin1 | mailx -s "$subject" "$all"
!
^ permalink raw reply [flat|nested] 232+ messages in thread
* incoming
@ 2017-09-13 23:28 Andrew Morton
0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2017-09-13 23:28 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits
A few leftovers. Now with fixed up locale stuff, fingers crossed.
9 patches, based on 46c1e79fee417f151547aa46fae04ab06cb666f4:
Subject: idr: remove WARN_ON_ONCE() when trying to replace negative ID
Subject: drivers/media/cec/cec-adap.c: fix build with gcc-4.4.4
Subject: procfs: remove unused variable
Subject: lib/test_bitmap.c: use ULL suffix for 64-bit constants
Subject: fscache: fix fscache_objlist_show format processing
Subject: IB/mlx4: fix sprintf format warning
Subject: mm: treewide: remove GFP_TEMPORARY allocation flag
Subject: arm64: stacktrace: avoid listing stacktrace functions in stacktrace
Subject: mm, page_owner: skip unnecessary stack_trace entries
^ permalink raw reply [flat|nested] 232+ messages in thread
* incoming
@ 2017-10-03 23:14 Andrew Morton
0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2017-10-03 23:14 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits
A lot of stuff, sorry about that. A week on a beach, then a bunch of
time catching up then more time letting it bake in -next. Shan't do
that again!
51 fixes, based on d81fa669e3de7eb8a631d7d95dac5fbcb2bf9d4e:
Subject: alpha: fix build failures
Subject: kernel/params.c: align add_sysfs_param documentation with code
Subject: scripts/spelling.txt: add more spelling mistakes to spelling.txt
Subject: include/linux/mm.h: fix typo in VM_MPX definition
Subject: ksm: fix unlocked iteration over vmas in cmp_and_merge_page()
Subject: mm, hugetlb, soft_offline: save compound page order before page migration
Subject: sh: sh7722: remove nonexistent GPIO_PTQ7 to fix pinctrl registration
Subject: sh: sh7757: remove nonexistent GPIO_PT[JLNQ]7_RESV to fix pinctrl registration
Subject: sh: sh7264: remove nonexistent GPIO_PH[0-7] to fix pinctrl registration
Subject: sh: sh7269: remove nonexistent GPIO_PH[0-7] to fix pinctrl registration
Subject: z3fold: fix potential race in z3fold_reclaim_page
Subject: mm, oom_reaper: skip mm structs with mmu notifiers
Subject: mm, memcg: remove hotplug locking from try_charge
Subject: mm/memcg: avoid page count check for zone device
Subject: android: binder: drop lru lock in isolate callback
Subject: mm,compaction: serialize waitqueue_active() checks (for real)
Subject: z3fold: fix stale list handling
Subject: mm: meminit: mark init_reserved_page as __meminit
Subject: rapidio: remove global irq spinlocks from the subsystem
Subject: mm: fix RODATA_TEST failure "rodata_test: test data was not read only"
Subject: zram: fix null dereference of handle
Subject: m32r: define CPU_BIG_ENDIAN
Subject: mm: have filemap_check_and_advance_wb_err clear AS_EIO/AS_ENOSPC
Subject: mm: avoid marking swap cached page as lazyfree
Subject: mm: fix data corruption caused by lazyfree page
Subject: mm/device-public-memory: fix edge case in _vm_normal_page()
Subject: userfaultfd: non-cooperative: fix fork use after free
Subject: exec: load_script: kill the onstack interp[BINPRM_BUF_SIZE] array
Subject: exec: binfmt_misc: don't nullify Node->dentry in kill_node()
Subject: exec: binfmt_misc: shift filp_close(interp_file) from kill_node() to bm_evict_inode()
Subject: exec: binfmt_misc: remove the confusing e->interp_file != NULL checks
Subject: exec: binfmt_misc: fix race between load_misc_binary() and kill_node()
Subject: exec: binfmt_misc: kill the onstack iname[BINPRM_BUF_SIZE] array
Subject: lib/lz4: make arrays static const, reduces object code size
Subject: include/linux/bitfield.h: remove 32bit from FIELD_GET comment block
Subject: kernel/sysctl.c: remove duplicate UINT_MAX check on do_proc_douintvec_conv()
Subject: mm: memcontrol: use vmalloc fallback for large kmem memcg arrays
Subject: lib/idr.c: fix comment for idr_replace()
Subject: mm, memory_hotplug: add scheduling point to __add_pages
Subject: mm, page_alloc: add scheduling point to memmap_init_zone
Subject: memremap: add scheduling point to devm_memremap_pages
Subject: kernel/kcmp.c: drop branch leftover typo
Subject: mm/memory_hotplug: change pfn_to_section_nr/section_nr_to_pfn macro to inline function
Subject: mm/memory_hotplug: define find_{smallest|biggest}_section_pfn as unsigned long
Subject: kernel/params.c: fix the maximum length in param_get_string
Subject: kernel/params.c: fix an overflow in param_attr_show
Subject: kernel/params.c: improve STANDARD_PARAM_DEF readability
Subject: lib/ratelimit.c: use deferred printk() version
Subject: m32r: fix build failure
Subject: checkpatch: fix ignoring cover-letter logic
Subject: include/linux/fs.h: fix comment about struct address_space
^ permalink raw reply [flat|nested] 232+ messages in thread
* incoming
@ 2017-10-13 22:57 Andrew Morton
0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2017-10-13 22:57 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits
18 fixes, based on 997301a860fca1a05ab8e383a8039b65f8abeb1e:
Subject: mm/migrate: fix indexing bug (off by one) and avoid out of bound access
Subject: lib/Kconfig.debug: kernel hacking menu: runtime testing: keep tests together
Subject: mm/madvise.c: add description for MADV_WIPEONFORK and MADV_KEEPONFORK
Subject: include/linux/of.h: provide of_n_{addr,size}_cells wrappers for !CONFIG_OF
Subject: mm/mempolicy: fix NUMA_INTERLEAVE_HIT counter
Subject: mm: remove unnecessary WARN_ONCE in page_vma_mapped_walk().
Subject: mm: only display online cpus of the numa node
Subject: userfaultfd: selftest: exercise -EEXIST only in background transfer
Subject: scripts/kallsyms.c: ignore symbol type 'n'
Subject: mm/cma.c: take __GFP_NOWARN into account in cma_alloc()
Subject: Revert "vmalloc: back off when the current task is killed"
Subject: tty: fall back to N_NULL if switching to N_TTY fails during hangup
Subject: linux/kernel.h: add/correct kernel-doc notation
Subject: fs/mpage.c: fix mpage_writepage() for pages with buffers
Subject: fs/binfmt_misc.c: node could be NULL when evicting inode
Subject: kmemleak: clear stale pointers from task stacks
Subject: mm: page_vma_mapped: ensure pmd is loaded with READ_ONCE outside of lock
Subject: mm, swap: use page-cluster as max window of VMA based swap readahead
^ permalink raw reply [flat|nested] 232+ messages in thread
* incoming
@ 2017-11-02 22:59 Andrew Morton
0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2017-11-02 22:59 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits
7 fixes, based on 5cb0512c02ecd7e6214e912e4c150f4219ac78e0:
Subject: userfaultfd: hugetlbfs: prevent UFFDIO_COPY to fill beyond the end of i_size
Subject: mm, /proc/pid/pagemap: fix soft dirty marking for PMD migration entry
Subject: ocfs2: fstrim: Fix start offset of first cluster group during fstrim
Subject: fs/hugetlbfs/inode.c: fix hwpoison reserve accounting
Subject: initramfs: fix initramfs rebuilds w/ compression after disabling
Subject: mm/huge_memory.c: deposit page table when copying a PMD migration entry
Subject: mm, swap: fix race between swap count continuation operations
^ permalink raw reply [flat|nested] 232+ messages in thread
* incoming
@ 2017-11-09 21:38 Andrew Morton
0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2017-11-09 21:38 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits
2 fixes, based on 3fefc31843cfe2b5f072efe11ed9ccaf6a7a5092:
Subject: sysctl: add register_sysctl() dummy helper
Subject: MAINTAINERS: update TPM driver infrastructure changes
^ permalink raw reply [flat|nested] 232+ messages in thread
* incoming
@ 2017-11-16 1:29 Andrew Morton
0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2017-11-16 1:29 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits
- a few misc bits
- ocfs2 updates
- almost all of MM
131 patches, based on c9b012e5f4a1d01dfa8abc6318211a67ba7d5db2:
Subject: bloat-o-meter: provide 3 different arguments for data, function and All
Subject: m32r: fix endianness constraints
Subject: ocfs2: remove unused declaration ocfs2_publish_get_mount_state()
Subject: ocfs2: no need flush workqueue before destroying it
Subject: ocfs2: cleanup unused func declaration and assignment
Subject: ocfs2: fix cluster hang after a node dies
Subject: ocfs2: clean up some unused function declarations
Subject: ocfs2: should wait dio before inode lock in ocfs2_setattr()
Subject: ocfs2: ip_alloc_sem should be taken in ocfs2_get_block()
Subject: ocfs2: subsystem.su_mutex is required while accessing the item->ci_parent
Subject: ocfs2/dlm: get mle inuse only when it is initialized
Subject: ocfs2: remove unneeded goto in ocfs2_reserve_cluster_bitmap_bits()
Subject: tools: slabinfo: add "-U" option to show unreclaimable slabs only
Subject: mm: slabinfo: remove CONFIG_SLABINFO
Subject: mm: oom: show unreclaimable slab info when unreclaimable slabs > user memory
Subject: mm/slob.c: remove an unnecessary check for __GFP_ZERO
Subject: mm/slab.c: only set __GFP_RECLAIMABLE once
Subject: slab, slub, slob: add slab_flags_t
Subject: slab, slub, slob: convert slab_flags_t to 32-bit
Subject: slub: fix sysfs duplicate filename creation when slub_debug=O
Subject: include/linux/slab.h: add kmalloc_array_node() and kcalloc_node()
Subject: block/blk-mq.c: use kmalloc_array_node()
Subject: drivers/infiniband/hw/qib/qib_init.c: use kmalloc_array_node()
Subject: drivers/infiniband/sw/rdmavt/qp.c: use kmalloc_array_node()
Subject: mm/mempool.c: use kmalloc_array_node()
Subject: net/rds/ib_fmr.c: use kmalloc_array_node()
Subject: mm: update comments for struct page.mapping
Subject: zram: set BDI_CAP_STABLE_WRITES once
Subject: bdi: introduce BDI_CAP_SYNCHRONOUS_IO
Subject: mm, swap: introduce SWP_SYNCHRONOUS_IO
Subject: mm, swap: skip swapcache for swapin of synchronous device
Subject: mm: swap: SWP_SYNCHRONOUS_IO: skip swapcache only if swapped page has no other reference
Subject: mm, swap: fix false error message in __swp_swapcount()
Subject: mm/page-writeback.c: remove unused parameter from balance_dirty_pages()
Subject: mm: drop migrate type checks from has_unmovable_pages
Subject: mm: distinguish CMA and MOVABLE isolation in has_unmovable_pages()
Subject: mm, page_alloc: fail has_unmovable_pages when seeing reserved pages
Subject: mm, memory_hotplug: do not fail offlining too early
Subject: mm, memory_hotplug: remove timeout from __offline_memory
Subject: mm/memblock.c: make the index explicit argument of for_each_memblock_type
Subject: mm/page-writeback.c: print a warning if the vm dirtiness settings are illogical
Subject: zram: add zstd to the supported algorithms list
Subject: zram: remove zlib from the list of recommended algorithms
Subject: fs/hugetlbfs/inode.c: remove redundant -ENIVAL return from hugetlbfs_setattr()
Subject: mm/hmm: constify hmm_devmem_page_get_drvdata() parameter
Subject: zsmalloc: calling zs_map_object() from irq is a bug
Subject: mm/mmu_notifier: avoid double notification when it is useless
Subject: mm/mmu_notifier: avoid call to invalidate_range() in range_end()
Subject: mm: remove unused pgdat->inactive_ratio
Subject: mm/swap_slots.c: fix race conditions in swap_slots cache init
Subject: mm, arch: remove empty_bad_page*
Subject: mm/cma.c: change pr_info to pr_err for cma_alloc fail log
Subject: mm/page_owner.c: reduce page_owner structure size
Subject: mm: implement find_get_pages_range_tag()
Subject: btrfs: use pagevec_lookup_range_tag()
Subject: ceph: use pagevec_lookup_range_tag()
Subject: ext4: use pagevec_lookup_range_tag()
Subject: f2fs: use pagevec_lookup_range_tag()
Subject: f2fs: simplify page iteration loops
Subject: f2fs: use find_get_pages_tag() for looking up single page
Subject: gfs2: use pagevec_lookup_range_tag()
Subject: nilfs2: use pagevec_lookup_range_tag()
Subject: mm: use pagevec_lookup_range_tag() in __filemap_fdatawait_range()
Subject: mm: use pagevec_lookup_range_tag() in write_cache_pages()
Subject: mm: add variant of pagevec_lookup_range_tag() taking number of pages
Subject: ceph: use pagevec_lookup_range_nr_tag()
Subject: mm: remove nr_pages argument from pagevec_lookup_{,range}_tag()
Subject: afs: use find_get_pages_range_tag()
Subject: cifs: use find_get_pages_range_tag()
Subject: kmemleak: change /sys/kernel/debug/kmemleak permissions from 0444 to 0644
Subject: mm: account pud page tables
Subject: mm: introduce wrappers to access mm->nr_ptes
Subject: mm: consolidate page table accounting
Subject: fs, mm: account filp cache to kmemcg
Subject: mm/rmap.c: remove redundant variable cend
Subject: kmemcheck: remove annotations
Subject: kmemcheck: stop using GFP_NOTRACK and SLAB_NOTRACK
Subject: kmemcheck: remove whats left of NOTRACK flags
Subject: kmemcheck: rip it out
Subject: mm/swap_state.c: declare a few variables as __read_mostly
Subject: mm: deferred_init_memmap improvements
Subject: x86/mm: set fields in deferred pages
Subject: sparc64/mm: set fields in deferred pages
Subject: sparc64: simplify vmemmap_populate
Subject: mm: define memblock_virt_alloc_try_nid_raw
Subject: mm: zero reserved and unavailable struct pages
Subject: x86/mm/kasan: don't use vmemmap_populate() to initialize shadow
Subject: arm64/mm/kasan: don't use vmemmap_populate() to initialize shadow
Subject: mm: stop zeroing memory during allocation in vmemmap
Subject: sparc64: optimize struct page zeroing
Subject: mm/page_alloc: make sure __rmqueue() etc are always inline
Subject: userfaultfd: use mmgrab instead of open-coded increment of mm_count
Subject: mm, soft_offline: improve hugepage soft offlining error log
Subject: mm/page-writeback.c: convert timers to use timer_setup()
Subject: drivers/block/zram/zram_drv.c: make zram_page_end_io() static
Subject: mm: speed up cancel_dirty_page() for clean pages
Subject: mm: refactor truncate_complete_page()
Subject: mm: factor out page cache page freeing into a separate function
Subject: mm: move accounting updates before page_cache_tree_delete()
Subject: mm: move clearing of page->mapping to page_cache_tree_delete()
Subject: mm: factor out checks and accounting from __delete_from_page_cache()
Subject: mm: batch radix tree operations when truncating pages
Subject: mm, page_alloc: enable/disable IRQs once when freeing a list of pages
Subject: mm, truncate: do not check mapping for every page being truncated
Subject: mm, truncate: remove all exceptional entries from pagevec under one lock
Subject: mm: only drain per-cpu pagevecs once per pagevec usage
Subject: mm, pagevec: remove cold parameter for pagevecs
Subject: mm: remove cold parameter for release_pages
Subject: mm: remove cold parameter from free_hot_cold_page*
Subject: mm: remove __GFP_COLD
Subject: mm, page_alloc: simplify list handling in rmqueue_bulk()
Subject: mm, pagevec: rename pagevec drained field
Subject: Unify migrate_pages and move_pages access checks
Subject: shmem: convert shmem_init_inodecache() to void
Subject: mm, sysctl: make NUMA stats configurable
Subject: mm: mlock: remove lru_add_drain_all()
Subject: mm, page_alloc: fix potential false positive in __zone_watermark_ok
Subject: fs: fuse: account fuse_inode slab memory as reclaimable
Subject: mm: don't warn about allocations which stall for too long
Subject: mm/page_alloc.c: broken deferred calculation
Subject: mm/shmem.c: mark expected switch fall-through
Subject: mm/list_lru.c: mark expected switch fall-through
Subject: mm/hmm: remove redundant variable align_end
Subject: mm, sparse: do not swamp log with huge vmemmap allocation failures
Subject: mm: do not rely on preempt_count in print_vma_addr
Subject: writeback: remove unused function parameter
Subject: mm/page_ext.c: check if page_ext is not prepared
Subject: mm,oom_reaper: remove pointless kthread_run() error check
Subject: mm: simplify nodemask printing
Subject: mm: make alloc_node_mem_map a void call if we don't have CONFIG_FLAT_NODE_MEM_MAP
Subject: memory hotplug: fix comments when adding section
^ permalink raw reply [flat|nested] 232+ messages in thread
* incoming
@ 2017-11-17 23:25 Andrew Morton
0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2017-11-17 23:25 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits
- a bit more MM
- procfs updates
- dynamic-debug fixes
- lib/ updates
- checkpatch
- epoll
- nilfs2
- signals
- rapidio
- PID management cleanup and optimization
- kcov updates
- sysvipc updates
- quite a few misc things all over the place
94 patches, based on a3841f94c7ecb3ede0f888d3fcfe8fb6368ddd7a:
Subject: mm: fix nodemask printing
Subject: mm/z3fold.c: use kref to prevent page free/compact race
Subject: lib/dma-debug.c: fix incorrect pfn calculation
Subject: mm: shmem: remove unused info variable
Subject: mm, compaction: kcompactd should not ignore pageblock skip
Subject: mm, compaction: persistently skip hugetlbfs pageblocks
Subject: mm, compaction: extend pageblock_skip_persistent() to all compound pages
Subject: mm, compaction: split off flag for not updating skip hints
Subject: mm, compaction: remove unneeded pageblock_skip_persistent() checks
Subject: proc, coredump: add CoreDumping flag to /proc/pid/status
Subject: proc: : uninline name_to_int()
Subject: proc: use do-while in name_to_int()
Subject: spelling.txt: add "unnecessary" typo variants
Subject: sh/boot: add static stack-protector to pre-kernel
Subject: kernel debug: support resetting WARN*_ONCE
Subject: kernel debug: support resetting WARN_ONCE for all architectures
Subject: parse-maintainers: add ability to specify filenames
Subject: iopoll: avoid -Wint-in-bool-context warning
Subject: lkdtm: include WARN format string
Subject: bug: define the "cut here" string in a single place
Subject: bug: fix "cut here" location for __WARN_TAINT architectures
Subject: include/linux/compiler-clang.h: handle randomizable anonymous structs
Subject: kernel/umh.c: optimize 'proc_cap_handler()'
Subject: dynamic-debug-howto: fix optional/omitted ending line number to be LARGE instead of 0
Subject: dynamic_debug documentation: minor fixes
Subject: get_maintainer: add --self-test for internal consistency tests
Subject: get_maintainer: add more --self-test options
Subject: include/linux/bitfield.h: include <linux/build_bug.h> instead of <linux/bug.h>
Subject: include/linux/radix-tree.h: remove unneeded #include <linux/bug.h>
Subject: lib: add module support to string tests
Subject: lib/test: delete five error messages for failed memory allocations
Subject: lib/int_sqrt: optimize small argument
Subject: lib/int_sqrt: optimize initial value compute
Subject: lib/int_sqrt: adjust comments
Subject: lib/genalloc.c: make the avail variable an atomic_long_t
Subject: lib/nmi_backtrace.c: fix kernel text address leak
Subject: tools/lib/traceevent/parse-filter.c: clean up clang build warning
Subject: lib/rbtree-test: lower default params
Subject: lib: test module for find_*_bit() functions
Subject: checkpatch: support function pointers for unnamed function definition arguments
Subject: scripts/checkpatch.pl: avoid false warning missing break
Subject: checkpatch: printks always need a KERN_<LEVEL>
Subject: checkpatch: allow DEFINE_PER_CPU definitions to exceed line length
Subject: checkpatch: add TP_printk to list of logging functions
Subject: checkpatch: add --strict test for lines ending in [ or (
Subject: checkpatch: do not check missing blank line before builtin_*_driver
Subject: epoll: account epitem and eppoll_entry to kmemcg
Subject: epoll: avoid calling ep_call_nested() from ep_poll_safewake()
Subject: epoll: remove ep_call_nested() from ep_eventpoll_poll()
Subject: init/version.c: include <linux/export.h> instead of <linux/module.h>
Subject: autofs: don't fail mount for transient error
Subject: pipe: match pipe_max_size data type with procfs
Subject: pipe: avoid round_pipe_size() nr_pages overflow on 32-bit
Subject: pipe: add proc_dopipe_max_size() to safely assign pipe_max_size
Subject: sysctl: check for UINT_MAX before unsigned int min/max
Subject: fs/nilfs2: convert timers to use timer_setup()
Subject: nilfs2: fix race condition that causes file system corruption
Subject: fs, nilfs: convert nilfs_root.count from atomic_t to refcount_t
Subject: nilfs2: align block comments of nilfs_sufile_truncate_range() at *
Subject: nilfs2: use octal for unreadable permission macro
Subject: nilfs2: remove inode->i_version initialization
Subject: hfs/hfsplus: clean up unused variables in bnode.c
Subject: fat: remove redundant assignment of 0 to slots
Subject: kernel/signal.c: protect the traced SIGNAL_UNKILLABLE tasks from SIGKILL
Subject: kernel/signal.c: protect the SIGNAL_UNKILLABLE tasks from !sig_kernel_only() signals
Subject: kernel/signal.c: remove the no longer needed SIGNAL_UNKILLABLE check in complete_signal()
Subject: kdump: print a message in case parse_crashkernel_mem resulted in zero bytes
Subject: rapidio: constify rio_device_id
Subject: drivers/rapidio/devices/rio_mport_cdev.c: fix resource leak in error handling path in 'rio_dma_transfer()'
Subject: drivers/rapidio/devices/rio_mport_cdev.c: fix error handling in 'rio_dma_transfer()'
Subject: Documentation/sysctl/vm.txt: fix typo
Subject: kernel/sysctl.c: code cleanups
Subject: pid: replace pid bitmap implementation with IDR API
Subject: pid: remove pidhash
Subject: kernel/panic.c: add TAINT_AUX
Subject: kcov: remove pointless current != NULL check
Subject: kcov: support comparison operands collection
Subject: Makefile: support flag -fsanitizer-coverage=trace-cmp
Subject: kcov: update documentation
Subject: kernel/reboot.c: add devm_register_reboot_notifier()
Subject: drivers/watchdog: make use of devm_register_reboot_notifier()
Subject: initramfs: use time64_t timestamps
Subject: sysvipc: unteach ids->next_id for !CHECKPOINT_RESTORE
Subject: sysvipc: duplicate lock comments wrt ipc_addid()
Subject: sysvipc: properly name ipc_addid() limit parameter
Subject: sysvipc: make get_maxid O(1) again
Subject: mm: add infrastructure for get_user_pages_fast() benchmarking
Subject: drivers/pcmcia/sa1111_badge4.c: avoid unused function warning
Subject: arch/ia64/include/asm/topology.h: remove unused parent_node() macro
Subject: arch/sh/include/asm/topology.h: remove unused parent_node() macro
Subject: arch/sparc/include/asm/topology_64.h: remove unused parent_node() macro
Subject: arch/tile/include/asm/topology.h: remove unused parent_node() macro
Subject: include/asm-generic/topology.h: remove unused parent_node() macro
Subject: EXPERT Kconfig menu: fix broken EXPERT menu
^ permalink raw reply [flat|nested] 232+ messages in thread
* incoming
@ 2017-11-30 0:09 Andrew Morton
0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2017-11-30 0:09 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits
28 fixes, based on 43570f0383d6d5879ae585e6c3cf027ba321546f:
Subject: mm, memory_hotplug: do not back off draining pcp free pages from kworker context
Subject: mm, oom_reaper: gather each vma to prevent leaking TLB entry
Subject: mm/cma: fix alloc_contig_range ret code/potential leak
Subject: mm: fix device-dax pud write-faults triggered by get_user_pages()
Subject: mm: switch to 'define pmd_write' instead of __HAVE_ARCH_PMD_WRITE
Subject: mm: replace pud_write with pud_access_permitted in fault + gup paths
Subject: mm: replace pmd_write with pmd_access_permitted in fault + gup paths
Subject: mm: replace pte_write with pte_access_permitted in fault + gup paths
Subject: scripts/faddr2line: extend usage on generic arch
Subject: mm, hugetlbfs: introduce ->split() to vm_operations_struct
Subject: device-dax: implement ->split() to catch invalid munmap attempts
Subject: mm: introduce get_user_pages_longterm
Subject: mm: fail get_vaddr_frames() for filesystem-dax mappings
Subject: v4l2: disable filesystem-dax mapping support
Subject: IB/core: disable memory registration of filesystem-dax vmas
Subject: exec: avoid RLIMIT_STACK races with prlimit()
Subject: mm/madvise.c: fix madvise() infinite loop under special circumstances
Subject: Revert "mm/page-writeback.c: print a warning if the vm dirtiness settings are illogical"
Subject: fs/mbcache.c: make count_objects() more robust
Subject: scripts/bloat-o-meter: don't fail with division by 0
Subject: kmemleak: add scheduling point to kmemleak_scan()
Subject: mm: migrate: fix an incorrect call of prep_transhuge_page()
Subject: mm, memcg: fix mem_cgroup_swapout() for THPs
Subject: fs/fat/inode.c: fix sb_rdonly() change
Subject: autofs: revert "autofs: take more care to not update last_used on path walk"
Subject: autofs: revert "autofs: fix AT_NO_AUTOMOUNT not being honored"
Subject: mm/hugetlb: fix NULL-pointer dereference on 5-level paging machine
Subject: fs/hugetlbfs/inode.c: change put_page/unlock_page order in hugetlbfs_fallocate()
^ permalink raw reply [flat|nested] 232+ messages in thread
* incoming
@ 2017-12-14 23:32 Andrew Morton
0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2017-12-14 23:32 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits
17 fixes, based on 7c5cac1bc7170bfc726a69eb64947c55658d16ad:
Subject: include/linux/idr.h: add #include <linux/bug.h>
Subject: lib/rbtree,drm/mm: add rbtree_replace_node_cached()
Subject: mm/kmemleak.c: make cond_resched() rate-limiting more efficient
Subject: string.h: workaround for increased stack usage
Subject: autofs: fix careless error in recent commit
Subject: exec: avoid gcc-8 warning for get_task_comm
Subject: Documentation/vm/zswap.txt: update with same-value filled page feature
Subject: scripts/faddr2line: fix CROSS_COMPILE unset error
Subject: mm/memory.c: mark wp_huge_pmd() inline to prevent build failure
Subject: mm/page_alloc.c: avoid excessive IRQ disabled times in free_unref_page_list()
Subject: mm/slab.c: do not hash pointers when debugging slab
Subject: kcov: fix comparison callback signature
Subject: tools/slabinfo-gnuplot: force to use bash shell
Subject: mm/frame_vector.c: release a semaphore in 'get_vaddr_frames()'
Subject: kernel: make groups_sort calling a responsibility group_info allocators
Subject: mm, oom_reaper: fix memory corruption
Subject: arch: define weak abort()
^ permalink raw reply [flat|nested] 232+ messages in thread
* incoming
@ 2018-01-05 0:17 Andrew Morton
0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2018-01-05 0:17 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits
9 fixes, based on e1915c8195b38393005be9b74bfa6a3a367c83b3:
Subject: mm: check pfn_valid first in zero_resv_unavail
Subject: kernel/acct.c: fix the acct->needcheck check in check_free_space()
Subject: mm/mprotect: add a cond_resched() inside change_pmd_range()
Subject: kernel/exit.c: export abort() to modules
Subject: mm/debug.c: provide useful debugging information for VM_BUG
Subject: mm/zsmalloc.c: include fs.h
Subject: mm/sparse.c: wrong allocation for mem_section
Subject: userfaultfd: clear the vma->vm_userfaultfd_ctx if UFFD_EVENT_FORK fails
Subject: mailmap: update Mark Yao's email address
^ permalink raw reply [flat|nested] 232+ messages in thread
* incoming
@ 2018-01-13 0:52 Andrew Morton
0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2018-01-13 0:52 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits
4 fixes, based on 1545dec46db3858bbce84c2065b579e2925706ab:
Subject: MAINTAINERS, nilfs2: change project home URLs
Subject: kmemleak: allow to coexist with fault injection
Subject: kdump: write correct address of mem_section into vmcoreinfo
Subject: tools/objtool/Makefile: don't assume sync-check.sh is executable
^ permalink raw reply [flat|nested] 232+ messages in thread
* incoming
@ 2018-01-19 0:33 Andrew Morton
0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2018-01-19 0:33 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits
6 fixes, based on dda3e15231b35840fe6f0973f803cc70ddb86281:
Subject: mm/memory.c: release locked page in do_swap_page()
Subject: mm/page_owner.c: remove drain_all_pages from init_early_allocated_pages
Subject: scripts/decodecode: fix decoding for AArch64 (arm64) instructions
Subject: scripts/gdb/linux/tasks.py: fix get_thread_info
Subject: proc: fix coredump vs read /proc/*/stat race
Subject: sparse doesn't support struct randomization
^ permalink raw reply [flat|nested] 232+ messages in thread
* incoming
@ 2018-02-01 0:13 Andrew Morton
2018-02-01 0:25 ` incoming Andrew Morton
0 siblings, 1 reply; 232+ messages in thread
From: Andrew Morton @ 2018-02-01 0:13 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits
- misc fixes
- ocfs2 updates
- most of MM
119 patches, based on 7b1cd95d65eb3b1e13f8a90eb757e0ea232c7899:
Subject: fs/dax.c: release PMD lock even when there is no PMD support in DAX
Subject: tools: fix cross-compile var clobbering
Subject: scripts/decodecode: make it take multiline Code line
Subject: scripts/tags.sh: change find_other_sources() for include directories
Subject: m32r: remove abort()
Subject: fs/ocfs2/dlm/dlmmaster.c: clean up dead code
Subject: ocfs2/cluster: neaten a member of o2net_msg_handler
Subject: ocfs2: give an obvious tip for mismatched cluster names
Subject: ocfs2/cluster: close a race that fence can't be triggered
Subject: ocfs2: use the OCFS2_XATTR_ROOT_SIZE macro in ocfs2_reflink_xattr_header()
Subject: ocfs2: clean dead code in suballoc.c
Subject: ocfs2: return -EROFS to mount.ocfs2 if inode block is invalid
Subject: ocfs2: try a blocking lock before return AOP_TRUNCATED_PAGE
Subject: ocfs2/xattr: assign errno to 'ret' in ocfs2_calc_xattr_init()
Subject: ocfs2: clean up dead code in alloc.c
Subject: ocfs2/acl: use 'ip_xattr_sem' to protect getting extended attribute
Subject: ocfs2: make metadata estimation accurate and clear
Subject: ocfs2: try to reuse extent block in dealloc without meta_alloc
Subject: ocfs2: add trimfs dlm lock resource
Subject: ocfs2: add trimfs lock to avoid duplicated trims in cluster
Subject: ocfs2: add ocfs2_try_rw_lock() and ocfs2_try_inode_lock()
Subject: ocfs2: add ocfs2_overwrite_io()
Subject: ocfs2: nowait aio support
Subject: ocfs2: unlock bh_state if bg check fails
Subject: ocfs2: return error when we attempt to access a dirty bh in jbd2
Subject: mm/slab_common.c: make calculate_alignment() static
Subject: mm/slab.c: remove redundant assignments for slab_state
Subject: mm/slub.c: fix wrong address during slab padding restoration
Subject: slub: remove obsolete comments of put_cpu_partial()
Subject: include/linux/sched/mm.h: uninline mmdrop_async(), etc
Subject: mm: kmemleak: remove unused hardirq.h
Subject: zswap: same-filled pages handling
Subject: mm: relax deferred struct page requirements
Subject: mm/mempolicy: remove redundant check in get_nodes
Subject: mm/mempolicy: fix the check of nodemask from user
Subject: mm/mempolicy: add nodes_empty check in SYSC_migrate_pages
Subject: mm: drop hotplug lock from lru_add_drain_all()
Subject: mm: show total hugetlb memory consumption in /proc/meminfo
Subject: mm: use sc->priority for slab shrink targets
Subject: mm: split deferred_init_range into initializing and freeing parts
Subject: mm/filemap.c: remove include of hardirq.h
Subject: mm: memcontrol: eliminate raw access to stat and event counters
Subject: mm: memcontrol: implement lruvec stat functions on top of each other
Subject: mm: memcontrol: fix excessive complexity in memory.stat reporting
Subject: mm/page_owner.c: use PTR_ERR_OR_ZERO()
Subject: mm/page_alloc.c: fix comment in __get_free_pages()
Subject: mm: do not stall register_shrinker()
Subject: selftests/vm: move 128TB mmap boundary test to generic directory
Subject: mm/interval_tree.c: use vma_pages() helper
Subject: mm: remove unused pgdat_reclaimable_pages()
Subject: mm, hugetlb: remove hugepages_treat_as_movable sysctl
Subject: mm/memory_hotplug.c: remove unnecesary check from register_page_bootmem_info_section()
Subject: mm: update comment describing tlb_gather_mmu
Subject: fs/proc/task_mmu.c: do not show VmExe bigger than total executable virtual memory
Subject: mm: memory_hotplug: remove second __nr_to_section in register_page_bootmem_info_section()
Subject: mm/huge_memory.c: fix comment in __split_huge_pmd_locked
Subject: mm, userfaultfd, THP: avoid waiting when PMD under THP migration
Subject: mm: add unmap_mapping_pages()
Subject: mm: get 7% more pages in a pagevec
Subject: asm-generic: provide generic_pmdp_establish()
Subject: arc: use generic_pmdp_establish as pmdp_establish
Subject: arm/mm: provide pmdp_establish() helper
Subject: arm64: provide pmdp_establish() helper
Subject: mips: use generic_pmdp_establish as pmdp_establish
Subject: powerpc/mm: update pmdp_invalidate to return old pmd value
Subject: s390/mm: modify pmdp_invalidate to return old value.
Subject: sparc64: update pmdp_invalidate() to return old pmd value
Subject: x86/mm: provide pmdp_establish() helper
Subject: mm: do not lose dirty and accessed bits in pmdp_invalidate()
Subject: mm: use updated pmdp_invalidate() interface to track dirty/accessed bits
Subject: mm/thp: remove pmd_huge_split_prepare()
Subject: mm: thp: use down_read_trylock() in khugepaged to avoid long block
Subject: mm, mmu_notifier: annotate mmu notifiers with blockable invalidate callbacks
Subject: mm, oom: avoid reaping only for mm's with blockable invalidate callbacks
Subject: mm/zsmalloc: simplify shrinker init/destroy
Subject: mm: align struct page more aesthetically
Subject: mm: de-indent struct page
Subject: mm: remove misleading alignment claims
Subject: mm: improve comment on page->mapping
Subject: mm: introduce _slub_counter_t
Subject: mm: store compound_dtor / compound_order as bytes
Subject: mm: document how to use struct page
Subject: mm: remove reference to PG_buddy
Subject: shmem: unexport shmem_add_seals()/shmem_get_seals()
Subject: shmem: rename functions that are memfd-related
Subject: hugetlb: expose hugetlbfs_inode_info in header
Subject: hugetlb: implement memfd sealing
Subject: shmem: add sealing support to hugetlb-backed memfd
Subject: memfd-test: test hugetlbfs sealing
Subject: memfd-test: add 'memfd-hugetlb:' prefix when testing hugetlbfs
Subject: memfd-test: move common code to a shared unit
Subject: memfd-test: run fuse test on hugetlb backend memory
Subject: userfaultfd: convert to use anon_inode_getfd()
Subject: mm: pin address_space before dereferencing it while isolating an LRU page
Subject: mm/fadvise: discard partial page if endbyte is also EOF
Subject: zswap: only save zswap header when necessary
Subject: memcg: refactor mem_cgroup_resize_limit()
Subject: mm/page_alloc.c: fix typos in comments
Subject: mm/page_owner.c: clean up init_pages_in_zone()
Subject: zsmalloc: use U suffix for negative literals being shifted
Subject: mm/page_ext.c: make page_ext_init a noop when CONFIG_PAGE_EXTENSION but nothing uses it
Subject: mm/compaction.c: fix comment for try_to_compact_pages()
Subject: include/linux/mmzone.h: fix explanation of lower bits in the SPARSEMEM mem_map pointer
Subject: mm/hmm: fix uninitialized use of 'entry' in hmm_vma_walk_pmd()
Subject: mm/memcontrol.c: make local symbol static
Subject: mm/memcontrol.c: try harder to decrease [memory,memsw].limit_in_bytes
Subject: mm, hugetlb: unify core page allocation accounting and initialization
Subject: mm, hugetlb: integrate giga hugetlb more naturally to the allocation path
Subject: mm, hugetlb: do not rely on overcommit limit during migration
Subject: mm, hugetlb: get rid of surplus page accounting tricks
Subject: mm, hugetlb: further simplify hugetlb allocation API
Subject: hugetlb, mempolicy: fix the mbind hugetlb migration
Subject: hugetlb, mbind: fall back to default policy if vma is NULL
Subject: mm: numa: do not trap faults on shared data section pages.
Subject: mm: correct comments regarding do_fault_around()
Subject: mm, memory_hotplug: fix memmap initialization
Subject: mm/swap.c: make functions and their kernel-doc agree
Subject: tools, vm: new option to specify kpageflags file
Subject: mm: remove PG_highmem description
^ permalink raw reply [flat|nested] 232+ messages in thread
* Re: incoming
2018-02-01 0:13 incoming Andrew Morton
@ 2018-02-01 0:25 ` Andrew Morton
0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2018-02-01 0:25 UTC (permalink / raw)
To: Linus Torvalds, mm-commits
And... [002/119] seems to have just disappeared. It was a standalone thing,
I'll resend next time.
^ permalink raw reply [flat|nested] 232+ messages in thread
* incoming
@ 2018-02-06 23:34 Andrew Morton
0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2018-02-06 23:34 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits
- kasan updates
- procfs
- lib/bitmap updates
- other lib/ updates
- checkpatch tweaks
- rapidio
- ubsan
- pipe fixes and cleanups
- lots of other misc bits
114 patches, based on e237f98a9c134c3d600353f21e07db915516875b:
Subject: kasan: don't emit builtin calls when sanitization is off
Subject: kasan: add compiler support for clang
Subject: kasan/Makefile: support LLVM style asan parameters
Subject: kasan: support alloca() poisoning
Subject: kasan: add tests for alloca poisoning
Subject: kasan: add functions for unpoisoning stack variables
Subject: kasan: detect invalid frees for large objects
Subject: kasan: don't use __builtin_return_address(1)
Subject: kasan: detect invalid frees for large mempool objects
Subject: kasan: unify code between kasan_slab_free() and kasan_poison_kfree()
Subject: kasan: detect invalid frees
Subject: kasan: fix prototype author email address
Subject: kasan: clean up KASAN_SHADOW_SCALE_SHIFT usage
Subject: kasan: remove redundant initialization of variable 'real_size'
Subject: proc: use %u for pid printing and slightly less stack
Subject: proc: don't use READ_ONCE/WRITE_ONCE for /proc/*/fail-nth
Subject: proc: fix /proc/*/map_files lookup
Subject: fs/proc/vmcore.c: simpler /proc/vmcore cleanup
Subject: proc: less memory for /proc/*/map_files readdir
Subject: fs/proc/array.c: delete children_seq_release()
Subject: fs/proc/kcore.c: use probe_kernel_read() instead of memcpy()
Subject: fs/proc/internal.h: rearrange struct proc_dir_entry
Subject: fs/proc/internal.h: fix up comment
Subject: fs/proc: use __ro_after_init
Subject: proc: spread likely/unlikely a bit
Subject: proc: rearrange args
Subject: fs/proc/consoles.c: use seq_putc() in show_console_dev()
Subject: Makefile: move stack-protector compiler breakage test earlier
Subject: Makefile: move stack-protector availability out of Kconfig
Subject: Makefile: introduce CONFIG_CC_STACKPROTECTOR_AUTO
Subject: uuid: cleanup <uapi/linux/uuid.h>
Subject: tools/lib/subcmd/pager.c: do not alias select() params
Subject: kernel/async.c: revert "async: simplify lowest_in_progress()"
Subject: MAINTAINERS: update sboyd's email address
Subject: bitmap: new bitmap_copy_safe and bitmap_{from,to}_arr32
Subject: bitmap: replace bitmap_{from,to}_u32array
Subject: lib/test_bitmap.c: add bitmap_zero()/bitmap_clear() test cases
Subject: lib/test_bitmap.c: add bitmap_fill()/bitmap_set() test cases
Subject: lib/test_bitmap.c: clean up test_zero_fill_copy() test case and rename
Subject: include/linux/bitmap.h: make bitmap_fill() and bitmap_zero() consistent
Subject: lib/stackdepot.c: use a non-instrumented version of memcmp()
Subject: lib/test_find_bit.c: rename to find_bit_benchmark.c
Subject: lib/find_bit_benchmark.c: improvements
Subject: lib: optimize cpumask_next_and()
Subject: lib/: make RUNTIME_TESTS a menuconfig to ease disabling it all
Subject: lib/test_sort.c: add module unload support
Subject: checkpatch: allow long lines containing URL
Subject: checkpatch: ignore some octal permissions of 0
Subject: checkpatch: improve quoted string and line continuation test
Subject: checkpatch: add a few DEVICE_ATTR style tests
Subject: checkpatch: improve the TABSTOP test to include declarations
Subject: checkpatch: exclude drivers/staging from if with unnecessary parentheses test
Subject: checkpatch: avoid some false positives for TABSTOP declaration test
Subject: checkpatch: improve OPEN_BRACE test
Subject: elf: fix NT_FILE integer overflow
Subject: kallsyms: let print_ip_sym() print raw addresses
Subject: nilfs2: use time64_t internally
Subject: hfsplus: honor setgid flag on directories
Subject: <asm-generic/siginfo.h>: fix language in comments
Subject: kernel/fork.c: check error and return early
Subject: kernel/fork.c: add comment about usage of CLONE_FS flags and namespaces
Subject: cpumask: make cpumask_size() return "unsigned int"
Subject: rapidio: delete an error message for a failed memory allocation in rio_init_mports()
Subject: rapidio: adjust 12 checks for null pointers
Subject: rapidio: adjust five function calls together with a variable assignment
Subject: rapidio: improve a size determination in five functions
Subject: rapidio: delete an unnecessary variable initialisation in three functions
Subject: rapidio: return an error code only as a constant in two functions
Subject: rapidio: move 12 EXPORT_SYMBOL_GPL() calls to function implementations
Subject: drivers/rapidio/devices/tsi721_dma.c: delete an error message for a failed memory allocation in tsi721_alloc_chan_resources()
Subject: drivers/rapidio/devices/tsi721_dma.c: delete an unnecessary variable initialisation in tsi721_alloc_chan_resources()
Subject: drivers/rapidio/devices/tsi721_dma.c: adjust six checks for null pointers
Subject: pids: introduce find_get_task_by_vpid() helper
Subject: pps: parport: use timespec64 instead of timespec
Subject: kernel/relay.c: revert "kernel/relay.c: fix potential memory leak"
Subject: kcov: detect double association with a single task
Subject: include/linux/genl_magic_func.h: remove own BUILD_BUG_ON*() defines
Subject: build_bug.h: remove BUILD_BUG_ON_NULL()
Subject: lib/ubsan.c: s/missaligned/misaligned/
Subject: lib/ubsan: add type mismatch handler for new GCC/Clang
Subject: lib/ubsan: remove returns-nonnull-attribute checks
Subject: ipc: fix ipc data structures inconsistency
Subject: ipc/mqueue.c: have RT tasks queue in by priority in wq_add()
Subject: arch/score/kernel/setup.c: combine two seq_printf() calls into one call in show_cpuinfo()
Subject: vfs: remove might_sleep() from clear_inode()
Subject: mm/userfaultfd.c: remove duplicate include
Subject: mm: remove unneeded kallsyms include
Subject: hrtimer: remove unneeded kallsyms include
Subject: genirq: remove unneeded kallsyms include
Subject: mm/memblock: memblock_is_map/region_memory can be boolean
Subject: lib/lockref: __lockref_is_dead can be boolean
Subject: kernel/cpuset: current_cpuset_is_being_rebound can be boolean
Subject: kernel/resource: iomem_is_exclusive can be boolean
Subject: kernel/module: module_is_live can be boolean
Subject: kernel/mutex: mutex_is_locked can be boolean
Subject: crash_dump: is_kdump_kernel can be boolean
Subject: kasan: rework Kconfig settings
Subject: pipe, sysctl: drop 'min' parameter from pipe-max-size converter
Subject: pipe, sysctl: remove pipe_proc_fn()
Subject: pipe: actually allow root to exceed the pipe buffer limits
Subject: pipe: fix off-by-one error when checking buffer limits
Subject: pipe: reject F_SETPIPE_SZ with size over UINT_MAX
Subject: pipe: simplify round_pipe_size()
Subject: pipe: read buffer limits atomically
Subject: mm: docs: fixup punctuation
Subject: mm: docs: fix parameter names mismatch
Subject: mm: docs: add blank lines to silence sphinx "Unexpected indentation" errors
Subject: MAINTAINERS: remove ANDROID ION pattern
Subject: MAINTAINERS: remove ARM/CLKDEV SUPPORT file pattern
Subject: MAINTAINERS: update Cortina/Gemini patterns
Subject: MAINTAINERS: update "ARM/OXNAS platform support" patterns
Subject: MAINTAINERS: update various PALM patterns
Subject: MAINTAINERS: update ARM/QUALCOMM SUPPORT patterns
Subject: Documentation/sysctl/user.txt: fix typo
^ permalink raw reply [flat|nested] 232+ messages in thread
* incoming
@ 2020-01-14 0:28 Andrew Morton
0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2020-01-14 0:28 UTC (permalink / raw)
To: Linus Torvalds; +Cc: linux-mm, mm-commits
11 MM fixes, based on b3a987b0264d3ddbb24293ebff10eddfc472f653:
Vlastimil Babka <vbabka@suse.cz>:
mm, thp: tweak reclaim/compaction effort of local-only and all-node allocations
David Hildenbrand <david@redhat.com>:
mm/memory_hotplug: don't free usage map when removing a re-added early section
"Kirill A. Shutemov" <kirill@shutemov.name>:
Patch series "Fix two above-47bit hint address vs. THP bugs":
mm/huge_memory.c: thp: fix conflict of above-47bit hint address and PMD alignment
mm/shmem.c: thp, shmem: fix conflict of above-47bit hint address and PMD alignment
Roman Gushchin <guro@fb.com>:
mm: memcg/slab: fix percpu slab vmstats flushing
Vlastimil Babka <vbabka@suse.cz>:
mm, debug_pagealloc: don't rely on static keys too early
Wen Yang <wenyang@linux.alibaba.com>:
Patch series "use div64_ul() instead of div_u64() if the divisor is:
mm/page-writeback.c: avoid potential division by zero in wb_min_max_ratio()
mm/page-writeback.c: use div64_ul() for u64-by-unsigned-long divide
mm/page-writeback.c: improve arithmetic divisions
Adrian Huang <ahuang12@lenovo.com>:
mm: memcg/slab: call flush_memcg_workqueue() only if memcg workqueue is valid
Yang Shi <yang.shi@linux.alibaba.com>:
mm: khugepaged: add trace status description for SCAN_PAGE_HAS_PRIVATE
include/linux/mm.h | 18 +++++++++-
include/linux/mmzone.h | 5 +--
include/trace/events/huge_memory.h | 3 +
init/main.c | 1
mm/huge_memory.c | 38 ++++++++++++++---------
mm/memcontrol.c | 37 +++++-----------------
mm/mempolicy.c | 10 ++++--
mm/page-writeback.c | 10 +++---
mm/page_alloc.c | 61 ++++++++++---------------------------
mm/shmem.c | 7 ++--
mm/slab.c | 4 +-
mm/slab_common.c | 3 +
mm/slub.c | 2 -
mm/sparse.c | 9 ++++-
mm/vmalloc.c | 4 +-
15 files changed, 102 insertions(+), 110 deletions(-)
^ permalink raw reply [flat|nested] 232+ messages in thread
* incoming
@ 2020-01-31 6:10 Andrew Morton
0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2020-01-31 6:10 UTC (permalink / raw)
To: Linus Torvalds; +Cc: linux-mm, mm-commits
Most of -mm and quite a number of other subsystems.
MM is fairly quiet this time. Holidays, I assume.
119 patches, based on 39bed42de2e7d74686a2d5a45638d6a5d7e7d473:
Subsystems affected by this patch series:
hotfixes
scripts
ocfs2
mm/slub
mm/kmemleak
mm/debug
mm/pagecache
mm/gup
mm/swap
mm/memcg
mm/pagemap
mm/tracing
mm/kasan
mm/initialization
mm/pagealloc
mm/vmscan
mm/tools
mm/memblock
mm/oom-kill
mm/hugetlb
mm/migration
mm/mmap
mm/memory-hotplug
mm/zswap
mm/cleanups
mm/zram
misc
lib
binfmt
init
reiserfs
exec
dma-mapping
kcov
Subsystem: hotfixes
Andy Shevchenko <andriy.shevchenko@linux.intel.com>:
lib/test_bitmap: correct test data offsets for 32-bit
"Theodore Ts'o" <tytso@mit.edu>:
memcg: fix a crash in wb_workfn when a device disappears
Dan Carpenter <dan.carpenter@oracle.com>:
mm/mempolicy.c: fix out of bounds write in mpol_parse_str()
Pingfan Liu <kernelfans@gmail.com>:
mm/sparse.c: reset section's mem_map when fully deactivated
Wei Yang <richardw.yang@linux.intel.com>:
mm/migrate.c: also overwrite error when it is bigger than zero
Dan Williams <dan.j.williams@intel.com>:
mm/memory_hotplug: fix remove_memory() lockdep splat
Wei Yang <richardw.yang@linux.intel.com>:
mm: thp: don't need care deferred split queue in memcg charge move path
Yang Shi <yang.shi@linux.alibaba.com>:
mm: move_pages: report the number of non-attempted pages
Subsystem: scripts
Xiong <xndchn@gmail.com>:
scripts/spelling.txt: add more spellings to spelling.txt
Luca Ceresoli <luca@lucaceresoli.net>:
scripts/spelling.txt: add "issus" typo
Subsystem: ocfs2
Aditya Pakki <pakki001@umn.edu>:
fs: ocfs: remove unnecessary assertion in dlm_migrate_lockres
zhengbin <zhengbin13@huawei.com>:
ocfs2: remove unneeded semicolons
Masahiro Yamada <masahiroy@kernel.org>:
ocfs2: make local header paths relative to C files
Colin Ian King <colin.king@canonical.com>:
ocfs2/dlm: remove redundant assignment to ret
Andy Shevchenko <andriy.shevchenko@linux.intel.com>:
ocfs2/dlm: move BITS_TO_BYTES() to bitops.h for wider use
wangyan <wangyan122@huawei.com>:
ocfs2: fix a NULL pointer dereference when call ocfs2_update_inode_fsync_trans()
ocfs2: use ocfs2_update_inode_fsync_trans() to access t_tid in handle->h_transaction
Subsystem: mm/slub
Yu Zhao <yuzhao@google.com>:
mm/slub.c: avoid slub allocation while holding list_lock
Subsystem: mm/kmemleak
He Zhe <zhe.he@windriver.com>:
mm/kmemleak: turn kmemleak_lock and object->lock to raw_spinlock_t
Subsystem: mm/debug
Vlastimil Babka <vbabka@suse.cz>:
mm/debug.c: always print flags in dump_page()
Subsystem: mm/pagecache
Ira Weiny <ira.weiny@intel.com>:
mm/filemap.c: clean up filemap_write_and_wait()
Subsystem: mm/gup
Qiujun Huang <hqjagain@gmail.com>:
mm: fix gup_pud_range
Wei Yang <richardw.yang@linux.intel.com>:
mm/gup.c: use is_vm_hugetlb_page() to check whether to follow huge
John Hubbard <jhubbard@nvidia.com>:
Patch series "mm/gup: prereqs to track dma-pinned pages: FOLL_PIN", v12:
mm/gup: factor out duplicate code from four routines
mm/gup: move try_get_compound_head() to top, fix minor issues
Dan Williams <dan.j.williams@intel.com>:
mm: Cleanup __put_devmap_managed_page() vs ->page_free()
John Hubbard <jhubbard@nvidia.com>:
mm: devmap: refactor 1-based refcounting for ZONE_DEVICE pages
goldish_pipe: rename local pin_user_pages() routine
mm: fix get_user_pages_remote()'s handling of FOLL_LONGTERM
vfio: fix FOLL_LONGTERM use, simplify get_user_pages_remote() call
mm/gup: allow FOLL_FORCE for get_user_pages_fast()
IB/umem: use get_user_pages_fast() to pin DMA pages
media/v4l2-core: set pages dirty upon releasing DMA buffers
mm/gup: introduce pin_user_pages*() and FOLL_PIN
goldish_pipe: convert to pin_user_pages() and put_user_page()
IB/{core,hw,umem}: set FOLL_PIN via pin_user_pages*(), fix up ODP
mm/process_vm_access: set FOLL_PIN via pin_user_pages_remote()
drm/via: set FOLL_PIN via pin_user_pages_fast()
fs/io_uring: set FOLL_PIN via pin_user_pages()
net/xdp: set FOLL_PIN via pin_user_pages()
media/v4l2-core: pin_user_pages (FOLL_PIN) and put_user_page() conversion
vfio, mm: pin_user_pages (FOLL_PIN) and put_user_page() conversion
powerpc: book3s64: convert to pin_user_pages() and put_user_page()
mm/gup_benchmark: use proper FOLL_WRITE flags instead of hard-coding "1"
mm, tree-wide: rename put_user_page*() to unpin_user_page*()
Subsystem: mm/swap
Vasily Averin <vvs@virtuozzo.com>:
mm/swapfile.c: swap_next should increase position index
Subsystem: mm/memcg
Kaitao Cheng <pilgrimtao@gmail.com>:
mm/memcontrol.c: cleanup some useless code
Subsystem: mm/pagemap
Li Xinhai <lixinhai.lxh@gmail.com>:
mm/page_vma_mapped.c: explicitly compare pfn for normal, hugetlbfs and THP page
Subsystem: mm/tracing
Junyong Sun <sunjy516@gmail.com>:
mm, tracing: print symbol name for kmem_alloc_node call_site events
Subsystem: mm/kasan
"Gustavo A. R. Silva" <gustavo@embeddedor.com>:
lib/test_kasan.c: fix memory leak in kmalloc_oob_krealloc_more()
Subsystem: mm/initialization
Andy Shevchenko <andriy.shevchenko@linux.intel.com>:
mm/early_ioremap.c: use %pa to print resource_size_t variables
Subsystem: mm/pagealloc
"Kirill A. Shutemov" <kirill@shutemov.name>:
mm/page_alloc: skip non present sections on zone initialization
David Hildenbrand <david@redhat.com>:
mm: remove the memory isolate notifier
mm: remove "count" parameter from has_unmovable_pages()
Subsystem: mm/vmscan
Liu Song <liu.song11@zte.com.cn>:
mm/vmscan.c: remove unused return value of shrink_node
Alex Shi <alex.shi@linux.alibaba.com>:
mm/vmscan: remove prefetch_prev_lru_page
mm/vmscan: remove unused RECLAIM_OFF/RECLAIM_ZONE
Subsystem: mm/tools
Daniel Wagner <dwagner@suse.de>:
tools/vm/slabinfo: fix sanity checks enabling
Subsystem: mm/memblock
Anshuman Khandual <anshuman.khandual@arm.com>:
mm/memblock: define memblock_physmem_add()
memblock: Use __func__ in remaining memblock_dbg() call sites
Subsystem: mm/oom-kill
David Rientjes <rientjes@google.com>:
mm, oom: dump stack of victim when reaping failed
Subsystem: mm/hugetlb
Wei Yang <richardw.yang@linux.intel.com>:
mm/huge_memory.c: use head to check huge zero page
mm/huge_memory.c: use head to emphasize the purpose of page
mm/huge_memory.c: reduce critical section protected by split_queue_lock
Subsystem: mm/migration
Ralph Campbell <rcampbell@nvidia.com>:
mm/migrate: remove useless mask of start address
mm/migrate: clean up some minor coding style
mm/migrate: add stable check in migrate_vma_insert_page()
David Rientjes <rientjes@google.com>:
mm, thp: fix defrag setting if newline is not used
Subsystem: mm/mmap
Miaohe Lin <linmiaohe@huawei.com>:
mm/mmap.c: get rid of odd jump labels in find_mergeable_anon_vma()
Subsystem: mm/memory-hotplug
David Hildenbrand <david@redhat.com>:
Patch series "mm/memory_hotplug: pass in nid to online_pages()":
mm/memory_hotplug: pass in nid to online_pages()
Qian Cai <cai@lca.pw>:
mm/hotplug: silence a lockdep splat with printk()
mm/page_isolation: fix potential warning from user
Subsystem: mm/zswap
Vitaly Wool <vitaly.wool@konsulko.com>:
mm/zswap.c: add allocation hysteresis if pool limit is hit
Dan Carpenter <dan.carpenter@oracle.com>:
zswap: potential NULL dereference on error in init_zswap()
Subsystem: mm/cleanups
Yu Zhao <yuzhao@google.com>:
include/linux/mm.h: clean up obsolete check on space in page->flags
Wei Yang <richardw.yang@linux.intel.com>:
include/linux/mm.h: remove dead code totalram_pages_set()
Anshuman Khandual <anshuman.khandual@arm.com>:
include/linux/memory.h: drop fields 'hw' and 'phys_callback' from struct memory_block
Hao Lee <haolee.swjtu@gmail.com>:
mm: fix comments related to node reclaim
Subsystem: mm/zram
Taejoon Song <taejoon.song@lge.com>:
zram: try to avoid worst-case scenario on same element pages
Colin Ian King <colin.king@canonical.com>:
drivers/block/zram/zram_drv.c: fix error return codes not being returned in writeback_store
Subsystem: misc
Akinobu Mita <akinobu.mita@gmail.com>:
Patch series "add header file for kelvin to/from Celsius conversion:
include/linux/units.h: add helpers for kelvin to/from Celsius conversion
ACPI: thermal: switch to use <linux/units.h> helpers
platform/x86: asus-wmi: switch to use <linux/units.h> helpers
platform/x86: intel_menlow: switch to use <linux/units.h> helpers
thermal: int340x: switch to use <linux/units.h> helpers
thermal: intel_pch: switch to use <linux/units.h> helpers
nvme: hwmon: switch to use <linux/units.h> helpers
thermal: remove kelvin to/from Celsius conversion helpers from <linux/thermal.h>
iwlegacy: use <linux/units.h> helpers
iwlwifi: use <linux/units.h> helpers
thermal: armada: remove unused TO_MCELSIUS macro
iio: adc: qcom-vadc-common: use <linux/units.h> helpers
Subsystem: lib
Mikhail Zaslonko <zaslonko@linux.ibm.com>:
Patch series "S390 hardware support for kernel zlib", v3:
lib/zlib: add s390 hardware support for kernel zlib_deflate
s390/boot: rename HEAP_SIZE due to name collision
lib/zlib: add s390 hardware support for kernel zlib_inflate
s390/boot: add dfltcc= kernel command line parameter
lib/zlib: add zlib_deflate_dfltcc_enabled() function
btrfs: use larger zlib buffer for s390 hardware compression
Nathan Chancellor <natechancellor@gmail.com>:
lib/scatterlist.c: adjust indentation in __sg_alloc_table
Yury Norov <yury.norov@gmail.com>:
uapi: rename ext2_swab() to swab() and share globally in swab.h
lib/find_bit.c: join _find_next_bit{_le}
lib/find_bit.c: uninline helper _find_next_bit()
Subsystem: binfmt
Alexey Dobriyan <adobriyan@gmail.com>:
fs/binfmt_elf.c: smaller code generation around auxv vector fill
fs/binfmt_elf.c: fix ->start_code calculation
fs/binfmt_elf.c: don't copy ELF header around
fs/binfmt_elf.c: better codegen around current->mm
fs/binfmt_elf.c: make BAD_ADDR() unlikely
fs/binfmt_elf.c: coredump: allocate core ELF header on stack
fs/binfmt_elf.c: coredump: delete duplicated overflow check
fs/binfmt_elf.c: coredump: allow process with empty address space to coredump
Subsystem: init
Arvind Sankar <nivedita@alum.mit.edu>:
init/main.c: log arguments and environment passed to init
init/main.c: remove unnecessary repair_env_string in do_initcall_level
Patch series "init/main.c: minor cleanup/bugfix of envvar handling", v2:
init/main.c: fix quoted value handling in unknown_bootoption
Christophe Leroy <christophe.leroy@c-s.fr>:
init/main.c: fix misleading "This architecture does not have kernel memory protection" message
Subsystem: reiserfs
Yunfeng Ye <yeyunfeng@huawei.com>:
reiserfs: prevent NULL pointer dereference in reiserfs_insert_item()
Subsystem: exec
Alexey Dobriyan <adobriyan@gmail.com>:
execve: warn if process starts with executable stack
Subsystem: dma-mapping
Andy Shevchenko <andriy.shevchenko@linux.intel.com>:
include/linux/io-mapping.h-mapping: use PHYS_PFN() macro in io_mapping_map_atomic_wc()
Subsystem: kcov
Dmitry Vyukov <dvyukov@google.com>:
kcov: ignore fault-inject and stacktrace
Documentation/admin-guide/kernel-parameters.txt | 12
Documentation/core-api/index.rst | 1
Documentation/core-api/pin_user_pages.rst | 234 +++++
Documentation/vm/zswap.rst | 13
arch/powerpc/mm/book3s64/iommu_api.c | 14
arch/s390/boot/compressed/decompressor.c | 8
arch/s390/boot/ipl_parm.c | 14
arch/s390/include/asm/setup.h | 7
arch/s390/kernel/setup.c | 14
drivers/acpi/thermal.c | 34
drivers/base/memory.c | 25
drivers/block/zram/zram_drv.c | 10
drivers/gpu/drm/via/via_dmablit.c | 6
drivers/iio/adc/qcom-vadc-common.c | 6
drivers/iio/adc/qcom-vadc-common.h | 1
drivers/infiniband/core/umem.c | 21
drivers/infiniband/core/umem_odp.c | 13
drivers/infiniband/hw/hfi1/user_pages.c | 4
drivers/infiniband/hw/mthca/mthca_memfree.c | 8
drivers/infiniband/hw/qib/qib_user_pages.c | 4
drivers/infiniband/hw/qib/qib_user_sdma.c | 8
drivers/infiniband/hw/usnic/usnic_uiom.c | 4
drivers/infiniband/sw/siw/siw_mem.c | 4
drivers/media/v4l2-core/videobuf-dma-sg.c | 20
drivers/net/ethernet/broadcom/bnx2x/bnx2x_init.h | 1
drivers/net/wireless/intel/iwlegacy/4965-mac.c | 3
drivers/net/wireless/intel/iwlegacy/4965.c | 17
drivers/net/wireless/intel/iwlegacy/common.h | 3
drivers/net/wireless/intel/iwlwifi/dvm/dev.h | 5
drivers/net/wireless/intel/iwlwifi/dvm/devices.c | 6
drivers/nvdimm/pmem.c | 6
drivers/nvme/host/hwmon.c | 13
drivers/platform/goldfish/goldfish_pipe.c | 39
drivers/platform/x86/asus-wmi.c | 7
drivers/platform/x86/intel_menlow.c | 9
drivers/thermal/armada_thermal.c | 2
drivers/thermal/intel/int340x_thermal/int340x_thermal_zone.c | 7
drivers/thermal/intel/intel_pch_thermal.c | 3
drivers/vfio/vfio_iommu_type1.c | 39
fs/binfmt_elf.c | 154 +--
fs/btrfs/compression.c | 2
fs/btrfs/zlib.c | 135 ++
fs/exec.c | 5
fs/fs-writeback.c | 2
fs/io_uring.c | 6
fs/ocfs2/cluster/quorum.c | 2
fs/ocfs2/dlm/Makefile | 2
fs/ocfs2/dlm/dlmast.c | 8
fs/ocfs2/dlm/dlmcommon.h | 4
fs/ocfs2/dlm/dlmconvert.c | 8
fs/ocfs2/dlm/dlmdebug.c | 8
fs/ocfs2/dlm/dlmdomain.c | 8
fs/ocfs2/dlm/dlmlock.c | 8
fs/ocfs2/dlm/dlmmaster.c | 10
fs/ocfs2/dlm/dlmrecovery.c | 10
fs/ocfs2/dlm/dlmthread.c | 8
fs/ocfs2/dlm/dlmunlock.c | 8
fs/ocfs2/dlmfs/Makefile | 2
fs/ocfs2/dlmfs/dlmfs.c | 4
fs/ocfs2/dlmfs/userdlm.c | 6
fs/ocfs2/dlmglue.c | 2
fs/ocfs2/journal.h | 8
fs/ocfs2/namei.c | 3
fs/reiserfs/stree.c | 3
include/linux/backing-dev.h | 10
include/linux/bitops.h | 1
include/linux/fs.h | 6
include/linux/io-mapping.h | 5
include/linux/memblock.h | 7
include/linux/memory.h | 29
include/linux/memory_hotplug.h | 3
include/linux/mm.h | 116 +-
include/linux/mmzone.h | 2
include/linux/page-isolation.h | 8
include/linux/swab.h | 1
include/linux/thermal.h | 11
include/linux/units.h | 84 +
include/linux/zlib.h | 6
include/trace/events/kmem.h | 4
include/trace/events/writeback.h | 37
include/uapi/linux/swab.h | 10
include/uapi/linux/sysctl.h | 2
init/main.c | 36
kernel/Makefile | 1
lib/Kconfig | 7
lib/Makefile | 2
lib/decompress_inflate.c | 13
lib/find_bit.c | 82 -
lib/scatterlist.c | 2
lib/test_bitmap.c | 9
lib/test_kasan.c | 1
lib/zlib_deflate/deflate.c | 85 +
lib/zlib_deflate/deflate_syms.c | 1
lib/zlib_deflate/deftree.c | 54 -
lib/zlib_deflate/defutil.h | 134 ++
lib/zlib_dfltcc/Makefile | 13
lib/zlib_dfltcc/dfltcc.c | 57 +
lib/zlib_dfltcc/dfltcc.h | 155 +++
lib/zlib_dfltcc/dfltcc_deflate.c | 280 ++++++
lib/zlib_dfltcc/dfltcc_inflate.c | 149 +++
lib/zlib_dfltcc/dfltcc_syms.c | 17
lib/zlib_dfltcc/dfltcc_util.h | 123 ++
lib/zlib_inflate/inflate.c | 32
lib/zlib_inflate/inflate.h | 8
lib/zlib_inflate/infutil.h | 18
mm/Makefile | 1
mm/backing-dev.c | 1
mm/debug.c | 18
mm/early_ioremap.c | 8
mm/filemap.c | 34
mm/gup.c | 503 ++++++-----
mm/gup_benchmark.c | 9
mm/huge_memory.c | 44
mm/kmemleak.c | 112 +-
mm/memblock.c | 22
mm/memcontrol.c | 25
mm/memory_hotplug.c | 24
mm/mempolicy.c | 6
mm/memremap.c | 95 --
mm/migrate.c | 77 +
mm/mmap.c | 30
mm/oom_kill.c | 2
mm/page_alloc.c | 83 +
mm/page_isolation.c | 69 -
mm/page_vma_mapped.c | 12
mm/process_vm_access.c | 32
mm/slub.c | 88 +
mm/sparse.c | 2
mm/swap.c | 27
mm/swapfile.c | 2
mm/vmscan.c | 24
mm/zswap.c | 88 +
net/xdp/xdp_umem.c | 4
scripts/spelling.txt | 14
tools/testing/selftests/vm/gup_benchmark.c | 6
tools/vm/slabinfo.c | 4
136 files changed, 2790 insertions(+), 1358 deletions(-)
^ permalink raw reply [flat|nested] 232+ messages in thread
* incoming
@ 2020-02-04 1:33 Andrew Morton
[not found] ` <CAHk-=whog86e4fRY_sxHqAos6spwAi_4aFF49S7h5C4XAZM2qw@mail.gmail.com>
0 siblings, 1 reply; 232+ messages in thread
From: Andrew Morton @ 2020-02-04 1:33 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm
The rest of MM and the rest of everything else.
Subsystems affected by this patch series:
hotfixes
mm/pagealloc
mm/memory-hotplug
ipc
misc
mm/cleanups
mm/pagemap
procfs
lib
cleanups
arm
Subsystem: hotfixes
Gang He <GHe@suse.com>:
ocfs2: fix oops when writing cloned file
David Hildenbrand <david@redhat.com>:
Patch series "mm: fix max_pfn not falling on section boundary", v2:
mm/page_alloc.c: fix uninitialized memmaps on a partially populated last section
fs/proc/page.c: allow inspection of last section and fix end detection
mm/page_alloc.c: initialize memmap of unavailable memory directly
Subsystem: mm/pagealloc
David Hildenbrand <david@redhat.com>:
mm/page_alloc: fix and rework pfn handling in memmap_init_zone()
mm: factor out next_present_section_nr()
Subsystem: mm/memory-hotplug
"Aneesh Kumar K.V" <aneesh.kumar@linux.ibm.com>:
Patch series "mm/memory_hotplug: Shrink zones before removing memory", v6:
mm/memmap_init: update variable name in memmap_init_zone
David Hildenbrand <david@redhat.com>:
mm/memory_hotplug: poison memmap in remove_pfn_range_from_zone()
mm/memory_hotplug: we always have a zone in find_(smallest|biggest)_section_pfn
mm/memory_hotplug: don't check for "all holes" in shrink_zone_span()
mm/memory_hotplug: drop local variables in shrink_zone_span()
mm/memory_hotplug: cleanup __remove_pages()
mm/memory_hotplug: drop valid_start/valid_end from test_pages_in_a_zone()
Subsystem: ipc
Manfred Spraul <manfred@colorfullife.com>:
smp_mb__{before,after}_atomic(): update Documentation
Davidlohr Bueso <dave@stgolabs.net>:
ipc/mqueue.c: remove duplicated code
Manfred Spraul <manfred@colorfullife.com>:
ipc/mqueue.c: update/document memory barriers
ipc/msg.c: update and document memory barriers
ipc/sem.c: document and update memory barriers
Lu Shuaibing <shuaibinglu@126.com>:
ipc/msg.c: consolidate all xxxctl_down() functions
drivers/block/null_blk_main.c: fix layout
Subsystem: misc
Andrew Morton <akpm@linux-foundation.org>:
drivers/block/null_blk_main.c: fix layout
drivers/block/null_blk_main.c: fix uninitialized var warnings
Randy Dunlap <rdunlap@infradead.org>:
pinctrl: fix pxa2xx.c build warnings
Subsystem: mm/cleanups
Florian Westphal <fw@strlen.de>:
mm: remove __krealloc
Subsystem: mm/pagemap
Steven Price <steven.price@arm.com>:
Patch series "Generic page walk and ptdump", v17:
mm: add generic p?d_leaf() macros
arc: mm: add p?d_leaf() definitions
arm: mm: add p?d_leaf() definitions
arm64: mm: add p?d_leaf() definitions
mips: mm: add p?d_leaf() definitions
powerpc: mm: add p?d_leaf() definitions
riscv: mm: add p?d_leaf() definitions
s390: mm: add p?d_leaf() definitions
sparc: mm: add p?d_leaf() definitions
x86: mm: add p?d_leaf() definitions
mm: pagewalk: add p4d_entry() and pgd_entry()
mm: pagewalk: allow walking without vma
mm: pagewalk: don't lock PTEs for walk_page_range_novma()
mm: pagewalk: fix termination condition in walk_pte_range()
mm: pagewalk: add 'depth' parameter to pte_hole
x86: mm: point to struct seq_file from struct pg_state
x86: mm+efi: convert ptdump_walk_pgd_level() to take a mm_struct
x86: mm: convert ptdump_walk_pgd_level_debugfs() to take an mm_struct
mm: add generic ptdump
x86: mm: convert dump_pagetables to use walk_page_range
arm64: mm: convert mm/dump.c to use walk_page_range()
arm64: mm: display non-present entries in ptdump
mm: ptdump: reduce level numbers by 1 in note_page()
x86: mm: avoid allocating struct mm_struct on the stack
"Aneesh Kumar K.V" <aneesh.kumar@linux.ibm.com>:
Patch series "Fixup page directory freeing", v4:
powerpc/mmu_gather: enable RCU_TABLE_FREE even for !SMP case
Peter Zijlstra <peterz@infradead.org>:
mm/mmu_gather: invalidate TLB correctly on batch allocation failure and flush
asm-generic/tlb: avoid potential double flush
asm-gemeric/tlb: remove stray function declarations
asm-generic/tlb: add missing CONFIG symbol
asm-generic/tlb: rename HAVE_RCU_TABLE_FREE
asm-generic/tlb: rename HAVE_MMU_GATHER_PAGE_SIZE
asm-generic/tlb: rename HAVE_MMU_GATHER_NO_GATHER
asm-generic/tlb: provide MMU_GATHER_TABLE_FREE
Subsystem: procfs
Alexey Dobriyan <adobriyan@gmail.com>:
proc: decouple proc from VFS with "struct proc_ops"
proc: convert everything to "struct proc_ops"
Subsystem: lib
Yury Norov <yury.norov@gmail.com>:
Patch series "lib: rework bitmap_parse", v5:
lib/string: add strnchrnul()
bitops: more BITS_TO_* macros
lib: add test for bitmap_parse()
lib: make bitmap_parse_user a wrapper on bitmap_parse
lib: rework bitmap_parse()
lib: new testcases for bitmap_parse{_user}
include/linux/cpumask.h: don't calculate length of the input string
Subsystem: cleanups
Masahiro Yamada <masahiroy@kernel.org>:
treewide: remove redundant IS_ERR() before error code check
Subsystem: arm
Chen-Yu Tsai <wens@csie.org>:
ARM: dma-api: fix max_pfn off-by-one error in __dma_supported()
Documentation/memory-barriers.txt | 14
arch/Kconfig | 17
arch/alpha/kernel/srm_env.c | 17
arch/arc/include/asm/pgtable.h | 1
arch/arm/Kconfig | 2
arch/arm/include/asm/pgtable-2level.h | 1
arch/arm/include/asm/pgtable-3level.h | 1
arch/arm/include/asm/tlb.h | 6
arch/arm/kernel/atags_proc.c | 8
arch/arm/mm/alignment.c | 14
arch/arm/mm/dma-mapping.c | 2
arch/arm64/Kconfig | 3
arch/arm64/Kconfig.debug | 19
arch/arm64/include/asm/pgtable.h | 2
arch/arm64/include/asm/ptdump.h | 8
arch/arm64/mm/Makefile | 4
arch/arm64/mm/dump.c | 152 ++----
arch/arm64/mm/mmu.c | 4
arch/arm64/mm/ptdump_debugfs.c | 2
arch/ia64/kernel/salinfo.c | 24 -
arch/m68k/kernel/bootinfo_proc.c | 8
arch/mips/include/asm/pgtable.h | 5
arch/mips/lasat/picvue_proc.c | 31 -
arch/powerpc/Kconfig | 7
arch/powerpc/include/asm/book3s/32/pgalloc.h | 8
arch/powerpc/include/asm/book3s/64/pgalloc.h | 2
arch/powerpc/include/asm/book3s/64/pgtable.h | 3
arch/powerpc/include/asm/nohash/pgalloc.h | 8
arch/powerpc/include/asm/tlb.h | 11
arch/powerpc/kernel/proc_powerpc.c | 10
arch/powerpc/kernel/rtas-proc.c | 70 +--
arch/powerpc/kernel/rtas_flash.c | 34 -
arch/powerpc/kernel/rtasd.c | 14
arch/powerpc/mm/book3s64/pgtable.c | 7
arch/powerpc/mm/numa.c | 12
arch/powerpc/platforms/pseries/lpar.c | 24 -
arch/powerpc/platforms/pseries/lparcfg.c | 14
arch/powerpc/platforms/pseries/reconfig.c | 8
arch/powerpc/platforms/pseries/scanlog.c | 15
arch/riscv/include/asm/pgtable-64.h | 7
arch/riscv/include/asm/pgtable.h | 7
arch/s390/Kconfig | 4
arch/s390/include/asm/pgtable.h | 2
arch/sh/mm/alignment.c | 17
arch/sparc/Kconfig | 3
arch/sparc/include/asm/pgtable_64.h | 2
arch/sparc/include/asm/tlb_64.h | 11
arch/sparc/kernel/led.c | 15
arch/um/drivers/mconsole_kern.c | 9
arch/um/kernel/exitcode.c | 15
arch/um/kernel/process.c | 15
arch/x86/Kconfig | 3
arch/x86/Kconfig.debug | 20
arch/x86/include/asm/pgtable.h | 10
arch/x86/include/asm/tlb.h | 4
arch/x86/kernel/cpu/mtrr/if.c | 21
arch/x86/mm/Makefile | 4
arch/x86/mm/debug_pagetables.c | 18
arch/x86/mm/dump_pagetables.c | 418 +++++-------------
arch/x86/platform/efi/efi_32.c | 2
arch/x86/platform/efi/efi_64.c | 4
arch/x86/platform/uv/tlb_uv.c | 14
arch/xtensa/platforms/iss/simdisk.c | 10
crypto/af_alg.c | 2
drivers/acpi/battery.c | 15
drivers/acpi/proc.c | 15
drivers/acpi/scan.c | 2
drivers/base/memory.c | 9
drivers/block/null_blk_main.c | 58 +-
drivers/char/hw_random/bcm2835-rng.c | 2
drivers/char/hw_random/omap-rng.c | 4
drivers/clk/clk.c | 2
drivers/dma/mv_xor_v2.c | 2
drivers/firmware/efi/arm-runtime.c | 2
drivers/gpio/gpiolib-devres.c | 2
drivers/gpio/gpiolib-of.c | 8
drivers/gpio/gpiolib.c | 2
drivers/hwmon/dell-smm-hwmon.c | 15
drivers/i2c/busses/i2c-mv64xxx.c | 5
drivers/i2c/busses/i2c-synquacer.c | 2
drivers/ide/ide-proc.c | 19
drivers/input/input.c | 28 -
drivers/isdn/capi/kcapi_proc.c | 6
drivers/macintosh/via-pmu.c | 17
drivers/md/md.c | 15
drivers/misc/sgi-gru/gruprocfs.c | 42 -
drivers/mtd/ubi/build.c | 2
drivers/net/wireless/cisco/airo.c | 126 ++---
drivers/net/wireless/intel/ipw2x00/libipw_module.c | 15
drivers/net/wireless/intersil/hostap/hostap_hw.c | 4
drivers/net/wireless/intersil/hostap/hostap_proc.c | 14
drivers/net/wireless/intersil/hostap/hostap_wlan.h | 2
drivers/net/wireless/ray_cs.c | 20
drivers/of/device.c | 2
drivers/parisc/led.c | 17
drivers/pci/controller/pci-tegra.c | 2
drivers/pci/proc.c | 25 -
drivers/phy/phy-core.c | 4
drivers/pinctrl/pxa/pinctrl-pxa2xx.c | 1
drivers/platform/x86/thinkpad_acpi.c | 15
drivers/platform/x86/toshiba_acpi.c | 60 +-
drivers/pnp/isapnp/proc.c | 9
drivers/pnp/pnpbios/proc.c | 17
drivers/s390/block/dasd_proc.c | 15
drivers/s390/cio/blacklist.c | 14
drivers/s390/cio/css.c | 11
drivers/scsi/esas2r/esas2r_main.c | 9
drivers/scsi/scsi_devinfo.c | 15
drivers/scsi/scsi_proc.c | 29 -
drivers/scsi/sg.c | 30 -
drivers/spi/spi-orion.c | 3
drivers/staging/rtl8192u/ieee80211/ieee80211_module.c | 14
drivers/tty/sysrq.c | 8
drivers/usb/gadget/function/rndis.c | 17
drivers/video/fbdev/imxfb.c | 2
drivers/video/fbdev/via/viafbdev.c | 105 ++--
drivers/zorro/proc.c | 9
fs/cifs/cifs_debug.c | 108 ++--
fs/cifs/dfs_cache.c | 13
fs/cifs/dfs_cache.h | 2
fs/ext4/super.c | 2
fs/f2fs/node.c | 2
fs/fscache/internal.h | 2
fs/fscache/object-list.c | 11
fs/fscache/proc.c | 2
fs/jbd2/journal.c | 13
fs/jfs/jfs_debug.c | 14
fs/lockd/procfs.c | 12
fs/nfsd/nfsctl.c | 13
fs/nfsd/stats.c | 12
fs/ocfs2/file.c | 14
fs/ocfs2/suballoc.c | 2
fs/proc/cpuinfo.c | 12
fs/proc/generic.c | 38 -
fs/proc/inode.c | 76 +--
fs/proc/internal.h | 5
fs/proc/kcore.c | 13
fs/proc/kmsg.c | 14
fs/proc/page.c | 54 +-
fs/proc/proc_net.c | 32 -
fs/proc/proc_sysctl.c | 2
fs/proc/root.c | 2
fs/proc/stat.c | 12
fs/proc/task_mmu.c | 4
fs/proc/vmcore.c | 10
fs/sysfs/group.c | 2
include/asm-generic/pgtable.h | 20
include/asm-generic/tlb.h | 138 +++--
include/linux/bitmap.h | 8
include/linux/bitops.h | 4
include/linux/cpumask.h | 4
include/linux/memory_hotplug.h | 4
include/linux/mm.h | 6
include/linux/mmzone.h | 10
include/linux/pagewalk.h | 49 +-
include/linux/proc_fs.h | 23
include/linux/ptdump.h | 24 -
include/linux/seq_file.h | 13
include/linux/slab.h | 1
include/linux/string.h | 1
include/linux/sunrpc/stats.h | 4
ipc/mqueue.c | 123 ++++-
ipc/msg.c | 62 +-
ipc/sem.c | 66 +-
ipc/util.c | 14
kernel/configs.c | 9
kernel/irq/proc.c | 42 -
kernel/kallsyms.c | 12
kernel/latencytop.c | 14
kernel/locking/lockdep_proc.c | 15
kernel/module.c | 12
kernel/profile.c | 24 -
kernel/sched/psi.c | 48 +-
lib/bitmap.c | 195 ++++----
lib/string.c | 17
lib/test_bitmap.c | 105 ++++
mm/Kconfig.debug | 21
mm/Makefile | 1
mm/gup.c | 2
mm/hmm.c | 66 +-
mm/memory_hotplug.c | 104 +---
mm/memremap.c | 2
mm/migrate.c | 5
mm/mincore.c | 1
mm/mmu_gather.c | 158 ++++--
mm/page_alloc.c | 75 +--
mm/pagewalk.c | 167 +++++--
mm/ptdump.c | 159 ++++++
mm/slab_common.c | 37 -
mm/sparse.c | 10
mm/swapfile.c | 14
net/atm/mpoa_proc.c | 17
net/atm/proc.c | 8
net/core/dev.c | 2
net/core/filter.c | 2
net/core/pktgen.c | 44 -
net/ipv4/ipconfig.c | 10
net/ipv4/netfilter/ipt_CLUSTERIP.c | 16
net/ipv4/route.c | 24 -
net/netfilter/xt_recent.c | 17
net/sunrpc/auth_gss/svcauth_gss.c | 10
net/sunrpc/cache.c | 45 -
net/sunrpc/stats.c | 21
net/xfrm/xfrm_policy.c | 2
samples/kfifo/bytestream-example.c | 11
samples/kfifo/inttype-example.c | 11
samples/kfifo/record-example.c | 11
scripts/coccinelle/free/devm_free.cocci | 4
sound/core/info.c | 34 -
sound/soc/codecs/ak4104.c | 3
sound/soc/codecs/cs4270.c | 3
sound/soc/codecs/tlv320aic32x4.c | 6
sound/soc/sunxi/sun4i-spdif.c | 2
tools/include/linux/bitops.h | 9
214 files changed, 2589 insertions(+), 2227 deletions(-)
^ permalink raw reply [flat|nested] 232+ messages in thread
* Re: incoming
[not found] ` <CAHk-=whog86e4fRY_sxHqAos6spwAi_4aFF49S7h5C4XAZM2qw@mail.gmail.com>
@ 2020-02-04 2:46 ` Andrew Morton
0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2020-02-04 2:46 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, Linux-MM
On Tue, 4 Feb 2020 02:27:48 +0000 Linus Torvalds <torvalds@linux-foundation.org> wrote:
> On Tue, Feb 4, 2020 at 1:33 AM Andrew Morton <akpm@linux-foundation.org> wrote:
> >
> > The rest of MM and the rest of everything else.
>
> What's the base? You've changed your scripts or something, and that
> information is no longer in your cover letter..
>
Crap, sorry, geriatric.
d4e9056daedca3891414fe3c91de3449a5dad0f2
^ permalink raw reply [flat|nested] 232+ messages in thread
* incoming
@ 2020-02-21 4:00 Andrew Morton
2020-02-21 4:03 ` incoming Andrew Morton
0 siblings, 1 reply; 232+ messages in thread
From: Andrew Morton @ 2020-02-21 4:00 UTC (permalink / raw)
To: Linus Torvalds; +Cc: linux-mm, mm-commits
- A few y2038 fixes which missed the merge window whiole dependencies
in NFS were being sorted out.
- A bunch of fixes. Some minor, some not.
Subsystems affected by this patch series:
Arnd Bergmann <arnd@arndb.de>:
y2038: remove ktime to/from timespec/timeval conversion
y2038: remove unused time32 interfaces
y2038: hide timeval/timespec/itimerval/itimerspec types
Ioanna Alifieraki <ioanna-maria.alifieraki@canonical.com>:
Revert "ipc,sem: remove uneeded sem_undo_list lock usage in exit_sem()"
Christian Borntraeger <borntraeger@de.ibm.com>:
include/uapi/linux/swab.h: fix userspace breakage, use __BITS_PER_LONG for swap
SeongJae Park <sjpark@amazon.de>:
selftests/vm: add missed tests in run_vmtests
Joe Perches <joe@perches.com>:
get_maintainer: remove uses of P: for maintainer name
Douglas Anderson <dianders@chromium.org>:
scripts/get_maintainer.pl: deprioritize old Fixes: addresses
Christoph Hellwig <hch@lst.de>:
mm/swapfile.c: fix a comment in sys_swapon()
Vasily Averin <vvs@virtuozzo.com>:
mm/memcontrol.c: lost css_put in memcg_expand_shrinker_maps()
Alexandru Ardelean <alexandru.ardelean@analog.com>:
lib/string.c: update match_string() doc-strings with correct behavior
Gavin Shan <gshan@redhat.com>:
mm/vmscan.c: don't round up scan size for online memory cgroup
Wei Yang <richardw.yang@linux.intel.com>:
mm/sparsemem: pfn_to_page is not valid yet on SPARSEMEM
Alexander Potapenko <glider@google.com>:
lib/stackdepot.c: fix global out-of-bounds in stack_slabs
Randy Dunlap <rdunlap@infradead.org>:
MAINTAINERS: use tabs for SAFESETID
MAINTAINERS | 8 -
include/linux/compat.h | 29 ------
include/linux/ktime.h | 37 -------
include/linux/time32.h | 154 ---------------------------------
include/linux/timekeeping32.h | 32 ------
include/linux/types.h | 5 -
include/uapi/asm-generic/posix_types.h | 2
include/uapi/linux/swab.h | 4
include/uapi/linux/time.h | 22 ++--
ipc/sem.c | 6 -
kernel/compat.c | 64 -------------
kernel/time/time.c | 43 ---------
lib/stackdepot.c | 8 +
lib/string.c | 16 +++
mm/memcontrol.c | 4
mm/sparse.c | 2
mm/swapfile.c | 2
mm/vmscan.c | 9 +
scripts/get_maintainer.pl | 32 ------
tools/testing/selftests/vm/run_vmtests | 33 +++++++
20 files changed, 93 insertions(+), 419 deletions(-)
^ permalink raw reply [flat|nested] 232+ messages in thread
* Re: incoming
2020-02-21 4:00 incoming Andrew Morton
@ 2020-02-21 4:03 ` Andrew Morton
0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2020-02-21 4:03 UTC (permalink / raw)
To: Linus Torvalds, linux-mm, mm-commits
On Thu, 20 Feb 2020 20:00:30 -0800 Andrew Morton <akpm@linux-foundation.org> wrote:
> - A few y2038 fixes which missed the merge window whiole dependencies
> in NFS were being sorted out.
>
> - A bunch of fixes. Some minor, some not.
15 patches, based on ca7e1fd1026c5af6a533b4b5447e1d2f153e28f2
^ permalink raw reply [flat|nested] 232+ messages in thread
* incoming
@ 2020-03-06 6:27 Andrew Morton
0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2020-03-06 6:27 UTC (permalink / raw)
To: Linus Torvalds; +Cc: linux-mm, mm-commits
7 fixes, based on 9f65ed5fe41ce08ed1cb1f6a950f9ec694c142ad:
Mel Gorman <mgorman@techsingularity.net>:
mm, numa: fix bad pmd by atomically check for pmd_trans_huge when marking page tables prot_numa
Huang Ying <ying.huang@intel.com>:
mm: fix possible PMD dirty bit lost in set_pmd_migration_entry()
"Kirill A. Shutemov" <kirill@shutemov.name>:
mm: avoid data corruption on CoW fault into PFN-mapped VMA
OGAWA Hirofumi <hirofumi@mail.parknet.co.jp>:
fat: fix uninit-memory access for partial initialized inode
Sebastian Andrzej Siewior <bigeasy@linutronix.de>:
mm/z3fold.c: do not include rwlock.h directly
Vlastimil Babka <vbabka@suse.cz>:
mm, hotplug: fix page online with DEBUG_PAGEALLOC compiled but not enabled
Miroslav Benes <mbenes@suse.cz>:
arch/Kconfig: update HAVE_RELIABLE_STACKTRACE description
arch/Kconfig | 5 +++--
fs/fat/inode.c | 19 +++++++------------
include/linux/mm.h | 4 ++++
mm/huge_memory.c | 3 +--
mm/memory.c | 35 +++++++++++++++++++++++++++--------
mm/memory_hotplug.c | 8 +++++++-
mm/mprotect.c | 38 ++++++++++++++++++++++++++++++++++++--
mm/z3fold.c | 1 -
8 files changed, 85 insertions(+), 28 deletions(-)
^ permalink raw reply [flat|nested] 232+ messages in thread
* incoming
@ 2020-03-22 1:19 Andrew Morton
0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2020-03-22 1:19 UTC (permalink / raw)
To: Linus Torvalds; +Cc: linux-mm, mm-commits
10 fixes, based on c63c50fc2ec9afc4de21ef9ead2eac64b178cce1:
Chunguang Xu <brookxu@tencent.com>:
memcg: fix NULL pointer dereference in __mem_cgroup_usage_unregister_event
Baoquan He <bhe@redhat.com>:
mm/hotplug: fix hot remove failure in SPARSEMEM|!VMEMMAP case
Qian Cai <cai@lca.pw>:
page-flags: fix a crash at SetPageError(THP_SWAP)
Chris Down <chris@chrisdown.name>:
mm, memcg: fix corruption on 64-bit divisor in memory.high throttling
mm, memcg: throttle allocators based on ancestral memory.high
Michal Hocko <mhocko@suse.com>:
mm: do not allow MADV_PAGEOUT for CoW pages
Roman Penyaev <rpenyaev@suse.de>:
epoll: fix possible lost wakeup on epoll_ctl() path
Qian Cai <cai@lca.pw>:
mm/mmu_notifier: silence PROVE_RCU_LIST warnings
Vlastimil Babka <vbabka@suse.cz>:
mm, slub: prevent kmalloc_node crashes and memory leaks
Joerg Roedel <jroedel@suse.de>:
x86/mm: split vmalloc_sync_all()
arch/x86/mm/fault.c | 26 ++++++++++-
drivers/acpi/apei/ghes.c | 2
fs/eventpoll.c | 8 +--
include/linux/page-flags.h | 2
include/linux/vmalloc.h | 5 +-
kernel/notifier.c | 2
mm/madvise.c | 12 +++--
mm/memcontrol.c | 105 ++++++++++++++++++++++++++++-----------------
mm/mmu_notifier.c | 27 +++++++----
mm/nommu.c | 10 +++-
mm/slub.c | 26 +++++++----
mm/sparse.c | 8 ++-
mm/vmalloc.c | 11 +++-
13 files changed, 165 insertions(+), 79 deletions(-)
^ permalink raw reply [flat|nested] 232+ messages in thread
* incoming
@ 2020-03-29 2:14 Andrew Morton
0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2020-03-29 2:14 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm
5 fixes, based on 83fd69c93340177dcd66fd26ce6441fb581c1dbf:
Naohiro Aota <naohiro.aota@wdc.com>:
mm/swapfile.c: move inode_lock out of claim_swapfile
David Hildenbrand <david@redhat.com>:
drivers/base/memory.c: indicate all memory blocks as removable
Mina Almasry <almasrymina@google.com>:
hugetlb_cgroup: fix illegal access to memory
Roman Gushchin <guro@fb.com>:
mm: fork: fix kernel_stack memcg stats for various stack implementations
"Aneesh Kumar K.V" <aneesh.kumar@linux.ibm.com>:
mm/sparse: fix kernel crash with pfn_section_valid check
drivers/base/memory.c | 23 +++--------------------
include/linux/memcontrol.h | 12 ++++++++++++
kernel/fork.c | 4 ++--
mm/hugetlb_cgroup.c | 3 +--
mm/memcontrol.c | 38 ++++++++++++++++++++++++++++++++++++++
mm/sparse.c | 6 ++++++
mm/swapfile.c | 41 ++++++++++++++++++++---------------------
7 files changed, 82 insertions(+), 45 deletions(-)
^ permalink raw reply [flat|nested] 232+ messages in thread
* incoming
@ 2020-04-02 4:01 Andrew Morton
0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2020-04-02 4:01 UTC (permalink / raw)
To: Linus Torvalds; +Cc: linux-mm, mm-commits
A large amount of MM, plenty more to come.
155 patches, based on GIT 1a323ea5356edbb3073dc59d51b9e6b86908857d
Subsystems affected by this patch series:
tools
kthread
kbuild
scripts
ocfs2
vfs
mm/slub
mm/kmemleak
mm/pagecache
mm/gup
mm/swap
mm/memcg
mm/pagemap
mm/mremap
mm/sparsemem
mm/kasan
mm/pagealloc
mm/vmscan
mm/compaction
mm/mempolicy
mm/hugetlbfs
mm/hugetlb
Subsystem: tools
David Ahern <dsahern@kernel.org>:
tools/accounting/getdelays.c: fix netlink attribute length
Subsystem: kthread
Petr Mladek <pmladek@suse.com>:
kthread: mark timer used by delayed kthread works as IRQ safe
Subsystem: kbuild
Masahiro Yamada <masahiroy@kernel.org>:
asm-generic: make more kernel-space headers mandatory
Subsystem: scripts
Jonathan Neuschäfer <j.neuschaefer@gmx.net>:
scripts/spelling.txt: add syfs/sysfs pattern
Colin Ian King <colin.king@canonical.com>:
scripts/spelling.txt: add more spellings to spelling.txt
Subsystem: ocfs2
Alex Shi <alex.shi@linux.alibaba.com>:
ocfs2: remove FS_OCFS2_NM
ocfs2: remove unused macros
ocfs2: use OCFS2_SEC_BITS in macro
ocfs2: remove dlm_lock_is_remote
wangyan <wangyan122@huawei.com>:
ocfs2: there is no need to log twice in several functions
ocfs2: correct annotation from "l_next_rec" to "l_next_free_rec"
Alex Shi <alex.shi@linux.alibaba.com>:
ocfs2: remove useless err
Jules Irenge <jbi.octave@gmail.com>:
ocfs2: Add missing annotations for ocfs2_refcount_cache_lock() and ocfs2_refcount_cache_unlock()
"Gustavo A. R. Silva" <gustavo@embeddedor.com>:
ocfs2: replace zero-length array with flexible-array member
ocfs2: cluster: replace zero-length array with flexible-array member
ocfs2: dlm: replace zero-length array with flexible-array member
ocfs2: ocfs2_fs.h: replace zero-length array with flexible-array member
wangjian <wangjian161@huawei.com>:
ocfs2: roll back the reference count modification of the parent directory if an error occurs
Takashi Iwai <tiwai@suse.de>:
ocfs2: use scnprintf() for avoiding potential buffer overflow
"Matthew Wilcox (Oracle)" <willy@infradead.org>:
ocfs2: use memalloc_nofs_save instead of memalloc_noio_save
Subsystem: vfs
Kees Cook <keescook@chromium.org>:
fs_parse: Remove pr_notice() about each validation
Subsystem: mm/slub
chenqiwu <chenqiwu@xiaomi.com>:
mm/slub.c: replace cpu_slab->partial with wrapped APIs
mm/slub.c: replace kmem_cache->cpu_partial with wrapped APIs
Kees Cook <keescook@chromium.org>:
slub: improve bit diffusion for freelist ptr obfuscation
slub: relocate freelist pointer to middle of object
Vlastimil Babka <vbabka@suse.cz>:
Revert "topology: add support for node_to_mem_node() to determine the fallback node"
Subsystem: mm/kmemleak
Nathan Chancellor <natechancellor@gmail.com>:
mm/kmemleak.c: use address-of operator on section symbols
Qian Cai <cai@lca.pw>:
mm/Makefile: disable KCSAN for kmemleak
Subsystem: mm/pagecache
Jan Kara <jack@suse.cz>:
mm/filemap.c: don't bother dropping mmap_sem for zero size readahead
Mauricio Faria de Oliveira <mfo@canonical.com>:
mm/page-writeback.c: write_cache_pages(): deduplicate identical checks
Xianting Tian <xianting_tian@126.com>:
mm/filemap.c: clear page error before actual read
Souptick Joarder <jrdr.linux@gmail.com>:
mm/filemap.c: remove unused argument from shrink_readahead_size_eio()
"Matthew Wilcox (Oracle)" <willy@infradead.org>:
mm/filemap.c: use vm_fault error code directly
include/linux/pagemap.h: rename arguments to find_subpage
mm/page-writeback.c: use VM_BUG_ON_PAGE in clear_page_dirty_for_io
mm/filemap.c: unexport find_get_entry
mm/filemap.c: rewrite pagecache_get_page documentation
Subsystem: mm/gup
John Hubbard <jhubbard@nvidia.com>:
Patch series "mm/gup: track FOLL_PIN pages", v6:
mm/gup: split get_user_pages_remote() into two routines
mm/gup: pass a flags arg to __gup_device_* functions
mm: introduce page_ref_sub_return()
mm/gup: pass gup flags to two more routines
mm/gup: require FOLL_GET for get_user_pages_fast()
mm/gup: track FOLL_PIN pages
mm/gup: page->hpage_pinned_refcount: exact pin counts for huge pages
mm/gup: /proc/vmstat: pin_user_pages (FOLL_PIN) reporting
mm/gup_benchmark: support pin_user_pages() and related calls
selftests/vm: run_vmtests: invoke gup_benchmark with basic FOLL_PIN coverage
"Matthew Wilcox (Oracle)" <willy@infradead.org>:
mm: improve dump_page() for compound pages
John Hubbard <jhubbard@nvidia.com>:
mm: dump_page(): additional diagnostics for huge pinned pages
Claudio Imbrenda <imbrenda@linux.ibm.com>:
mm/gup/writeback: add callbacks for inaccessible pages
Pingfan Liu <kernelfans@gmail.com>:
mm/gup: rename nr as nr_pinned in get_user_pages_fast()
mm/gup: fix omission of check on FOLL_LONGTERM in gup fast path
Subsystem: mm/swap
Chen Wandun <chenwandun@huawei.com>:
mm/swapfile.c: fix comments for swapcache_prepare
Wei Yang <richardw.yang@linux.intel.com>:
mm/swap.c: not necessary to export __pagevec_lru_add()
Qian Cai <cai@lca.pw>:
mm/swapfile: fix data races in try_to_unuse()
Wei Yang <richard.weiyang@linux.alibaba.com>:
mm/swap_slots.c: assign|reset cache slot by value directly
Yang Shi <yang.shi@linux.alibaba.com>:
mm: swap: make page_evictable() inline
mm: swap: use smp_mb__after_atomic() to order LRU bit set
Wei Yang <richard.weiyang@gmail.com>:
mm/swap_state.c: use the same way to count page in [add_to|delete_from]_swap_cache
Subsystem: mm/memcg
Yafang Shao <laoar.shao@gmail.com>:
mm, memcg: fix build error around the usage of kmem_caches
Kirill Tkhai <ktkhai@virtuozzo.com>:
mm/memcontrol.c: allocate shrinker_map on appropriate NUMA node
Roman Gushchin <guro@fb.com>:
mm: memcg/slab: use mem_cgroup_from_obj()
Patch series "mm: memcg: kmem API cleanup", v2:
mm: kmem: cleanup (__)memcg_kmem_charge_memcg() arguments
mm: kmem: cleanup memcg_kmem_uncharge_memcg() arguments
mm: kmem: rename memcg_kmem_(un)charge() into memcg_kmem_(un)charge_page()
mm: kmem: switch to nr_pages in (__)memcg_kmem_charge_memcg()
mm: memcg/slab: cache page number in memcg_(un)charge_slab()
mm: kmem: rename (__)memcg_kmem_(un)charge_memcg() to __memcg_kmem_(un)charge()
Johannes Weiner <hannes@cmpxchg.org>:
Patch series "mm: memcontrol: recursive memory.low protection", v3:
mm: memcontrol: fix memory.low proportional distribution
mm: memcontrol: clean up and document effective low/min calculations
mm: memcontrol: recursive memory.low protection
Shakeel Butt <shakeelb@google.com>:
memcg: css_tryget_online cleanups
Vincenzo Frascino <vincenzo.frascino@arm.com>:
mm/memcontrol.c: make mem_cgroup_id_get_many() __maybe_unused
Chris Down <chris@chrisdown.name>:
mm, memcg: prevent memory.high load/store tearing
mm, memcg: prevent memory.max load tearing
mm, memcg: prevent memory.low load/store tearing
mm, memcg: prevent memory.min load/store tearing
mm, memcg: prevent memory.swap.max load tearing
mm, memcg: prevent mem_cgroup_protected store tearing
Roman Gushchin <guro@fb.com>:
mm: memcg: make memory.oom.group tolerable to task migration
Subsystem: mm/pagemap
Thomas Hellstrom <thellstrom@vmware.com>:
mm/mapping_dirty_helpers: Update huge page-table entry callbacks
Anshuman Khandual <anshuman.khandual@arm.com>:
Patch series "mm/vma: some more minor changes", v2:
mm/vma: move VM_NO_KHUGEPAGED into generic header
mm/vma: make vma_is_foreign() available for general use
mm/vma: make is_vma_temporary_stack() available for general use
"Matthew Wilcox (Oracle)" <willy@infradead.org>:
mm: add pagemap.h to the fine documentation
Peter Xu <peterx@redhat.com>:
Patch series "mm: Page fault enhancements", v6:
mm/gup: rename "nonblocking" to "locked" where proper
mm/gup: fix __get_user_pages() on fault retry of hugetlb
mm: introduce fault_signal_pending()
x86/mm: use helper fault_signal_pending()
arc/mm: use helper fault_signal_pending()
arm64/mm: use helper fault_signal_pending()
powerpc/mm: use helper fault_signal_pending()
sh/mm: use helper fault_signal_pending()
mm: return faster for non-fatal signals in user mode faults
userfaultfd: don't retake mmap_sem to emulate NOPAGE
mm: introduce FAULT_FLAG_DEFAULT
mm: introduce FAULT_FLAG_INTERRUPTIBLE
mm: allow VM_FAULT_RETRY for multiple times
mm/gup: allow VM_FAULT_RETRY for multiple times
mm/gup: allow to react to fatal signals
mm/userfaultfd: honor FAULT_FLAG_KILLABLE in fault path
WANG Wenhu <wenhu.wang@vivo.com>:
mm: clarify a confusing comment for remap_pfn_range()
Wang Wenhu <wenhu.wang@vivo.com>:
mm/memory.c: clarify a confusing comment for vm_iomap_memory
Jaewon Kim <jaewon31.kim@samsung.com>:
Patch series "mm: mmap: add mmap trace point", v3:
mmap: remove inline of vm_unmapped_area
mm: mmap: add trace point of vm_unmapped_area
Subsystem: mm/mremap
Brian Geffon <bgeffon@google.com>:
mm/mremap: add MREMAP_DONTUNMAP to mremap()
selftests: add MREMAP_DONTUNMAP selftest
Subsystem: mm/sparsemem
Wei Yang <richardw.yang@linux.intel.com>:
mm/sparsemem: get address to page struct instead of address to pfn
Pingfan Liu <kernelfans@gmail.com>:
mm/sparse: rename pfn_present() to pfn_in_present_section()
Baoquan He <bhe@redhat.com>:
mm/sparse.c: use kvmalloc/kvfree to alloc/free memmap for the classic sparse
mm/sparse.c: allocate memmap preferring the given node
Subsystem: mm/kasan
Walter Wu <walter-zh.wu@mediatek.com>:
Patch series "fix the missing underflow in memory operation function", v4:
kasan: detect negative size in memory operation function
kasan: add test for invalid size in memmove
Subsystem: mm/pagealloc
Joel Savitz <jsavitz@redhat.com>:
mm/page_alloc: increase default min_free_kbytes bound
Mateusz Nosek <mateusznosek0@gmail.com>:
mm, pagealloc: micro-optimisation: save two branches on hot page allocation path
chenqiwu <chenqiwu@xiaomi.com>:
mm/page_alloc.c: use free_area_empty() instead of open-coding
Mateusz Nosek <mateusznosek0@gmail.com>:
mm/page_alloc.c: micro-optimisation Remove unnecessary branch
chenqiwu <chenqiwu@xiaomi.com>:
mm/page_alloc: simplify page_is_buddy() for better code readability
Subsystem: mm/vmscan
Yang Shi <yang.shi@linux.alibaba.com>:
mm: vmpressure: don't need call kfree if kstrndup fails
mm: vmpressure: use mem_cgroup_is_root API
mm: vmscan: replace open codings to NUMA_NO_NODE
Wei Yang <richardw.yang@linux.intel.com>:
mm/vmscan.c: remove cpu online notification for now
Qian Cai <cai@lca.pw>:
mm/vmscan.c: fix data races using kswapd_classzone_idx
Mateusz Nosek <mateusznosek0@gmail.com>:
mm/vmscan.c: Clean code by removing unnecessary assignment
Kirill Tkhai <ktkhai@virtuozzo.com>:
mm/vmscan.c: make may_enter_fs bool in shrink_page_list()
Mateusz Nosek <mateusznosek0@gmail.com>:
mm/vmscan.c: do_try_to_free_pages(): clean code by removing unnecessary assignment
Michal Hocko <mhocko@suse.com>:
selftests: vm: drop dependencies on page flags from mlock2 tests
Subsystem: mm/compaction
Rik van Riel <riel@surriel.com>:
Patch series "fix THP migration for CMA allocations", v2:
mm,compaction,cma: add alloc_contig flag to compact_control
mm,thp,compaction,cma: allow THP migration for CMA allocations
Vlastimil Babka <vbabka@suse.cz>:
mm, compaction: fully assume capture is not NULL in compact_zone_order()
Sebastian Andrzej Siewior <bigeasy@linutronix.de>:
mm/compaction: really limit compact_unevictable_allowed to 0 and 1
mm/compaction: Disable compact_unevictable_allowed on RT
Mateusz Nosek <mateusznosek0@gmail.com>:
mm/compaction.c: clean code by removing unnecessary assignment
Subsystem: mm/mempolicy
Li Xinhai <lixinhai.lxh@gmail.com>:
mm/mempolicy: support MPOL_MF_STRICT for huge page mapping
mm/mempolicy: check hugepage migration is supported by arch in vma_migratable()
Yang Shi <yang.shi@linux.alibaba.com>:
mm: mempolicy: use VM_BUG_ON_VMA in queue_pages_test_walk()
Randy Dunlap <rdunlap@infradead.org>:
mm: mempolicy: require at least one nodeid for MPOL_PREFERRED
Colin Ian King <colin.king@canonical.com>:
mm/memblock.c: remove redundant assignment to variable max_addr
Subsystem: mm/hugetlbfs
Mike Kravetz <mike.kravetz@oracle.com>:
Patch series "hugetlbfs: use i_mmap_rwsem for more synchronization", v2:
hugetlbfs: use i_mmap_rwsem for more pmd sharing synchronization
hugetlbfs: Use i_mmap_rwsem to address page fault/truncate race
Subsystem: mm/hugetlb
Mina Almasry <almasrymina@google.com>:
hugetlb_cgroup: add hugetlb_cgroup reservation counter
hugetlb_cgroup: add interface for charge/uncharge hugetlb reservations
mm/hugetlb_cgroup: fix hugetlb_cgroup migration
hugetlb_cgroup: add reservation accounting for private mappings
hugetlb: disable region_add file_region coalescing
hugetlb_cgroup: add accounting for shared mappings
hugetlb_cgroup: support noreserve mappings
hugetlb: support file_region coalescing again
hugetlb_cgroup: add hugetlb_cgroup reservation tests
hugetlb_cgroup: add hugetlb_cgroup reservation docs
Mateusz Nosek <mateusznosek0@gmail.com>:
mm/hugetlb.c: clean code by removing unnecessary initialization
Vlastimil Babka <vbabka@suse.cz>:
mm/hugetlb: remove unnecessary memory fetch in PageHeadHuge()
Christophe Leroy <christophe.leroy@c-s.fr>:
selftests/vm: fix map_hugetlb length used for testing read and write
mm/hugetlb: fix build failure with HUGETLB_PAGE but not HUGEBTLBFS
"Matthew Wilcox (Oracle)" <willy@infradead.org>:
include/linux/huge_mm.h: check PageTail in hpage_nr_pages even when !THP
Documentation/admin-guide/cgroup-v1/hugetlb.rst | 103 +-
Documentation/admin-guide/cgroup-v2.rst | 11
Documentation/admin-guide/sysctl/vm.rst | 3
Documentation/core-api/mm-api.rst | 3
Documentation/core-api/pin_user_pages.rst | 86 +
arch/alpha/include/asm/Kbuild | 11
arch/alpha/mm/fault.c | 6
arch/arc/include/asm/Kbuild | 21
arch/arc/mm/fault.c | 37
arch/arm/include/asm/Kbuild | 12
arch/arm/mm/fault.c | 7
arch/arm64/include/asm/Kbuild | 18
arch/arm64/mm/fault.c | 26
arch/c6x/include/asm/Kbuild | 37
arch/csky/include/asm/Kbuild | 36
arch/h8300/include/asm/Kbuild | 46
arch/hexagon/include/asm/Kbuild | 33
arch/hexagon/mm/vm_fault.c | 5
arch/ia64/include/asm/Kbuild | 7
arch/ia64/mm/fault.c | 5
arch/m68k/include/asm/Kbuild | 24
arch/m68k/mm/fault.c | 7
arch/microblaze/include/asm/Kbuild | 29
arch/microblaze/mm/fault.c | 5
arch/mips/include/asm/Kbuild | 13
arch/mips/mm/fault.c | 5
arch/nds32/include/asm/Kbuild | 37
arch/nds32/mm/fault.c | 5
arch/nios2/include/asm/Kbuild | 38
arch/nios2/mm/fault.c | 7
arch/openrisc/include/asm/Kbuild | 36
arch/openrisc/mm/fault.c | 5
arch/parisc/include/asm/Kbuild | 18
arch/parisc/mm/fault.c | 8
arch/powerpc/include/asm/Kbuild | 4
arch/powerpc/mm/book3s64/pkeys.c | 12
arch/powerpc/mm/fault.c | 20
arch/powerpc/platforms/pseries/hotplug-memory.c | 2
arch/riscv/include/asm/Kbuild | 28
arch/riscv/mm/fault.c | 9
arch/s390/include/asm/Kbuild | 15
arch/s390/mm/fault.c | 10
arch/sh/include/asm/Kbuild | 16
arch/sh/mm/fault.c | 13
arch/sparc/include/asm/Kbuild | 14
arch/sparc/mm/fault_32.c | 5
arch/sparc/mm/fault_64.c | 5
arch/um/kernel/trap.c | 3
arch/unicore32/include/asm/Kbuild | 34
arch/unicore32/mm/fault.c | 8
arch/x86/include/asm/Kbuild | 2
arch/x86/include/asm/mmu_context.h | 15
arch/x86/mm/fault.c | 32
arch/xtensa/include/asm/Kbuild | 26
arch/xtensa/mm/fault.c | 5
drivers/base/node.c | 2
drivers/gpu/drm/ttm/ttm_bo_vm.c | 12
fs/fs_parser.c | 2
fs/hugetlbfs/inode.c | 30
fs/ocfs2/alloc.c | 3
fs/ocfs2/cluster/heartbeat.c | 12
fs/ocfs2/cluster/netdebug.c | 4
fs/ocfs2/cluster/tcp.c | 27
fs/ocfs2/cluster/tcp.h | 2
fs/ocfs2/dir.c | 4
fs/ocfs2/dlm/dlmcommon.h | 8
fs/ocfs2/dlm/dlmdebug.c | 100 -
fs/ocfs2/dlm/dlmmaster.c | 2
fs/ocfs2/dlm/dlmthread.c | 3
fs/ocfs2/dlmglue.c | 2
fs/ocfs2/journal.c | 2
fs/ocfs2/namei.c | 15
fs/ocfs2/ocfs2_fs.h | 18
fs/ocfs2/refcounttree.c | 2
fs/ocfs2/reservations.c | 3
fs/ocfs2/stackglue.c | 2
fs/ocfs2/suballoc.c | 5
fs/ocfs2/super.c | 46
fs/pipe.c | 2
fs/userfaultfd.c | 64 -
include/asm-generic/Kbuild | 52 +
include/linux/cgroup-defs.h | 5
include/linux/fs.h | 5
include/linux/gfp.h | 6
include/linux/huge_mm.h | 10
include/linux/hugetlb.h | 76 +
include/linux/hugetlb_cgroup.h | 175 +++
include/linux/kasan.h | 2
include/linux/kthread.h | 3
include/linux/memcontrol.h | 66 -
include/linux/mempolicy.h | 29
include/linux/mm.h | 243 +++-
include/linux/mm_types.h | 7
include/linux/mmzone.h | 6
include/linux/page_ref.h | 9
include/linux/pagemap.h | 29
include/linux/sched/signal.h | 18
include/linux/swap.h | 1
include/linux/topology.h | 17
include/trace/events/mmap.h | 48
include/uapi/linux/mman.h | 5
kernel/cgroup/cgroup.c | 17
kernel/fork.c | 9
kernel/sysctl.c | 31
lib/test_kasan.c | 19
mm/Makefile | 1
mm/compaction.c | 31
mm/debug.c | 54 -
mm/filemap.c | 77 -
mm/gup.c | 682 ++++++++++---
mm/gup_benchmark.c | 71 +
mm/huge_memory.c | 29
mm/hugetlb.c | 866 ++++++++++++-----
mm/hugetlb_cgroup.c | 347 +++++-
mm/internal.h | 32
mm/kasan/common.c | 26
mm/kasan/generic.c | 9
mm/kasan/generic_report.c | 11
mm/kasan/kasan.h | 2
mm/kasan/report.c | 5
mm/kasan/tags.c | 9
mm/kasan/tags_report.c | 11
mm/khugepaged.c | 4
mm/kmemleak.c | 2
mm/list_lru.c | 12
mm/mapping_dirty_helpers.c | 42
mm/memblock.c | 2
mm/memcontrol.c | 378 ++++---
mm/memory-failure.c | 29
mm/memory.c | 4
mm/mempolicy.c | 73 +
mm/migrate.c | 25
mm/mmap.c | 32
mm/mremap.c | 92 +
mm/page-writeback.c | 19
mm/page_alloc.c | 82 -
mm/page_counter.c | 29
mm/page_ext.c | 2
mm/rmap.c | 39
mm/shuffle.c | 2
mm/slab.h | 32
mm/slab_common.c | 2
mm/slub.c | 27
mm/sparse.c | 33
mm/swap.c | 5
mm/swap_slots.c | 12
mm/swap_state.c | 2
mm/swapfile.c | 10
mm/userfaultfd.c | 11
mm/vmpressure.c | 8
mm/vmscan.c | 111 --
mm/vmstat.c | 2
scripts/spelling.txt | 21
tools/accounting/getdelays.c | 2
tools/testing/selftests/vm/.gitignore | 1
tools/testing/selftests/vm/Makefile | 2
tools/testing/selftests/vm/charge_reserved_hugetlb.sh | 575 +++++++++++
tools/testing/selftests/vm/gup_benchmark.c | 15
tools/testing/selftests/vm/hugetlb_reparenting_test.sh | 244 ++++
tools/testing/selftests/vm/map_hugetlb.c | 14
tools/testing/selftests/vm/mlock2-tests.c | 233 ----
tools/testing/selftests/vm/mremap_dontunmap.c | 313 ++++++
tools/testing/selftests/vm/run_vmtests | 37
tools/testing/selftests/vm/write_hugetlb_memory.sh | 23
tools/testing/selftests/vm/write_to_hugetlbfs.c | 242 ++++
165 files changed, 5020 insertions(+), 2376 deletions(-)
^ permalink raw reply [flat|nested] 232+ messages in thread
* incoming
@ 2020-04-07 3:02 Andrew Morton
0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2020-04-07 3:02 UTC (permalink / raw)
To: Linus Torvalds; +Cc: linux-mm, mm-commits
- a lot more of MM, quite a bit more yet to come.
- various other subsystems
166 patches based on 7e63420847ae5f1036e4f7c42f0b3282e73efbc2.
Subsystems affected by this patch series:
mm/memcg
mm/pagemap
mm/vmalloc
mm/pagealloc
mm/migration
mm/thp
mm/ksm
mm/madvise
mm/virtio
mm/userfaultfd
mm/memory-hotplug
mm/shmem
mm/rmap
mm/zswap
mm/zsmalloc
mm/cleanups
procfs
misc
MAINTAINERS
bitops
lib
checkpatch
epoll
binfmt
kallsyms
reiserfs
kmod
gcov
kconfig
kcov
ubsan
fault-injection
ipc
Subsystem: mm/memcg
Chris Down <chris@chrisdown.name>:
mm, memcg: bypass high reclaim iteration for cgroup hierarchy root
Subsystem: mm/pagemap
Li Xinhai <lixinhai.lxh@gmail.com>:
Patch series "mm: Fix misuse of parent anon_vma in dup_mmap path":
mm: don't prepare anon_vma if vma has VM_WIPEONFORK
Revert "mm/rmap.c: reuse mergeable anon_vma as parent when fork"
mm: set vm_next and vm_prev to NULL in vm_area_dup()
Anshuman Khandual <anshuman.khandual@arm.com>:
Patch series "mm/vma: Use all available wrappers when possible", v2:
mm/vma: add missing VMA flag readable name for VM_SYNC
mm/vma: make vma_is_accessible() available for general use
mm/vma: replace all remaining open encodings with is_vm_hugetlb_page()
mm/vma: replace all remaining open encodings with vma_is_anonymous()
mm/vma: append unlikely() while testing VMA access permissions
Subsystem: mm/vmalloc
Qiujun Huang <hqjagain@gmail.com>:
mm/vmalloc: fix a typo in comment
Subsystem: mm/pagealloc
Michal Hocko <mhocko@suse.com>:
mm: make it clear that gfp reclaim modifiers are valid only for sleepable allocations
Subsystem: mm/migration
Wei Yang <richardw.yang@linux.intel.com>:
Patch series "cleanup on do_pages_move()", v5:
mm/migrate.c: no need to check for i > start in do_pages_move()
mm/migrate.c: wrap do_move_pages_to_node() and store_status()
mm/migrate.c: check pagelist in move_pages_and_store_status()
mm/migrate.c: unify "not queued for migration" handling in do_pages_move()
Yang Shi <yang.shi@linux.alibaba.com>:
mm/migrate.c: migrate PG_readahead flag
Subsystem: mm/thp
David Rientjes <rientjes@google.com>:
mm, shmem: add vmstat for hugepage fallback
mm, thp: track fallbacks due to failed memcg charges separately
"Matthew Wilcox (Oracle)" <willy@infradead.org>:
include/linux/pagemap.h: optimise find_subpage for !THP
mm: remove CONFIG_TRANSPARENT_HUGE_PAGECACHE
Subsystem: mm/ksm
Li Chen <chenli@uniontech.com>:
mm/ksm.c: update get_user_pages() argument in comment
Subsystem: mm/madvise
Huang Ying <ying.huang@intel.com>:
mm: code cleanup for MADV_FREE
Subsystem: mm/virtio
Alexander Duyck <alexander.h.duyck@linux.intel.com>:
Patch series "mm / virtio: Provide support for free page reporting", v17:
mm: adjust shuffle code to allow for future coalescing
mm: use zone and order instead of free area in free_list manipulators
mm: add function __putback_isolated_page
mm: introduce Reported pages
virtio-balloon: pull page poisoning config out of free page hinting
virtio-balloon: add support for providing free page reports to host
mm/page_reporting: rotate reported pages to the tail of the list
mm/page_reporting: add budget limit on how many pages can be reported per pass
mm/page_reporting: add free page reporting documentation
David Hildenbrand <david@redhat.com>:
virtio-balloon: switch back to OOM handler for VIRTIO_BALLOON_F_DEFLATE_ON_OOM
Subsystem: mm/userfaultfd
Shaohua Li <shli@fb.com>:
Patch series "userfaultfd: write protection support", v6:
userfaultfd: wp: add helper for writeprotect check
Andrea Arcangeli <aarcange@redhat.com>:
userfaultfd: wp: hook userfault handler to write protection fault
userfaultfd: wp: add WP pagetable tracking to x86
userfaultfd: wp: userfaultfd_pte/huge_pmd_wp() helpers
userfaultfd: wp: add UFFDIO_COPY_MODE_WP
Peter Xu <peterx@redhat.com>:
mm: merge parameters for change_protection()
userfaultfd: wp: apply _PAGE_UFFD_WP bit
userfaultfd: wp: drop _PAGE_UFFD_WP properly when fork
userfaultfd: wp: add pmd_swp_*uffd_wp() helpers
userfaultfd: wp: support swap and page migration
khugepaged: skip collapse if uffd-wp detected
Shaohua Li <shli@fb.com>:
userfaultfd: wp: support write protection for userfault vma range
Andrea Arcangeli <aarcange@redhat.com>:
userfaultfd: wp: add the writeprotect API to userfaultfd ioctl
Shaohua Li <shli@fb.com>:
userfaultfd: wp: enabled write protection in userfaultfd API
Peter Xu <peterx@redhat.com>:
userfaultfd: wp: don't wake up when doing write protect
Martin Cracauer <cracauer@cons.org>:
userfaultfd: wp: UFFDIO_REGISTER_MODE_WP documentation update
Peter Xu <peterx@redhat.com>:
userfaultfd: wp: declare _UFFDIO_WRITEPROTECT conditionally
userfaultfd: selftests: refactor statistics
userfaultfd: selftests: add write-protect test
Subsystem: mm/memory-hotplug
David Hildenbrand <david@redhat.com>:
Patch series "mm: drop superfluous section checks when onlining/offlining":
drivers/base/memory.c: drop section_count
drivers/base/memory.c: drop pages_correctly_probed()
mm/page_ext.c: drop pfn_present() check when onlining
Baoquan He <bhe@redhat.com>:
mm/memory_hotplug.c: only respect mem= parameter during boot stage
David Hildenbrand <david@redhat.com>:
mm/memory_hotplug.c: simplify calculation of number of pages in __remove_pages()
mm/memory_hotplug.c: cleanup __add_pages()
Baoquan He <bhe@redhat.com>:
Patch series "mm/hotplug: Only use subsection map for VMEMMAP", v4:
mm/sparse.c: introduce new function fill_subsection_map()
mm/sparse.c: introduce a new function clear_subsection_map()
mm/sparse.c: only use subsection map in VMEMMAP case
mm/sparse.c: add note about only VMEMMAP supporting sub-section hotplug
mm/sparse.c: move subsection_map related functions together
David Hildenbrand <david@redhat.com>:
Patch series "mm/memory_hotplug: allow to specify a default online_type", v3:
drivers/base/memory: rename MMOP_ONLINE_KEEP to MMOP_ONLINE
drivers/base/memory: map MMOP_OFFLINE to 0
drivers/base/memory: store mapping between MMOP_* and string in an array
powernv/memtrace: always online added memory blocks
hv_balloon: don't check for memhp_auto_online manually
mm/memory_hotplug: unexport memhp_auto_online
mm/memory_hotplug: convert memhp_auto_online to store an online_type
mm/memory_hotplug: allow to specify a default online_type
chenqiwu <chenqiwu@xiaomi.com>:
mm/memory_hotplug.c: use __pfn_to_section() instead of open-coding
Subsystem: mm/shmem
Kees Cook <keescook@chromium.org>:
mm/shmem.c: distribute switch variables for initialization
Mateusz Nosek <mateusznosek0@gmail.com>:
mm/shmem.c: clean code by removing unnecessary assignment
Hugh Dickins <hughd@google.com>:
mm: huge tmpfs: try to split_huge_page() when punching hole
Subsystem: mm/rmap
Palmer Dabbelt <palmerdabbelt@google.com>:
mm: prevent a warning when casting void* -> enum
Subsystem: mm/zswap
"Maciej S. Szmigiero" <mail@maciej.szmigiero.name>:
mm/zswap: allow setting default status, compressor and allocator in Kconfig
Subsystem: mm/zsmalloc
Subsystem: mm/cleanups
Jules Irenge <jbi.octave@gmail.com>:
mm/compaction: add missing annotation for compact_lock_irqsave
mm/hugetlb: add missing annotation for gather_surplus_pages()
mm/mempolicy: add missing annotation for queue_pages_pmd()
mm/slub: add missing annotation for get_map()
mm/slub: add missing annotation for put_map()
mm/zsmalloc: add missing annotation for migrate_read_lock()
mm/zsmalloc: add missing annotation for migrate_read_unlock()
mm/zsmalloc: add missing annotation for pin_tag()
mm/zsmalloc: add missing annotation for unpin_tag()
chenqiwu <chenqiwu@xiaomi.com>:
mm: fix ambiguous comments for better code readability
Mateusz Nosek <mateusznosek0@gmail.com>:
mm/mm_init.c: clean code. Use BUILD_BUG_ON when comparing compile time constant
Joe Perches <joe@perches.com>:
mm: use fallthrough;
Steven Price <steven.price@arm.com>:
include/linux/swapops.h: correct guards for non_swap_entry()
Ira Weiny <ira.weiny@intel.com>:
include/linux/memremap.h: remove stale comments
Mateusz Nosek <mateusznosek0@gmail.com>:
mm/dmapool.c: micro-optimisation remove unnecessary branch
Waiman Long <longman@redhat.com>:
mm: remove dummy struct bootmem_data/bootmem_data_t
Subsystem: procfs
Jules Irenge <jbi.octave@gmail.com>:
fs/proc/inode.c: annotate close_pdeo() for sparse
Alexey Dobriyan <adobriyan@gmail.com>:
proc: faster open/read/close with "permanent" files
proc: speed up /proc/*/statm
"Matthew Wilcox (Oracle)" <willy@infradead.org>:
proc: inline vma_stop into m_stop
proc: remove m_cache_vma
proc: use ppos instead of m->version
seq_file: remove m->version
proc: inline m_next_vma into m_next
Subsystem: misc
Michal Simek <michal.simek@xilinx.com>:
asm-generic: fix unistd_32.h generation format
Nathan Chancellor <natechancellor@gmail.com>:
kernel/extable.c: use address-of operator on section symbols
Masahiro Yamada <masahiroy@kernel.org>:
sparc,x86: vdso: remove meaningless undefining CONFIG_OPTIMIZE_INLINING
compiler: remove CONFIG_OPTIMIZE_INLINING entirely
Vegard Nossum <vegard.nossum@oracle.com>:
compiler.h: fix error in BUILD_BUG_ON() reporting
Subsystem: MAINTAINERS
Joe Perches <joe@perches.com>:
MAINTAINERS: list the section entries in the preferred order
Subsystem: bitops
Josh Poimboeuf <jpoimboe@redhat.com>:
bitops: always inline sign extension helpers
Subsystem: lib
Konstantin Khlebnikov <khlebnikov@yandex-team.ru>:
lib/test_lockup: test module to generate lockups
Colin Ian King <colin.king@canonical.com>:
lib/test_lockup.c: fix spelling mistake "iteraions" -> "iterations"
Konstantin Khlebnikov <khlebnikov@yandex-team.ru>:
lib/test_lockup.c: add parameters for locking generic vfs locks
"Gustavo A. R. Silva" <gustavo@embeddedor.com>:
lib/bch.c: replace zero-length array with flexible-array member
lib/ts_bm.c: replace zero-length array with flexible-array member
lib/ts_fsm.c: replace zero-length array with flexible-array member
lib/ts_kmp.c: replace zero-length array with flexible-array member
Geert Uytterhoeven <geert+renesas@glider.be>:
lib/scatterlist: fix sg_copy_buffer() kerneldoc
Kees Cook <keescook@chromium.org>:
lib: test_stackinit.c: XFAIL switch variable init tests
Alexander Potapenko <glider@google.com>:
lib/stackdepot.c: check depot_index before accessing the stack slab
lib/stackdepot.c: fix a condition in stack_depot_fetch()
lib/stackdepot.c: build with -fno-builtin
kasan: stackdepot: move filter_irq_stacks() to stackdepot.c
Qian Cai <cai@lca.pw>:
percpu_counter: fix a data race at vm_committed_as
Andy Shevchenko <andriy.shevchenko@linux.intel.com>:
lib/test_bitmap.c: make use of EXP2_IN_BITS
chenqiwu <chenqiwu@xiaomi.com>:
lib/rbtree: fix coding style of assignments
Dan Carpenter <dan.carpenter@oracle.com>:
lib/test_kmod.c: remove a NULL test
Rikard Falkeborn <rikard.falkeborn@gmail.com>:
linux/bits.h: add compile time sanity check of GENMASK inputs
Chris Wilson <chris@chris-wilson.co.uk>:
lib/list: prevent compiler reloads inside 'safe' list iteration
Nathan Chancellor <natechancellor@gmail.com>:
lib/dynamic_debug.c: use address-of operator on section symbols
Subsystem: checkpatch
Joe Perches <joe@perches.com>:
checkpatch: remove email address comment from email address comparisons
Lubomir Rintel <lkundrak@v3.sk>:
checkpatch: check SPDX tags in YAML files
John Hubbard <jhubbard@nvidia.com>:
checkpatch: support "base-commit:" format
Joe Perches <joe@perches.com>:
checkpatch: prefer fallthrough; over fallthrough comments
Antonio Borneo <borneo.antonio@gmail.com>:
checkpatch: fix minor typo and mixed space+tab in indentation
checkpatch: fix multiple const * types
checkpatch: add command-line option for TAB size
Joe Perches <joe@perches.com>:
checkpatch: improve Gerrit Change-Id: test
Lubomir Rintel <lkundrak@v3.sk>:
checkpatch: check proper licensing of Devicetree bindings
Joe Perches <joe@perches.com>:
checkpatch: avoid warning about uninitialized_var()
Subsystem: epoll
Roman Penyaev <rpenyaev@suse.de>:
kselftest: introduce new epoll test case
Jason Baron <jbaron@akamai.com>:
fs/epoll: make nesting accounting safe for -rt kernel
Subsystem: binfmt
Alexey Dobriyan <adobriyan@gmail.com>:
fs/binfmt_elf.c: delete "loc" variable
fs/binfmt_elf.c: allocate less for static executable
fs/binfmt_elf.c: don't free interpreter's ELF pheaders on common path
Subsystem: kallsyms
Will Deacon <will@kernel.org>:
Patch series "Unexport kallsyms_lookup_name() and kallsyms_on_each_symbol()":
samples/hw_breakpoint: drop HW_BREAKPOINT_R when reporting writes
samples/hw_breakpoint: drop use of kallsyms_lookup_name()
kallsyms: unexport kallsyms_lookup_name() and kallsyms_on_each_symbol()
Subsystem: reiserfs
Colin Ian King <colin.king@canonical.com>:
reiserfs: clean up several indentation issues
Subsystem: kmod
Qiujun Huang <hqjagain@gmail.com>:
kernel/kmod.c: fix a typo "assuems" -> "assumes"
Subsystem: gcov
"Gustavo A. R. Silva" <gustavo@embeddedor.com>:
gcov: gcc_4_7: replace zero-length array with flexible-array member
gcov: gcc_3_4: replace zero-length array with flexible-array member
kernel/gcov/fs.c: replace zero-length array with flexible-array member
Subsystem: kconfig
Krzysztof Kozlowski <krzk@kernel.org>:
init/Kconfig: clean up ANON_INODES and old IO schedulers options
Subsystem: kcov
Andrey Konovalov <andreyknvl@google.com>:
Patch series "kcov: collect coverage from usb soft interrupts", v4:
kcov: cleanup debug messages
kcov: fix potential use-after-free in kcov_remote_start
kcov: move t->kcov assignments into kcov_start/stop
kcov: move t->kcov_sequence assignment
kcov: use t->kcov_mode as enabled indicator
kcov: collect coverage from interrupts
usb: core: kcov: collect coverage from usb complete callback
Subsystem: ubsan
Kees Cook <keescook@chromium.org>:
Patch series "ubsan: Split out bounds checker", v5:
ubsan: add trap instrumentation option
ubsan: split "bounds" checker from other options
drivers/misc/lkdtm/bugs.c: add arithmetic overflow and array bounds checks
ubsan: check panic_on_warn
kasan: unset panic_on_warn before calling panic()
ubsan: include bug type in report header
Subsystem: fault-injection
Qiujun Huang <hqjagain@gmail.com>:
lib/Kconfig.debug: fix a typo "capabilitiy" -> "capability"
Subsystem: ipc
Somala Swaraj <somalaswaraj@gmail.com>:
ipc/mqueue.c: fix a brace coding style issue
Jason Yan <yanaijie@huawei.com>:
ipc/shm.c: make compat_ksys_shmctl() static
Documentation/admin-guide/kernel-parameters.txt | 13
Documentation/admin-guide/mm/transhuge.rst | 14
Documentation/admin-guide/mm/userfaultfd.rst | 51
Documentation/dev-tools/kcov.rst | 17
Documentation/vm/free_page_reporting.rst | 41
Documentation/vm/zswap.rst | 20
MAINTAINERS | 35
arch/alpha/include/asm/mmzone.h | 2
arch/alpha/kernel/syscalls/syscallhdr.sh | 2
arch/csky/mm/fault.c | 4
arch/ia64/kernel/syscalls/syscallhdr.sh | 2
arch/ia64/kernel/vmlinux.lds.S | 2
arch/m68k/mm/fault.c | 4
arch/microblaze/kernel/syscalls/syscallhdr.sh | 2
arch/mips/kernel/syscalls/syscallhdr.sh | 3
arch/mips/mm/fault.c | 4
arch/nds32/kernel/vmlinux.lds.S | 1
arch/parisc/kernel/syscalls/syscallhdr.sh | 2
arch/powerpc/kernel/syscalls/syscallhdr.sh | 3
arch/powerpc/kvm/e500_mmu_host.c | 2
arch/powerpc/mm/fault.c | 2
arch/powerpc/platforms/powernv/memtrace.c | 14
arch/sh/kernel/syscalls/syscallhdr.sh | 2
arch/sh/mm/fault.c | 2
arch/sparc/kernel/syscalls/syscallhdr.sh | 2
arch/sparc/vdso/vdso32/vclock_gettime.c | 4
arch/x86/Kconfig | 1
arch/x86/configs/i386_defconfig | 1
arch/x86/configs/x86_64_defconfig | 1
arch/x86/entry/vdso/vdso32/vclock_gettime.c | 4
arch/x86/include/asm/pgtable.h | 67 +
arch/x86/include/asm/pgtable_64.h | 8
arch/x86/include/asm/pgtable_types.h | 12
arch/x86/mm/fault.c | 2
arch/xtensa/kernel/syscalls/syscallhdr.sh | 2
drivers/base/memory.c | 138 --
drivers/hv/hv_balloon.c | 25
drivers/misc/lkdtm/bugs.c | 75 +
drivers/misc/lkdtm/core.c | 3
drivers/misc/lkdtm/lkdtm.h | 3
drivers/usb/core/hcd.c | 3
drivers/virtio/Kconfig | 1
drivers/virtio/virtio_balloon.c | 190 ++-
fs/binfmt_elf.c | 56
fs/eventpoll.c | 64 -
fs/proc/array.c | 39
fs/proc/cpuinfo.c | 1
fs/proc/generic.c | 31
fs/proc/inode.c | 188 ++-
fs/proc/internal.h | 6
fs/proc/kmsg.c | 1
fs/proc/stat.c | 1
fs/proc/task_mmu.c | 97 -
fs/reiserfs/do_balan.c | 2
fs/reiserfs/ioctl.c | 11
fs/reiserfs/namei.c | 10
fs/seq_file.c | 28
fs/userfaultfd.c | 116 +
include/asm-generic/pgtable.h | 1
include/asm-generic/pgtable_uffd.h | 66 +
include/asm-generic/tlb.h | 3
include/linux/bitops.h | 4
include/linux/bits.h | 22
include/linux/compiler.h | 2
include/linux/compiler_types.h | 11
include/linux/gfp.h | 2
include/linux/huge_mm.h | 2
include/linux/list.h | 50
include/linux/memory.h | 1
include/linux/memory_hotplug.h | 13
include/linux/memremap.h | 2
include/linux/mm.h | 25
include/linux/mm_inline.h | 15
include/linux/mm_types.h | 4
include/linux/mmzone.h | 47
include/linux/page-flags.h | 16
include/linux/page_reporting.h | 26
include/linux/pagemap.h | 4
include/linux/percpu_counter.h | 4
include/linux/proc_fs.h | 17
include/linux/sched.h | 3
include/linux/seq_file.h | 1
include/linux/shmem_fs.h | 10
include/linux/stackdepot.h | 2
include/linux/swapops.h | 5
include/linux/userfaultfd_k.h | 42
include/linux/vm_event_item.h | 5
include/trace/events/huge_memory.h | 1
include/trace/events/mmflags.h | 1
include/trace/events/vmscan.h | 2
include/uapi/linux/userfaultfd.h | 40
include/uapi/linux/virtio_balloon.h | 1
init/Kconfig | 8
ipc/mqueue.c | 5
ipc/shm.c | 2
ipc/util.c | 1
kernel/configs/tiny.config | 1
kernel/events/core.c | 3
kernel/extable.c | 3
kernel/fork.c | 10
kernel/gcov/fs.c | 2
kernel/gcov/gcc_3_4.c | 6
kernel/gcov/gcc_4_7.c | 2
kernel/kallsyms.c | 2
kernel/kcov.c | 282 +++-
kernel/kmod.c | 2
kernel/module.c | 1
kernel/sched/fair.c | 2
lib/Kconfig.debug | 35
lib/Kconfig.ubsan | 51
lib/Makefile | 8
lib/bch.c | 2
lib/dynamic_debug.c | 2
lib/rbtree.c | 4
lib/scatterlist.c | 2
lib/stackdepot.c | 39
lib/test_bitmap.c | 2
lib/test_kmod.c | 2
lib/test_lockup.c | 601 +++++++++-
lib/test_stackinit.c | 28
lib/ts_bm.c | 2
lib/ts_fsm.c | 2
lib/ts_kmp.c | 2
lib/ubsan.c | 47
mm/Kconfig | 135 ++
mm/Makefile | 1
mm/compaction.c | 3
mm/dmapool.c | 4
mm/filemap.c | 14
mm/gup.c | 9
mm/huge_memory.c | 36
mm/hugetlb.c | 1
mm/hugetlb_cgroup.c | 6
mm/internal.h | 2
mm/kasan/common.c | 23
mm/kasan/report.c | 10
mm/khugepaged.c | 39
mm/ksm.c | 5
mm/list_lru.c | 2
mm/memcontrol.c | 5
mm/memory-failure.c | 2
mm/memory.c | 42
mm/memory_hotplug.c | 53
mm/mempolicy.c | 11
mm/migrate.c | 122 +-
mm/mm_init.c | 2
mm/mmap.c | 10
mm/mprotect.c | 76 -
mm/page_alloc.c | 174 ++
mm/page_ext.c | 5
mm/page_isolation.c | 6
mm/page_reporting.c | 384 ++++++
mm/page_reporting.h | 54
mm/rmap.c | 23
mm/shmem.c | 168 +-
mm/shuffle.c | 12
mm/shuffle.h | 6
mm/slab_common.c | 1
mm/slub.c | 3
mm/sparse.c | 236 ++-
mm/swap.c | 20
mm/swapfile.c | 1
mm/userfaultfd.c | 98 +
mm/vmalloc.c | 2
mm/vmscan.c | 12
mm/vmstat.c | 3
mm/zsmalloc.c | 10
mm/zswap.c | 24
samples/hw_breakpoint/data_breakpoint.c | 11
scripts/Makefile.ubsan | 16
scripts/checkpatch.pl | 155 +-
tools/lib/rbtree.c | 4
tools/testing/selftests/filesystems/epoll/epoll_wakeup_test.c | 67 +
tools/testing/selftests/vm/userfaultfd.c | 233 +++
174 files changed, 3990 insertions(+), 1399 deletions(-)
^ permalink raw reply [flat|nested] 232+ messages in thread
* incoming
@ 2020-04-10 21:30 Andrew Morton
0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2020-04-10 21:30 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm
Almost all of the rest of MM. Various other things.
35 patches, based on c0cc271173b2e1c2d8d0ceaef14e4dfa79eefc0d.
Subsystems affected by this patch series:
hfs
mm/memcg
mm/slab-generic
mm/slab
mm/pagealloc
mm/gup
ocfs2
mm/hugetlb
mm/pagemap
mm/memremap
kmod
misc
seqfile
Subsystem: hfs
Simon Gander <simon@tuxera.com>:
hfsplus: fix crash and filesystem corruption when deleting files
Subsystem: mm/memcg
Jakub Kicinski <kuba@kernel.org>:
mm, memcg: do not high throttle allocators based on wraparound
Subsystem: mm/slab-generic
Qiujun Huang <hqjagain@gmail.com>:
mm, slab_common: fix a typo in comment "eariler"->"earlier"
Subsystem: mm/slab
Mauro Carvalho Chehab <mchehab+huawei@kernel.org>:
docs: mm: slab.h: fix a broken cross-reference
Subsystem: mm/pagealloc
Randy Dunlap <rdunlap@infradead.org>:
mm/page_alloc.c: fix kernel-doc warning
Jason Yan <yanaijie@huawei.com>:
mm/page_alloc: make pcpu_drain_mutex and pcpu_drain static
Subsystem: mm/gup
Miles Chen <miles.chen@mediatek.com>:
mm/gup: fix null pointer dereference detected by coverity
Subsystem: ocfs2
Changwei Ge <chge@linux.alibaba.com>:
ocfs2: no need try to truncate file beyond i_size
Subsystem: mm/hugetlb
Aslan Bakirov <aslan@fb.com>:
mm: cma: NUMA node interface
Roman Gushchin <guro@fb.com>:
mm: hugetlb: optionally allocate gigantic hugepages using cma
Subsystem: mm/pagemap
Jaewon Kim <jaewon31.kim@samsung.com>:
mm/mmap.c: initialize align_offset explicitly for vm_unmapped_area
Arjun Roy <arjunroy@google.com>:
mm/memory.c: refactor insert_page to prepare for batched-lock insert
mm: bring sparc pte_index() semantics inline with other platforms
mm: define pte_index as macro for x86
mm/memory.c: add vm_insert_pages()
Anshuman Khandual <anshuman.khandual@arm.com>:
mm/vma: define a default value for VM_DATA_DEFAULT_FLAGS
mm/vma: introduce VM_ACCESS_FLAGS
mm/special: create generic fallbacks for pte_special() and pte_mkspecial()
Subsystem: mm/memremap
Logan Gunthorpe <logang@deltatee.com>:
Patch series "Allow setting caching mode in arch_add_memory() for P2PDMA", v4:
mm/memory_hotplug: drop the flags field from struct mhp_restrictions
mm/memory_hotplug: rename mhp_restrictions to mhp_params
x86/mm: thread pgprot_t through init_memory_mapping()
x86/mm: introduce __set_memory_prot()
powerpc/mm: thread pgprot_t through create_section_mapping()
mm/memory_hotplug: add pgprot_t to mhp_params
mm/memremap: set caching mode for PCI P2PDMA memory to WC
Subsystem: kmod
Eric Biggers <ebiggers@google.com>:
Patch series "module autoloading fixes and cleanups", v5:
kmod: make request_module() return an error when autoloading is disabled
fs/filesystems.c: downgrade user-reachable WARN_ONCE() to pr_warn_once()
docs: admin-guide: document the kernel.modprobe sysctl
selftests: kmod: fix handling test numbers above 9
selftests: kmod: test disabling module autoloading
Subsystem: misc
Pali Rohár <pali@kernel.org>:
change email address for Pali Rohár
kbuild test robot <lkp@intel.com>:
drivers/dma/tegra20-apb-dma.c: fix platform_get_irq.cocci warnings
Subsystem: seqfile
Vasily Averin <vvs@virtuozzo.com>:
Patch series "seq_file .next functions should increase position index":
fs/seq_file.c: seq_read(): add info message about buggy .next functions
kernel/gcov/fs.c: gcov_seq_next() should increase position index
ipc/util.c: sysvipc_find_ipc() should increase position index
Documentation/ABI/testing/sysfs-platform-dell-laptop | 8
Documentation/admin-guide/kernel-parameters.txt | 8
Documentation/admin-guide/sysctl/kernel.rst | 21 ++
MAINTAINERS | 16 -
arch/alpha/include/asm/page.h | 3
arch/alpha/include/asm/pgtable.h | 2
arch/arc/include/asm/page.h | 2
arch/arm/include/asm/page.h | 4
arch/arm/include/asm/pgtable-2level.h | 2
arch/arm/include/asm/pgtable.h | 15 -
arch/arm/mach-omap2/omap-secure.c | 2
arch/arm/mach-omap2/omap-secure.h | 2
arch/arm/mach-omap2/omap-smc.S | 2
arch/arm/mm/fault.c | 2
arch/arm/mm/mmu.c | 14 +
arch/arm64/include/asm/page.h | 4
arch/arm64/mm/fault.c | 2
arch/arm64/mm/init.c | 6
arch/arm64/mm/mmu.c | 7
arch/c6x/include/asm/page.h | 5
arch/csky/include/asm/page.h | 3
arch/csky/include/asm/pgtable.h | 3
arch/h8300/include/asm/page.h | 2
arch/hexagon/include/asm/page.h | 3
arch/hexagon/include/asm/pgtable.h | 2
arch/ia64/include/asm/page.h | 5
arch/ia64/include/asm/pgtable.h | 2
arch/ia64/mm/init.c | 7
arch/m68k/include/asm/mcf_pgtable.h | 10 -
arch/m68k/include/asm/motorola_pgtable.h | 2
arch/m68k/include/asm/page.h | 3
arch/m68k/include/asm/sun3_pgtable.h | 2
arch/microblaze/include/asm/page.h | 2
arch/microblaze/include/asm/pgtable.h | 4
arch/mips/include/asm/page.h | 5
arch/mips/include/asm/pgtable.h | 44 +++-
arch/nds32/include/asm/page.h | 3
arch/nds32/include/asm/pgtable.h | 9 -
arch/nds32/mm/fault.c | 2
arch/nios2/include/asm/page.h | 3
arch/nios2/include/asm/pgtable.h | 3
arch/openrisc/include/asm/page.h | 5
arch/openrisc/include/asm/pgtable.h | 2
arch/parisc/include/asm/page.h | 3
arch/parisc/include/asm/pgtable.h | 2
arch/powerpc/include/asm/book3s/64/hash.h | 3
arch/powerpc/include/asm/book3s/64/radix.h | 3
arch/powerpc/include/asm/page.h | 9 -
arch/powerpc/include/asm/page_64.h | 7
arch/powerpc/include/asm/sparsemem.h | 3
arch/powerpc/mm/book3s64/hash_utils.c | 5
arch/powerpc/mm/book3s64/pgtable.c | 7
arch/powerpc/mm/book3s64/pkeys.c | 2
arch/powerpc/mm/book3s64/radix_pgtable.c | 18 +-
arch/powerpc/mm/mem.c | 12 -
arch/riscv/include/asm/page.h | 3
arch/s390/include/asm/page.h | 3
arch/s390/mm/fault.c | 2
arch/s390/mm/init.c | 9 -
arch/sh/include/asm/page.h | 3
arch/sh/mm/init.c | 7
arch/sparc/include/asm/page_32.h | 3
arch/sparc/include/asm/page_64.h | 3
arch/sparc/include/asm/pgtable_32.h | 7
arch/sparc/include/asm/pgtable_64.h | 10 -
arch/um/include/asm/pgtable.h | 10 -
arch/unicore32/include/asm/page.h | 3
arch/unicore32/include/asm/pgtable.h | 3
arch/unicore32/mm/fault.c | 2
arch/x86/include/asm/page_types.h | 7
arch/x86/include/asm/pgtable.h | 6
arch/x86/include/asm/set_memory.h | 1
arch/x86/kernel/amd_gart_64.c | 3
arch/x86/kernel/setup.c | 4
arch/x86/mm/init.c | 9 -
arch/x86/mm/init_32.c | 19 +-
arch/x86/mm/init_64.c | 42 ++--
arch/x86/mm/mm_internal.h | 3
arch/x86/mm/pat/set_memory.c | 13 +
arch/x86/mm/pkeys.c | 2
arch/x86/platform/uv/bios_uv.c | 3
arch/x86/um/asm/vm-flags.h | 10 -
arch/xtensa/include/asm/page.h | 3
arch/xtensa/include/asm/pgtable.h | 3
drivers/char/hw_random/omap3-rom-rng.c | 4
drivers/dma/tegra20-apb-dma.c | 1
drivers/hwmon/dell-smm-hwmon.c | 4
drivers/platform/x86/dell-laptop.c | 4
drivers/platform/x86/dell-rbtn.c | 4
drivers/platform/x86/dell-rbtn.h | 2
drivers/platform/x86/dell-smbios-base.c | 4
drivers/platform/x86/dell-smbios-smm.c | 2
drivers/platform/x86/dell-smbios.h | 2
drivers/platform/x86/dell-smo8800.c | 2
drivers/platform/x86/dell-wmi.c | 4
drivers/power/supply/bq2415x_charger.c | 4
drivers/power/supply/bq27xxx_battery.c | 2
drivers/power/supply/isp1704_charger.c | 2
drivers/power/supply/rx51_battery.c | 4
drivers/staging/gasket/gasket_core.c | 2
fs/filesystems.c | 4
fs/hfsplus/attributes.c | 4
fs/ocfs2/alloc.c | 4
fs/seq_file.c | 7
fs/udf/ecma_167.h | 2
fs/udf/osta_udf.h | 2
include/linux/cma.h | 14 +
include/linux/hugetlb.h | 12 +
include/linux/memblock.h | 3
include/linux/memory_hotplug.h | 21 +-
include/linux/mm.h | 34 +++
include/linux/power/bq2415x_charger.h | 2
include/linux/slab.h | 2
ipc/util.c | 2
kernel/gcov/fs.c | 2
kernel/kmod.c | 4
mm/cma.c | 16 +
mm/gup.c | 3
mm/hugetlb.c | 109 ++++++++++++
mm/memblock.c | 2
mm/memcontrol.c | 3
mm/memory.c | 168 +++++++++++++++++--
mm/memory_hotplug.c | 13 -
mm/memremap.c | 17 +
mm/mmap.c | 4
mm/mprotect.c | 4
mm/page_alloc.c | 5
mm/slab_common.c | 2
tools/laptop/freefall/freefall.c | 2
tools/testing/selftests/kmod/kmod.sh | 43 ++++
130 files changed, 710 insertions(+), 370 deletions(-)
^ permalink raw reply [flat|nested] 232+ messages in thread
* incoming
@ 2020-04-12 7:41 Andrew Morton
0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2020-04-12 7:41 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm
A straggler. This patch caused a lot of build errors on a lot of
architectures for a long time, but Anshuman believes it's all fixed up
now.
1 patch, based on GIT b032227c62939b5481bcd45442b36dfa263f4a7c.
Anshuman Khandual <anshuman.khandual@arm.com>:
mm/debug: add tests validating architecture page table helpers
Documentation/features/debug/debug-vm-pgtable/arch-support.txt | 34
arch/arc/Kconfig | 1
arch/arm64/Kconfig | 1
arch/powerpc/Kconfig | 1
arch/s390/Kconfig | 1
arch/x86/Kconfig | 1
arch/x86/include/asm/pgtable_64.h | 6
include/linux/mmdebug.h | 5
init/main.c | 2
lib/Kconfig.debug | 26
mm/Makefile | 1
mm/debug_vm_pgtable.c | 392 ++++++++++
12 files changed, 471 insertions(+)
^ permalink raw reply [flat|nested] 232+ messages in thread
* incoming
@ 2020-04-21 1:13 Andrew Morton
0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2020-04-21 1:13 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm
15 fixes, based on ae83d0b416db002fe95601e7f97f64b59514d936:
Masahiro Yamada <masahiroy@kernel.org>:
sh: fix build error in mm/init.c
Kees Cook <keescook@chromium.org>:
slub: avoid redzone when choosing freepointer location
Peter Xu <peterx@redhat.com>:
mm/userfaultfd: disable userfaultfd-wp on x86_32
Bartosz Golaszewski <bgolaszewski@baylibre.com>:
MAINTAINERS: add an entry for kfifo
Longpeng <longpeng2@huawei.com>:
mm/hugetlb: fix a addressing exception caused by huge_pte_offset
Michal Hocko <mhocko@suse.com>:
mm, gup: return EINTR when gup is interrupted by fatal signals
Christophe JAILLET <christophe.jaillet@wanadoo.fr>:
checkpatch: fix a typo in the regex for $allocFunctions
George Burgess IV <gbiv@google.com>:
tools/build: tweak unused value workaround
Muchun Song <songmuchun@bytedance.com>:
mm/ksm: fix NULL pointer dereference when KSM zero page is enabled
Hugh Dickins <hughd@google.com>:
mm/shmem: fix build without THP
Jann Horn <jannh@google.com>:
vmalloc: fix remap_vmalloc_range() bounds checks
Hugh Dickins <hughd@google.com>:
shmem: fix possible deadlocks on shmlock_user_lock
Yang Shi <yang.shi@linux.alibaba.com>:
mm: shmem: disable interrupt when acquiring info->lock in userfaultfd_copy path
Sudip Mukherjee <sudipm.mukherjee@gmail.com>:
coredump: fix null pointer dereference on coredump
Lucas Stach <l.stach@pengutronix.de>:
tools/vm: fix cross-compile build
MAINTAINERS | 7 +++++++
arch/sh/mm/init.c | 2 +-
arch/x86/Kconfig | 2 +-
fs/coredump.c | 2 ++
fs/proc/vmcore.c | 5 +++--
include/linux/vmalloc.h | 2 +-
mm/gup.c | 2 +-
mm/hugetlb.c | 14 ++++++++------
mm/ksm.c | 12 ++++++++++--
mm/shmem.c | 13 ++++++++-----
mm/slub.c | 12 ++++++++++--
mm/vmalloc.c | 16 +++++++++++++---
samples/vfio-mdev/mdpy.c | 2 +-
scripts/checkpatch.pl | 2 +-
tools/build/feature/test-sync-compare-and-swap.c | 2 +-
tools/vm/Makefile | 2 ++
16 files changed, 70 insertions(+), 27 deletions(-)
^ permalink raw reply [flat|nested] 232+ messages in thread
* incoming
@ 2020-05-08 1:35 Andrew Morton
0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2020-05-08 1:35 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm
14 fixes and one selftest to verify the ipc fixes herein.
15 patches, based on a811c1fa0a02c062555b54651065899437bacdbe:
Oleg Nesterov <oleg@redhat.com>:
ipc/mqueue.c: change __do_notify() to bypass check_kill_permission()
Yafang Shao <laoar.shao@gmail.com>:
mm, memcg: fix error return value of mem_cgroup_css_alloc()
David Hildenbrand <david@redhat.com>:
mm/page_alloc: fix watchdog soft lockups during set_zone_contiguous()
Maciej Grochowski <maciej.grochowski@pm.me>:
kernel/kcov.c: fix typos in kcov_remote_start documentation
Ivan Delalande <colona@arista.com>:
scripts/decodecode: fix trapping instruction formatting
Janakarajan Natarajan <Janakarajan.Natarajan@amd.com>:
arch/x86/kvm/svm/sev.c: change flag passed to GUP fast in sev_pin_memory()
Khazhismel Kumykov <khazhy@google.com>:
eventpoll: fix missing wakeup for ovflist in ep_poll_callback
Aymeric Agon-Rambosson <aymeric.agon@yandex.com>:
scripts/gdb: repair rb_first() and rb_last()
Waiman Long <longman@redhat.com>:
mm/slub: fix incorrect interpretation of s->offset
Filipe Manana <fdmanana@suse.com>:
percpu: make pcpu_alloc() aware of current gfp context
Roman Penyaev <rpenyaev@suse.de>:
kselftests: introduce new epoll60 testcase for catching lost wakeups
epoll: atomically remove wait entry on wake up
Qiwu Chen <qiwuchen55@gmail.com>:
mm/vmscan: remove unnecessary argument description of isolate_lru_pages()
Kees Cook <keescook@chromium.org>:
ubsan: disable UBSAN_ALIGNMENT under COMPILE_TEST
Henry Willard <henry.willard@oracle.com>:
mm: limit boost_watermark on small zones
arch/x86/kvm/svm/sev.c | 2
fs/eventpoll.c | 61 ++--
ipc/mqueue.c | 34 +-
kernel/kcov.c | 4
lib/Kconfig.ubsan | 15 -
mm/memcontrol.c | 15 -
mm/page_alloc.c | 9
mm/percpu.c | 14
mm/slub.c | 45 ++-
mm/vmscan.c | 1
scripts/decodecode | 2
scripts/gdb/linux/rbtree.py | 4
tools/testing/selftests/filesystems/epoll/epoll_wakeup_test.c | 146 ++++++++++
tools/testing/selftests/wireguard/qemu/debug.config | 1
14 files changed, 275 insertions(+), 78 deletions(-)
^ permalink raw reply [flat|nested] 232+ messages in thread
* incoming
@ 2020-05-14 0:50 Andrew Morton
0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2020-05-14 0:50 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm
7 fixes, based on 24085f70a6e1b0cb647ec92623284641d8270637:
Yafang Shao <laoar.shao@gmail.com>:
mm, memcg: fix inconsistent oom event behavior
Roman Penyaev <rpenyaev@suse.de>:
epoll: call final ep_events_available() check under the lock
Peter Xu <peterx@redhat.com>:
mm/gup: fix fixup_user_fault() on multiple retries
Brian Geffon <bgeffon@google.com>:
userfaultfd: fix remap event with MREMAP_DONTUNMAP
Vasily Averin <vvs@virtuozzo.com>:
ipc/util.c: sysvipc_find_ipc() incorrectly updates position index
Andrey Konovalov <andreyknvl@google.com>:
kasan: consistently disable debugging features
kasan: add missing functions declarations to kasan.h
fs/eventpoll.c | 48 ++++++++++++++++++++++++++-------------------
include/linux/memcontrol.h | 2 +
ipc/util.c | 12 +++++------
mm/gup.c | 12 ++++++-----
mm/kasan/Makefile | 15 +++++++++-----
mm/kasan/kasan.h | 34 ++++++++++++++++++++++++++++++-
mm/mremap.c | 2 -
7 files changed, 86 insertions(+), 39 deletions(-)
^ permalink raw reply [flat|nested] 232+ messages in thread
* incoming
@ 2020-05-28 5:20 Andrew Morton
[not found] ` <CAHk-=whQSWcE1WvKxptHdyc9BUXQyxxyAH954=Jb_YSBrNJYDQ@mail.gmail.com>
0 siblings, 1 reply; 232+ messages in thread
From: Andrew Morton @ 2020-05-28 5:20 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm
5 fixes, based on 444fc5cde64330661bf59944c43844e7d4c2ccd8:
Qian Cai <cai@lca.pw>:
mm/z3fold: silence kmemleak false positives of slots
Hugh Dickins <hughd@google.com>:
mm,thp: stop leaking unreleased file pages
Konstantin Khlebnikov <khlebnikov@yandex-team.ru>:
mm: remove VM_BUG_ON(PageSlab()) from page_mapcount()
Alexander Potapenko <glider@google.com>:
fs/binfmt_elf.c: allocate initialized memory in fill_thread_core_info()
Arnd Bergmann <arnd@arndb.de>:
include/asm-generic/topology.h: guard cpumask_of_node() macro argument
fs/binfmt_elf.c | 2 +-
include/asm-generic/topology.h | 2 +-
include/linux/mm.h | 19 +++++++++++++++----
mm/khugepaged.c | 1 +
mm/z3fold.c | 3 +++
5 files changed, 21 insertions(+), 6 deletions(-)
^ permalink raw reply [flat|nested] 232+ messages in thread
* Re: incoming
[not found] ` <CAHk-=whQSWcE1WvKxptHdyc9BUXQyxxyAH954=Jb_YSBrNJYDQ@mail.gmail.com>
@ 2020-05-29 20:31 ` Andrew Morton
[not found] ` <CAHk-=wiU-vQVURz62dzitbh2Pk+m_+ipaJU6=z=ES3cd_wKSLQ@mail.gmail.com>
0 siblings, 1 reply; 232+ messages in thread
From: Andrew Morton @ 2020-05-29 20:31 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, Linux-MM
On Thu, 28 May 2020 13:10:18 -0700 Linus Torvalds <torvalds@linux-foundation.org> wrote:
> Hmm..
>
> On Wed, May 27, 2020 at 10:20 PM Andrew Morton
> <akpm@linux-foundation.org> wrote:
> >
> > fs/binfmt_elf.c | 2 +-
> > include/asm-generic/topology.h | 2 +-
> > include/linux/mm.h | 19 +++++++++++++++----
> > mm/khugepaged.c | 1 +
> > mm/z3fold.c | 3 +++
> > 5 files changed, 21 insertions(+), 6 deletions(-)
>
> I wonder how you generate that diffstat.
>
> The change to <linux/mm.h> simply doesn't match what you sent me. The
> patch you sent me that changed mm.h had this:
>
> include/linux/mm.h | 15 +++++++++++++--
> 1 file changed, 13 insertions(+), 2 deletions(-)
>
> (note 15 lines changed: it's +13 and -2) but now suddenly in your
> overall diffstat you have that
>
> include/linux/mm.h | 19 +++++++++++++++----
>
> with +15/-4.
>
> So your diffstat simply doesn't match what you are sending. What's going on?
>
Bah. I got lazy (didn't want to interrupt an ongoing build) so I
generated the diffstat prior to folding two patches into a single one.
Evidently diffstat isn't as smart as I had assumed!
^ permalink raw reply [flat|nested] 232+ messages in thread
* Re: incoming
[not found] ` <CAHk-=wiU-vQVURz62dzitbh2Pk+m_+ipaJU6=z=ES3cd_wKSLQ@mail.gmail.com>
@ 2020-05-29 21:12 ` Andrew Morton
0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2020-05-29 21:12 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, Linux-MM
On Fri, 29 May 2020 13:38:35 -0700 Linus Torvalds <torvalds@linux-foundation.org> wrote:
> On Fri, May 29, 2020 at 1:31 PM Andrew Morton <akpm@linux-foundation.org> wrote:
> >
> > Bah. I got lazy (didn't want to interrupt an ongoing build) so I
> > generated the diffstat prior to folding two patches into a single one.
> > Evidently diffstat isn't as smart as I had assumed!
>
> Ahh. Yes - given two patches, diffstat just adds up the line number
> counts for the individual diffs, it doesn't count some kind of
> "combined diff result" line counts.
Stupid diffstat. Means that basically all my diffstats are very wrong.
Thanks for spotting it.
I can fix that...
^ permalink raw reply [flat|nested] 232+ messages in thread
* incoming
@ 2020-06-02 4:44 Andrew Morton
2020-06-02 20:08 ` incoming Andrew Morton
0 siblings, 1 reply; 232+ messages in thread
From: Andrew Morton @ 2020-06-02 4:44 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm
A few little subsystems and a start of a lot of MM patches.
128 patches, based on 9bf9511e3d9f328c03f6f79bfb741c3d18f2f2c0:
Subsystems affected by this patch series:
squashfs
ocfs2
parisc
vfs
mm/slab-generic
mm/slub
mm/debug
mm/pagecache
mm/gup
mm/swap
mm/memcg
mm/pagemap
mm/memory-failure
mm/vmalloc
mm/kasan
Subsystem: squashfs
Philippe Liard <pliard@google.com>:
squashfs: migrate from ll_rw_block usage to BIO
Subsystem: ocfs2
Jules Irenge <jbi.octave@gmail.com>:
ocfs2: add missing annotation for dlm_empty_lockres()
Gang He <ghe@suse.com>:
ocfs2: mount shared volume without ha stack
Subsystem: parisc
Andrew Morton <akpm@linux-foundation.org>:
arch/parisc/include/asm/pgtable.h: remove unused `old_pte'
Subsystem: vfs
Jeff Layton <jlayton@redhat.com>:
Patch series "vfs: have syncfs() return error when there are writeback:
vfs: track per-sb writeback errors and report them to syncfs
fs/buffer.c: record blockdev write errors in super_block that it backs
Subsystem: mm/slab-generic
Vlastimil Babka <vbabka@suse.cz>:
usercopy: mark dma-kmalloc caches as usercopy caches
Subsystem: mm/slub
Dongli Zhang <dongli.zhang@oracle.com>:
mm/slub.c: fix corrupted freechain in deactivate_slab()
Christoph Lameter <cl@linux.com>:
slub: Remove userspace notifier for cache add/remove
Christopher Lameter <cl@linux.com>:
slub: remove kmalloc under list_lock from list_slab_objects() V2
Qian Cai <cai@lca.pw>:
mm/slub: fix stack overruns with SLUB_STATS
Andrew Morton <akpm@linux-foundation.org>:
Documentation/vm/slub.rst: s/Toggle/Enable/
Subsystem: mm/debug
Vlastimil Babka <vbabka@suse.cz>:
mm, dump_page(): do not crash with invalid mapping pointer
Subsystem: mm/pagecache
"Matthew Wilcox (Oracle)" <willy@infradead.org>:
Patch series "Change readahead API", v11:
mm: move readahead prototypes from mm.h
mm: return void from various readahead functions
mm: ignore return value of ->readpages
mm: move readahead nr_pages check into read_pages
mm: add new readahead_control API
mm: use readahead_control to pass arguments
mm: rename various 'offset' parameters to 'index'
mm: rename readahead loop variable to 'i'
mm: remove 'page_offset' from readahead loop
mm: put readahead pages in cache earlier
mm: add readahead address space operation
mm: move end_index check out of readahead loop
mm: add page_cache_readahead_unbounded
mm: document why we don't set PageReadahead
mm: use memalloc_nofs_save in readahead path
fs: convert mpage_readpages to mpage_readahead
btrfs: convert from readpages to readahead
erofs: convert uncompressed files from readpages to readahead
erofs: convert compressed files from readpages to readahead
ext4: convert from readpages to readahead
ext4: pass the inode to ext4_mpage_readpages
f2fs: convert from readpages to readahead
f2fs: pass the inode to f2fs_mpage_readpages
fuse: convert from readpages to readahead
iomap: convert from readpages to readahead
Guoqing Jiang <guoqing.jiang@cloud.ionos.com>:
Patch series "Introduce attach/detach_page_private to cleanup code":
include/linux/pagemap.h: introduce attach/detach_page_private
md: remove __clear_page_buffers and use attach/detach_page_private
btrfs: use attach/detach_page_private
fs/buffer.c: use attach/detach_page_private
f2fs: use attach/detach_page_private
iomap: use attach/detach_page_private
ntfs: replace attach_page_buffers with attach_page_private
orangefs: use attach/detach_page_private
buffer_head.h: remove attach_page_buffers
mm/migrate.c: call detach_page_private to cleanup code
mm_types.h: change set_page_private to inline function
"Matthew Wilcox (Oracle)" <willy@infradead.org>:
mm/filemap.c: remove misleading comment
Chao Yu <yuchao0@huawei.com>:
mm/page-writeback.c: remove unused variable
NeilBrown <neilb@suse.de>:
mm/writeback: replace PF_LESS_THROTTLE with PF_LOCAL_THROTTLE
mm/writeback: discard NR_UNSTABLE_NFS, use NR_WRITEBACK instead
Subsystem: mm/gup
Souptick Joarder <jrdr.linux@gmail.com>:
mm/gup.c: update the documentation
John Hubbard <jhubbard@nvidia.com>:
mm/gup: introduce pin_user_pages_unlocked
ivtv: convert get_user_pages() --> pin_user_pages()
Miles Chen <miles.chen@mediatek.com>:
mm/gup.c: further document vma_permits_fault()
Subsystem: mm/swap
chenqiwu <chenqiwu@xiaomi.com>:
mm/swapfile: use list_{prev,next}_entry() instead of open-coding
Qian Cai <cai@lca.pw>:
mm/swap_state: fix a data race in swapin_nr_pages
Andrea Righi <andrea.righi@canonical.com>:
mm: swap: properly update readahead statistics in unuse_pte_range()
Wei Yang <richard.weiyang@gmail.com>:
mm/swapfile.c: offset is only used when there is more slots
mm/swapfile.c: explicitly show ssd/non-ssd is handled mutually exclusive
mm/swapfile.c: remove the unnecessary goto for SSD case
mm/swapfile.c: simplify the calculation of n_goal
mm/swapfile.c: remove the extra check in scan_swap_map_slots()
mm/swapfile.c: found_free could be represented by (tmp < max)
mm/swapfile.c: tmp is always smaller than max
mm/swapfile.c: omit a duplicate code by compare tmp and max first
Huang Ying <ying.huang@intel.com>:
swap: try to scan more free slots even when fragmented
Wei Yang <richard.weiyang@gmail.com>:
mm/swapfile.c: classify SWAP_MAP_XXX to make it more readable
mm/swapfile.c: __swap_entry_free() always free 1 entry
Huang Ying <ying.huang@intel.com>:
mm/swapfile.c: use prandom_u32_max()
swap: reduce lock contention on swap cache from swap slots allocation
Randy Dunlap <rdunlap@infradead.org>:
mm: swapfile: fix /proc/swaps heading and Size/Used/Priority alignment
Miaohe Lin <linmiaohe@huawei.com>:
include/linux/swap.h: delete meaningless __add_to_swap_cache() declaration
Subsystem: mm/memcg
Yafang Shao <laoar.shao@gmail.com>:
mm, memcg: add workingset_restore in memory.stat
Kaixu Xia <kaixuxia@tencent.com>:
mm: memcontrol: simplify value comparison between count and limit
Shakeel Butt <shakeelb@google.com>:
memcg: expose root cgroup's memory.stat
Jakub Kicinski <kuba@kernel.org>:
Patch series "memcg: Slow down swap allocation as the available space gets:
mm/memcg: prepare for swap over-high accounting and penalty calculation
mm/memcg: move penalty delay clamping out of calculate_high_delay()
mm/memcg: move cgroup high memory limit setting into struct page_counter
mm/memcg: automatically penalize tasks with high swap use
Zefan Li <lizefan@huawei.com>:
memcg: fix memcg_kmem_bypass() for remote memcg charging
Subsystem: mm/pagemap
Steven Price <steven.price@arm.com>:
Patch series "Fix W+X debug feature on x86":
x86: mm: ptdump: calculate effective permissions correctly
mm: ptdump: expand type of 'val' in note_page()
Huang Ying <ying.huang@intel.com>:
/proc/PID/smaps: Add PMD migration entry parsing
chenqiwu <chenqiwu@xiaomi.com>:
mm/memory: remove unnecessary pte_devmap case in copy_one_pte()
Subsystem: mm/memory-failure
Wetp Zhang <wetp.zy@linux.alibaba.com>:
mm, memory_failure: don't send BUS_MCEERR_AO for action required error
Subsystem: mm/vmalloc
Christoph Hellwig <hch@lst.de>:
Patch series "decruft the vmalloc API", v2:
x86/hyperv: use vmalloc_exec for the hypercall page
x86: fix vmap arguments in map_irq_stack
staging: android: ion: use vmap instead of vm_map_ram
staging: media: ipu3: use vmap instead of reimplementing it
dma-mapping: use vmap insted of reimplementing it
powerpc: add an ioremap_phb helper
powerpc: remove __ioremap_at and __iounmap_at
mm: remove __get_vm_area
mm: unexport unmap_kernel_range_noflush
mm: rename CONFIG_PGTABLE_MAPPING to CONFIG_ZSMALLOC_PGTABLE_MAPPING
mm: only allow page table mappings for built-in zsmalloc
mm: pass addr as unsigned long to vb_free
mm: remove vmap_page_range_noflush and vunmap_page_range
mm: rename vmap_page_range to map_kernel_range
mm: don't return the number of pages from map_kernel_range{,_noflush}
mm: remove map_vm_range
mm: remove unmap_vmap_area
mm: remove the prot argument from vm_map_ram
mm: enforce that vmap can't map pages executable
gpu/drm: remove the powerpc hack in drm_legacy_sg_alloc
mm: remove the pgprot argument to __vmalloc
mm: remove the prot argument to __vmalloc_node
mm: remove both instances of __vmalloc_node_flags
mm: remove __vmalloc_node_flags_caller
mm: switch the test_vmalloc module to use __vmalloc_node
mm: remove vmalloc_user_node_flags
arm64: use __vmalloc_node in arch_alloc_vmap_stack
powerpc: use __vmalloc_node in alloc_vm_stack
s390: use __vmalloc_node in stack_alloc
Joerg Roedel <jroedel@suse.de>:
Patch series "mm: Get rid of vmalloc_sync_(un)mappings()", v3:
mm: add functions to track page directory modifications
mm/vmalloc: track which page-table levels were modified
mm/ioremap: track which page-table levels were modified
x86/mm/64: implement arch_sync_kernel_mappings()
x86/mm/32: implement arch_sync_kernel_mappings()
mm: remove vmalloc_sync_(un)mappings()
x86/mm: remove vmalloc faulting
Subsystem: mm/kasan
Andrey Konovalov <andreyknvl@google.com>:
kasan: fix clang compilation warning due to stack protector
Kees Cook <keescook@chromium.org>:
ubsan: entirely disable alignment checks under UBSAN_TRAP
Jing Xia <jing.xia@unisoc.com>:
mm/mm_init.c: report kasan-tag information stored in page->flags
Andrey Konovalov <andreyknvl@google.com>:
kasan: move kasan_report() into report.c
Documentation/admin-guide/cgroup-v2.rst | 24 +
Documentation/core-api/cachetlb.rst | 2
Documentation/filesystems/locking.rst | 6
Documentation/filesystems/proc.rst | 4
Documentation/filesystems/vfs.rst | 15
Documentation/vm/slub.rst | 2
arch/arm/configs/omap2plus_defconfig | 2
arch/arm64/include/asm/pgtable.h | 3
arch/arm64/include/asm/vmap_stack.h | 6
arch/arm64/mm/dump.c | 2
arch/parisc/include/asm/pgtable.h | 2
arch/powerpc/include/asm/io.h | 10
arch/powerpc/include/asm/pci-bridge.h | 2
arch/powerpc/kernel/irq.c | 5
arch/powerpc/kernel/isa-bridge.c | 28 +
arch/powerpc/kernel/pci_64.c | 56 +-
arch/powerpc/mm/ioremap_64.c | 50 --
arch/riscv/include/asm/pgtable.h | 4
arch/riscv/mm/ptdump.c | 2
arch/s390/kernel/setup.c | 9
arch/sh/kernel/cpu/sh4/sq.c | 3
arch/x86/hyperv/hv_init.c | 5
arch/x86/include/asm/kvm_host.h | 3
arch/x86/include/asm/pgtable-2level_types.h | 2
arch/x86/include/asm/pgtable-3level_types.h | 2
arch/x86/include/asm/pgtable_64_types.h | 2
arch/x86/include/asm/pgtable_types.h | 8
arch/x86/include/asm/switch_to.h | 23 -
arch/x86/kernel/irq_64.c | 2
arch/x86/kernel/setup_percpu.c | 6
arch/x86/kvm/svm/sev.c | 3
arch/x86/mm/dump_pagetables.c | 35 +
arch/x86/mm/fault.c | 196 ----------
arch/x86/mm/init_64.c | 5
arch/x86/mm/pti.c | 8
arch/x86/mm/tlb.c | 37 -
block/blk-core.c | 1
drivers/acpi/apei/ghes.c | 6
drivers/base/node.c | 2
drivers/block/drbd/drbd_bitmap.c | 4
drivers/block/loop.c | 2
drivers/dax/device.c | 1
drivers/gpu/drm/drm_scatter.c | 11
drivers/gpu/drm/etnaviv/etnaviv_dump.c | 4
drivers/gpu/drm/i915/gem/selftests/mock_dmabuf.c | 2
drivers/lightnvm/pblk-init.c | 5
drivers/md/dm-bufio.c | 4
drivers/md/md-bitmap.c | 12
drivers/media/common/videobuf2/videobuf2-dma-sg.c | 3
drivers/media/common/videobuf2/videobuf2-vmalloc.c | 3
drivers/media/pci/ivtv/ivtv-udma.c | 19 -
drivers/media/pci/ivtv/ivtv-yuv.c | 17
drivers/media/pci/ivtv/ivtvfb.c | 4
drivers/mtd/ubi/io.c | 4
drivers/pcmcia/electra_cf.c | 45 --
drivers/scsi/sd_zbc.c | 3
drivers/staging/android/ion/ion_heap.c | 4
drivers/staging/media/ipu3/ipu3-css-pool.h | 4
drivers/staging/media/ipu3/ipu3-dmamap.c | 30 -
fs/block_dev.c | 7
fs/btrfs/disk-io.c | 4
fs/btrfs/extent_io.c | 64 ---
fs/btrfs/extent_io.h | 3
fs/btrfs/inode.c | 39 --
fs/buffer.c | 23 -
fs/erofs/data.c | 41 --
fs/erofs/decompressor.c | 2
fs/erofs/zdata.c | 31 -
fs/exfat/inode.c | 7
fs/ext2/inode.c | 10
fs/ext4/ext4.h | 5
fs/ext4/inode.c | 25 -
fs/ext4/readpage.c | 25 -
fs/ext4/verity.c | 35 -
fs/f2fs/data.c | 56 +-
fs/f2fs/f2fs.h | 14
fs/f2fs/verity.c | 35 -
fs/fat/inode.c | 7
fs/file_table.c | 1
fs/fs-writeback.c | 1
fs/fuse/file.c | 100 +----
fs/gfs2/aops.c | 23 -
fs/gfs2/dir.c | 9
fs/gfs2/quota.c | 2
fs/hpfs/file.c | 7
fs/iomap/buffered-io.c | 113 +----
fs/iomap/trace.h | 2
fs/isofs/inode.c | 7
fs/jfs/inode.c | 7
fs/mpage.c | 38 --
fs/nfs/blocklayout/extent_tree.c | 2
fs/nfs/internal.h | 10
fs/nfs/write.c | 4
fs/nfsd/vfs.c | 9
fs/nilfs2/inode.c | 15
fs/ntfs/aops.c | 2
fs/ntfs/malloc.h | 2
fs/ntfs/mft.c | 2
fs/ocfs2/aops.c | 34 -
fs/ocfs2/dlm/dlmmaster.c | 1
fs/ocfs2/ocfs2.h | 4
fs/ocfs2/slot_map.c | 46 +-
fs/ocfs2/super.c | 21 +
fs/omfs/file.c | 7
fs/open.c | 3
fs/orangefs/inode.c | 32 -
fs/proc/meminfo.c | 3
fs/proc/task_mmu.c | 16
fs/qnx6/inode.c | 7
fs/reiserfs/inode.c | 8
fs/squashfs/block.c | 273 +++++++-------
fs/squashfs/decompressor.h | 5
fs/squashfs/decompressor_multi.c | 9
fs/squashfs/decompressor_multi_percpu.c | 17
fs/squashfs/decompressor_single.c | 9
fs/squashfs/lz4_wrapper.c | 17
fs/squashfs/lzo_wrapper.c | 17
fs/squashfs/squashfs.h | 4
fs/squashfs/xz_wrapper.c | 51 +-
fs/squashfs/zlib_wrapper.c | 63 +--
fs/squashfs/zstd_wrapper.c | 62 +--
fs/sync.c | 6
fs/ubifs/debug.c | 2
fs/ubifs/lprops.c | 2
fs/ubifs/lpt_commit.c | 4
fs/ubifs/orphan.c | 2
fs/udf/inode.c | 7
fs/xfs/kmem.c | 2
fs/xfs/xfs_aops.c | 13
fs/xfs/xfs_buf.c | 2
fs/zonefs/super.c | 7
include/asm-generic/5level-fixup.h | 5
include/asm-generic/pgtable.h | 27 +
include/linux/buffer_head.h | 8
include/linux/fs.h | 18
include/linux/iomap.h | 3
include/linux/memcontrol.h | 4
include/linux/mm.h | 67 ++-
include/linux/mm_types.h | 6
include/linux/mmzone.h | 1
include/linux/mpage.h | 4
include/linux/page_counter.h | 8
include/linux/pagemap.h | 193 ++++++++++
include/linux/ptdump.h | 3
include/linux/sched.h | 3
include/linux/swap.h | 17
include/linux/vmalloc.h | 49 +-
include/linux/zsmalloc.h | 2
include/trace/events/erofs.h | 6
include/trace/events/f2fs.h | 6
include/trace/events/writeback.h | 5
kernel/bpf/core.c | 6
kernel/bpf/syscall.c | 29 -
kernel/dma/remap.c | 48 --
kernel/groups.c | 2
kernel/module.c | 3
kernel/notifier.c | 1
kernel/sys.c | 2
kernel/trace/trace.c | 12
lib/Kconfig.ubsan | 2
lib/ioremap.c | 46 +-
lib/test_vmalloc.c | 26 -
mm/Kconfig | 4
mm/debug.c | 56 ++
mm/fadvise.c | 6
mm/filemap.c | 1
mm/gup.c | 77 +++-
mm/internal.h | 14
mm/kasan/Makefile | 21 -
mm/kasan/common.c | 19 -
mm/kasan/report.c | 22 +
mm/memcontrol.c | 198 +++++++---
mm/memory-failure.c | 15
mm/memory.c | 2
mm/migrate.c | 9
mm/mm_init.c | 16
mm/nommu.c | 52 +-
mm/page-writeback.c | 62 ++-
mm/page_alloc.c | 7
mm/percpu.c | 2
mm/ptdump.c | 17
mm/readahead.c | 349 ++++++++++--------
mm/slab_common.c | 3
mm/slub.c | 67 ++-
mm/swap_state.c | 5
mm/swapfile.c | 194 ++++++----
mm/util.c | 2
mm/vmalloc.c | 399 ++++++++-------------
mm/vmscan.c | 4
mm/vmstat.c | 11
mm/zsmalloc.c | 12
net/bridge/netfilter/ebtables.c | 6
net/ceph/ceph_common.c | 3
sound/core/memalloc.c | 2
sound/core/pcm_memory.c | 2
195 files changed, 2292 insertions(+), 2288 deletions(-)
^ permalink raw reply [flat|nested] 232+ messages in thread
* Re: incoming
2020-06-02 4:44 incoming Andrew Morton
@ 2020-06-02 20:08 ` Andrew Morton
[not found] ` <CAHk-=wgRV=SaiMn3L5u5mG0WfvB2VfEQadtudzDV3KRz5HnFrQ@mail.gmail.com>
0 siblings, 1 reply; 232+ messages in thread
From: Andrew Morton @ 2020-06-02 20:08 UTC (permalink / raw)
To: Linus Torvalds, mm-commits, linux-mm
The local_lock merge made rather a mess of all of this. I'm
cooking up a full resend of the same material.
^ permalink raw reply [flat|nested] 232+ messages in thread
* incoming
@ 2020-06-02 20:09 Andrew Morton
0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2020-06-02 20:09 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm
A few little subsystems and a start of a lot of MM patches.
128 patches, based on f359287765c04711ff54fbd11645271d8e5ff763:
Subsystems affected by this patch series:
squashfs
ocfs2
parisc
vfs
mm/slab-generic
mm/slub
mm/debug
mm/pagecache
mm/gup
mm/swap
mm/memcg
mm/pagemap
mm/memory-failure
mm/vmalloc
mm/kasan
Subsystem: squashfs
Philippe Liard <pliard@google.com>:
squashfs: migrate from ll_rw_block usage to BIO
Subsystem: ocfs2
Jules Irenge <jbi.octave@gmail.com>:
ocfs2: add missing annotation for dlm_empty_lockres()
Gang He <ghe@suse.com>:
ocfs2: mount shared volume without ha stack
Subsystem: parisc
Andrew Morton <akpm@linux-foundation.org>:
arch/parisc/include/asm/pgtable.h: remove unused `old_pte'
Subsystem: vfs
Jeff Layton <jlayton@redhat.com>:
Patch series "vfs: have syncfs() return error when there are writeback:
vfs: track per-sb writeback errors and report them to syncfs
fs/buffer.c: record blockdev write errors in super_block that it backs
Subsystem: mm/slab-generic
Vlastimil Babka <vbabka@suse.cz>:
usercopy: mark dma-kmalloc caches as usercopy caches
Subsystem: mm/slub
Dongli Zhang <dongli.zhang@oracle.com>:
mm/slub.c: fix corrupted freechain in deactivate_slab()
Christoph Lameter <cl@linux.com>:
slub: Remove userspace notifier for cache add/remove
Christopher Lameter <cl@linux.com>:
slub: remove kmalloc under list_lock from list_slab_objects() V2
Qian Cai <cai@lca.pw>:
mm/slub: fix stack overruns with SLUB_STATS
Andrew Morton <akpm@linux-foundation.org>:
Documentation/vm/slub.rst: s/Toggle/Enable/
Subsystem: mm/debug
Vlastimil Babka <vbabka@suse.cz>:
mm, dump_page(): do not crash with invalid mapping pointer
Subsystem: mm/pagecache
"Matthew Wilcox (Oracle)" <willy@infradead.org>:
Patch series "Change readahead API", v11:
mm: move readahead prototypes from mm.h
mm: return void from various readahead functions
mm: ignore return value of ->readpages
mm: move readahead nr_pages check into read_pages
mm: add new readahead_control API
mm: use readahead_control to pass arguments
mm: rename various 'offset' parameters to 'index'
mm: rename readahead loop variable to 'i'
mm: remove 'page_offset' from readahead loop
mm: put readahead pages in cache earlier
mm: add readahead address space operation
mm: move end_index check out of readahead loop
mm: add page_cache_readahead_unbounded
mm: document why we don't set PageReadahead
mm: use memalloc_nofs_save in readahead path
fs: convert mpage_readpages to mpage_readahead
btrfs: convert from readpages to readahead
erofs: convert uncompressed files from readpages to readahead
erofs: convert compressed files from readpages to readahead
ext4: convert from readpages to readahead
ext4: pass the inode to ext4_mpage_readpages
f2fs: convert from readpages to readahead
f2fs: pass the inode to f2fs_mpage_readpages
fuse: convert from readpages to readahead
iomap: convert from readpages to readahead
Guoqing Jiang <guoqing.jiang@cloud.ionos.com>:
Patch series "Introduce attach/detach_page_private to cleanup code":
include/linux/pagemap.h: introduce attach/detach_page_private
md: remove __clear_page_buffers and use attach/detach_page_private
btrfs: use attach/detach_page_private
fs/buffer.c: use attach/detach_page_private
f2fs: use attach/detach_page_private
iomap: use attach/detach_page_private
ntfs: replace attach_page_buffers with attach_page_private
orangefs: use attach/detach_page_private
buffer_head.h: remove attach_page_buffers
mm/migrate.c: call detach_page_private to cleanup code
mm_types.h: change set_page_private to inline function
"Matthew Wilcox (Oracle)" <willy@infradead.org>:
mm/filemap.c: remove misleading comment
Chao Yu <yuchao0@huawei.com>:
mm/page-writeback.c: remove unused variable
NeilBrown <neilb@suse.de>:
mm/writeback: replace PF_LESS_THROTTLE with PF_LOCAL_THROTTLE
mm/writeback: discard NR_UNSTABLE_NFS, use NR_WRITEBACK instead
Subsystem: mm/gup
Souptick Joarder <jrdr.linux@gmail.com>:
mm/gup.c: update the documentation
John Hubbard <jhubbard@nvidia.com>:
mm/gup: introduce pin_user_pages_unlocked
ivtv: convert get_user_pages() --> pin_user_pages()
Miles Chen <miles.chen@mediatek.com>:
mm/gup.c: further document vma_permits_fault()
Subsystem: mm/swap
chenqiwu <chenqiwu@xiaomi.com>:
mm/swapfile: use list_{prev,next}_entry() instead of open-coding
Qian Cai <cai@lca.pw>:
mm/swap_state: fix a data race in swapin_nr_pages
Andrea Righi <andrea.righi@canonical.com>:
mm: swap: properly update readahead statistics in unuse_pte_range()
Wei Yang <richard.weiyang@gmail.com>:
mm/swapfile.c: offset is only used when there is more slots
mm/swapfile.c: explicitly show ssd/non-ssd is handled mutually exclusive
mm/swapfile.c: remove the unnecessary goto for SSD case
mm/swapfile.c: simplify the calculation of n_goal
mm/swapfile.c: remove the extra check in scan_swap_map_slots()
mm/swapfile.c: found_free could be represented by (tmp < max)
mm/swapfile.c: tmp is always smaller than max
mm/swapfile.c: omit a duplicate code by compare tmp and max first
Huang Ying <ying.huang@intel.com>:
swap: try to scan more free slots even when fragmented
Wei Yang <richard.weiyang@gmail.com>:
mm/swapfile.c: classify SWAP_MAP_XXX to make it more readable
mm/swapfile.c: __swap_entry_free() always free 1 entry
Huang Ying <ying.huang@intel.com>:
mm/swapfile.c: use prandom_u32_max()
swap: reduce lock contention on swap cache from swap slots allocation
Randy Dunlap <rdunlap@infradead.org>:
mm: swapfile: fix /proc/swaps heading and Size/Used/Priority alignment
Miaohe Lin <linmiaohe@huawei.com>:
include/linux/swap.h: delete meaningless __add_to_swap_cache() declaration
Subsystem: mm/memcg
Yafang Shao <laoar.shao@gmail.com>:
mm, memcg: add workingset_restore in memory.stat
Kaixu Xia <kaixuxia@tencent.com>:
mm: memcontrol: simplify value comparison between count and limit
Shakeel Butt <shakeelb@google.com>:
memcg: expose root cgroup's memory.stat
Jakub Kicinski <kuba@kernel.org>:
Patch series "memcg: Slow down swap allocation as the available space gets:
mm/memcg: prepare for swap over-high accounting and penalty calculation
mm/memcg: move penalty delay clamping out of calculate_high_delay()
mm/memcg: move cgroup high memory limit setting into struct page_counter
mm/memcg: automatically penalize tasks with high swap use
Zefan Li <lizefan@huawei.com>:
memcg: fix memcg_kmem_bypass() for remote memcg charging
Subsystem: mm/pagemap
Steven Price <steven.price@arm.com>:
Patch series "Fix W+X debug feature on x86":
x86: mm: ptdump: calculate effective permissions correctly
mm: ptdump: expand type of 'val' in note_page()
Huang Ying <ying.huang@intel.com>:
/proc/PID/smaps: Add PMD migration entry parsing
chenqiwu <chenqiwu@xiaomi.com>:
mm/memory: remove unnecessary pte_devmap case in copy_one_pte()
Subsystem: mm/memory-failure
Wetp Zhang <wetp.zy@linux.alibaba.com>:
mm, memory_failure: don't send BUS_MCEERR_AO for action required error
Subsystem: mm/vmalloc
Christoph Hellwig <hch@lst.de>:
Patch series "decruft the vmalloc API", v2:
x86/hyperv: use vmalloc_exec for the hypercall page
x86: fix vmap arguments in map_irq_stack
staging: android: ion: use vmap instead of vm_map_ram
staging: media: ipu3: use vmap instead of reimplementing it
dma-mapping: use vmap insted of reimplementing it
powerpc: add an ioremap_phb helper
powerpc: remove __ioremap_at and __iounmap_at
mm: remove __get_vm_area
mm: unexport unmap_kernel_range_noflush
mm: rename CONFIG_PGTABLE_MAPPING to CONFIG_ZSMALLOC_PGTABLE_MAPPING
mm: only allow page table mappings for built-in zsmalloc
mm: pass addr as unsigned long to vb_free
mm: remove vmap_page_range_noflush and vunmap_page_range
mm: rename vmap_page_range to map_kernel_range
mm: don't return the number of pages from map_kernel_range{,_noflush}
mm: remove map_vm_range
mm: remove unmap_vmap_area
mm: remove the prot argument from vm_map_ram
mm: enforce that vmap can't map pages executable
gpu/drm: remove the powerpc hack in drm_legacy_sg_alloc
mm: remove the pgprot argument to __vmalloc
mm: remove the prot argument to __vmalloc_node
mm: remove both instances of __vmalloc_node_flags
mm: remove __vmalloc_node_flags_caller
mm: switch the test_vmalloc module to use __vmalloc_node
mm: remove vmalloc_user_node_flags
arm64: use __vmalloc_node in arch_alloc_vmap_stack
powerpc: use __vmalloc_node in alloc_vm_stack
s390: use __vmalloc_node in stack_alloc
Joerg Roedel <jroedel@suse.de>:
Patch series "mm: Get rid of vmalloc_sync_(un)mappings()", v3:
mm: add functions to track page directory modifications
mm/vmalloc: track which page-table levels were modified
mm/ioremap: track which page-table levels were modified
x86/mm/64: implement arch_sync_kernel_mappings()
x86/mm/32: implement arch_sync_kernel_mappings()
mm: remove vmalloc_sync_(un)mappings()
x86/mm: remove vmalloc faulting
Subsystem: mm/kasan
Andrey Konovalov <andreyknvl@google.com>:
kasan: fix clang compilation warning due to stack protector
Kees Cook <keescook@chromium.org>:
ubsan: entirely disable alignment checks under UBSAN_TRAP
Jing Xia <jing.xia@unisoc.com>:
mm/mm_init.c: report kasan-tag information stored in page->flags
Andrey Konovalov <andreyknvl@google.com>:
kasan: move kasan_report() into report.c
Documentation/admin-guide/cgroup-v2.rst | 24 +
Documentation/core-api/cachetlb.rst | 2
Documentation/filesystems/locking.rst | 6
Documentation/filesystems/proc.rst | 4
Documentation/filesystems/vfs.rst | 15
Documentation/vm/slub.rst | 2
arch/arm/configs/omap2plus_defconfig | 2
arch/arm64/include/asm/pgtable.h | 3
arch/arm64/include/asm/vmap_stack.h | 6
arch/arm64/mm/dump.c | 2
arch/parisc/include/asm/pgtable.h | 2
arch/powerpc/include/asm/io.h | 10
arch/powerpc/include/asm/pci-bridge.h | 2
arch/powerpc/kernel/irq.c | 5
arch/powerpc/kernel/isa-bridge.c | 28 +
arch/powerpc/kernel/pci_64.c | 56 +-
arch/powerpc/mm/ioremap_64.c | 50 --
arch/riscv/include/asm/pgtable.h | 4
arch/riscv/mm/ptdump.c | 2
arch/s390/kernel/setup.c | 9
arch/sh/kernel/cpu/sh4/sq.c | 3
arch/x86/hyperv/hv_init.c | 5
arch/x86/include/asm/kvm_host.h | 3
arch/x86/include/asm/pgtable-2level_types.h | 2
arch/x86/include/asm/pgtable-3level_types.h | 2
arch/x86/include/asm/pgtable_64_types.h | 2
arch/x86/include/asm/pgtable_types.h | 8
arch/x86/include/asm/switch_to.h | 23 -
arch/x86/kernel/irq_64.c | 2
arch/x86/kernel/setup_percpu.c | 6
arch/x86/kvm/svm/sev.c | 3
arch/x86/mm/dump_pagetables.c | 35 +
arch/x86/mm/fault.c | 196 ----------
arch/x86/mm/init_64.c | 5
arch/x86/mm/pti.c | 8
arch/x86/mm/tlb.c | 37 -
block/blk-core.c | 1
drivers/acpi/apei/ghes.c | 6
drivers/base/node.c | 2
drivers/block/drbd/drbd_bitmap.c | 4
drivers/block/loop.c | 2
drivers/dax/device.c | 1
drivers/gpu/drm/drm_scatter.c | 11
drivers/gpu/drm/etnaviv/etnaviv_dump.c | 4
drivers/gpu/drm/i915/gem/selftests/mock_dmabuf.c | 2
drivers/lightnvm/pblk-init.c | 5
drivers/md/dm-bufio.c | 4
drivers/md/md-bitmap.c | 12
drivers/media/common/videobuf2/videobuf2-dma-sg.c | 3
drivers/media/common/videobuf2/videobuf2-vmalloc.c | 3
drivers/media/pci/ivtv/ivtv-udma.c | 19 -
drivers/media/pci/ivtv/ivtv-yuv.c | 17
drivers/media/pci/ivtv/ivtvfb.c | 4
drivers/mtd/ubi/io.c | 4
drivers/pcmcia/electra_cf.c | 45 --
drivers/scsi/sd_zbc.c | 3
drivers/staging/android/ion/ion_heap.c | 4
drivers/staging/media/ipu3/ipu3-css-pool.h | 4
drivers/staging/media/ipu3/ipu3-dmamap.c | 30 -
fs/block_dev.c | 7
fs/btrfs/disk-io.c | 4
fs/btrfs/extent_io.c | 64 ---
fs/btrfs/extent_io.h | 3
fs/btrfs/inode.c | 39 --
fs/buffer.c | 23 -
fs/erofs/data.c | 41 --
fs/erofs/decompressor.c | 2
fs/erofs/zdata.c | 31 -
fs/exfat/inode.c | 7
fs/ext2/inode.c | 10
fs/ext4/ext4.h | 5
fs/ext4/inode.c | 25 -
fs/ext4/readpage.c | 25 -
fs/ext4/verity.c | 35 -
fs/f2fs/data.c | 56 +-
fs/f2fs/f2fs.h | 14
fs/f2fs/verity.c | 35 -
fs/fat/inode.c | 7
fs/file_table.c | 1
fs/fs-writeback.c | 1
fs/fuse/file.c | 100 +----
fs/gfs2/aops.c | 23 -
fs/gfs2/dir.c | 9
fs/gfs2/quota.c | 2
fs/hpfs/file.c | 7
fs/iomap/buffered-io.c | 113 +----
fs/iomap/trace.h | 2
fs/isofs/inode.c | 7
fs/jfs/inode.c | 7
fs/mpage.c | 38 --
fs/nfs/blocklayout/extent_tree.c | 2
fs/nfs/internal.h | 10
fs/nfs/write.c | 4
fs/nfsd/vfs.c | 9
fs/nilfs2/inode.c | 15
fs/ntfs/aops.c | 2
fs/ntfs/malloc.h | 2
fs/ntfs/mft.c | 2
fs/ocfs2/aops.c | 34 -
fs/ocfs2/dlm/dlmmaster.c | 1
fs/ocfs2/ocfs2.h | 4
fs/ocfs2/slot_map.c | 46 +-
fs/ocfs2/super.c | 21 +
fs/omfs/file.c | 7
fs/open.c | 3
fs/orangefs/inode.c | 32 -
fs/proc/meminfo.c | 3
fs/proc/task_mmu.c | 16
fs/qnx6/inode.c | 7
fs/reiserfs/inode.c | 8
fs/squashfs/block.c | 273 +++++++-------
fs/squashfs/decompressor.h | 5
fs/squashfs/decompressor_multi.c | 9
fs/squashfs/decompressor_multi_percpu.c | 17
fs/squashfs/decompressor_single.c | 9
fs/squashfs/lz4_wrapper.c | 17
fs/squashfs/lzo_wrapper.c | 17
fs/squashfs/squashfs.h | 4
fs/squashfs/xz_wrapper.c | 51 +-
fs/squashfs/zlib_wrapper.c | 63 +--
fs/squashfs/zstd_wrapper.c | 62 +--
fs/sync.c | 6
fs/ubifs/debug.c | 2
fs/ubifs/lprops.c | 2
fs/ubifs/lpt_commit.c | 4
fs/ubifs/orphan.c | 2
fs/udf/inode.c | 7
fs/xfs/kmem.c | 2
fs/xfs/xfs_aops.c | 13
fs/xfs/xfs_buf.c | 2
fs/zonefs/super.c | 7
include/asm-generic/5level-fixup.h | 5
include/asm-generic/pgtable.h | 27 +
include/linux/buffer_head.h | 8
include/linux/fs.h | 18
include/linux/iomap.h | 3
include/linux/memcontrol.h | 4
include/linux/mm.h | 67 ++-
include/linux/mm_types.h | 6
include/linux/mmzone.h | 1
include/linux/mpage.h | 4
include/linux/page_counter.h | 8
include/linux/pagemap.h | 193 ++++++++++
include/linux/ptdump.h | 3
include/linux/sched.h | 3
include/linux/swap.h | 17
include/linux/vmalloc.h | 49 +-
include/linux/zsmalloc.h | 2
include/trace/events/erofs.h | 6
include/trace/events/f2fs.h | 6
include/trace/events/writeback.h | 5
kernel/bpf/core.c | 6
kernel/bpf/syscall.c | 29 -
kernel/dma/remap.c | 48 --
kernel/groups.c | 2
kernel/module.c | 3
kernel/notifier.c | 1
kernel/sys.c | 2
kernel/trace/trace.c | 12
lib/Kconfig.ubsan | 2
lib/ioremap.c | 46 +-
lib/test_vmalloc.c | 26 -
mm/Kconfig | 4
mm/debug.c | 56 ++
mm/fadvise.c | 6
mm/filemap.c | 1
mm/gup.c | 77 +++-
mm/internal.h | 14
mm/kasan/Makefile | 21 -
mm/kasan/common.c | 19 -
mm/kasan/report.c | 22 +
mm/memcontrol.c | 198 +++++++---
mm/memory-failure.c | 15
mm/memory.c | 2
mm/migrate.c | 9
mm/mm_init.c | 16
mm/nommu.c | 52 +-
mm/page-writeback.c | 62 ++-
mm/page_alloc.c | 7
mm/percpu.c | 2
mm/ptdump.c | 17
mm/readahead.c | 349 ++++++++++--------
mm/slab_common.c | 3
mm/slub.c | 67 ++-
mm/swap_state.c | 5
mm/swapfile.c | 194 ++++++----
mm/util.c | 2
mm/vmalloc.c | 399 ++++++++-------------
mm/vmscan.c | 4
mm/vmstat.c | 11
mm/zsmalloc.c | 12
net/bridge/netfilter/ebtables.c | 6
net/ceph/ceph_common.c | 3
sound/core/memalloc.c | 2
sound/core/pcm_memory.c | 2
195 files changed, 2292 insertions(+), 2288 deletions(-)
^ permalink raw reply [flat|nested] 232+ messages in thread
* Re: incoming
[not found] ` <CAHk-=wgRV=SaiMn3L5u5mG0WfvB2VfEQadtudzDV3KRz5HnFrQ@mail.gmail.com>
@ 2020-06-02 21:38 ` Andrew Morton
0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2020-06-02 21:38 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, Linux-MM
On Tue, 2 Jun 2020 13:45:49 -0700 Linus Torvalds <torvalds@linux-foundation.org> wrote:
> On Tue, Jun 2, 2020 at 1:08 PM Andrew Morton <akpm@linux-foundation.org> wrote:
> >
> > The local_lock merge made rather a mess of all of this. I'm
> > cooking up a full resend of the same material.
>
> Hmm. I have no issues with conflicts, and already took your previous series.
Well that's odd.
> I've pushed it out now - does my tree match what you expect?
Yup, thanks.
^ permalink raw reply [flat|nested] 232+ messages in thread
* incoming
@ 2020-06-03 22:55 Andrew Morton
0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2020-06-03 22:55 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm
More mm/ work, plenty more to come.
131 patches, based on d6f9469a03d832dcd17041ed67774ffb5f3e73b3.
Subsystems affected by this patch series:
mm/slub
mm/memcg
mm/gup
mm/kasan
mm/pagealloc
mm/hugetlb
mm/vmscan
mm/tools
mm/mempolicy
mm/memblock
mm/hugetlbfs
mm/thp
mm/mmap
mm/kconfig
Subsystem: mm/slub
Wang Hai <wanghai38@huawei.com>:
mm/slub: fix a memory leak in sysfs_slab_add()
Subsystem: mm/memcg
Shakeel Butt <shakeelb@google.com>:
mm/memcg: optimize memory.numa_stat like memory.stat
Subsystem: mm/gup
John Hubbard <jhubbard@nvidia.com>:
Patch series "mm/gup, drm/i915: refactor gup_fast, convert to pin_user_pages()", v2:
mm/gup: move __get_user_pages_fast() down a few lines in gup.c
mm/gup: refactor and de-duplicate gup_fast() code
mm/gup: introduce pin_user_pages_fast_only()
drm/i915: convert get_user_pages() --> pin_user_pages()
mm/gup: might_lock_read(mmap_sem) in get_user_pages_fast()
Subsystem: mm/kasan
Daniel Axtens <dja@axtens.net>:
Patch series "Fix some incompatibilites between KASAN and FORTIFY_SOURCE", v4:
kasan: stop tests being eliminated as dead code with FORTIFY_SOURCE
string.h: fix incompatibility between FORTIFY_SOURCE and KASAN
Subsystem: mm/pagealloc
Michal Hocko <mhocko@suse.com>:
mm: clarify __GFP_MEMALLOC usage
Mike Rapoport <rppt@linux.ibm.com>:
Patch series "mm: rework free_area_init*() funcitons":
mm: memblock: replace dereferences of memblock_region.nid with API calls
mm: make early_pfn_to_nid() and related defintions close to each other
mm: remove CONFIG_HAVE_MEMBLOCK_NODE_MAP option
mm: free_area_init: use maximal zone PFNs rather than zone sizes
mm: use free_area_init() instead of free_area_init_nodes()
alpha: simplify detection of memory zone boundaries
arm: simplify detection of memory zone boundaries
arm64: simplify detection of memory zone boundaries for UMA configs
csky: simplify detection of memory zone boundaries
m68k: mm: simplify detection of memory zone boundaries
parisc: simplify detection of memory zone boundaries
sparc32: simplify detection of memory zone boundaries
unicore32: simplify detection of memory zone boundaries
xtensa: simplify detection of memory zone boundaries
Baoquan He <bhe@redhat.com>:
mm: memmap_init: iterate over memblock regions rather that check each PFN
Mike Rapoport <rppt@linux.ibm.com>:
mm: remove early_pfn_in_nid() and CONFIG_NODES_SPAN_OTHER_NODES
mm: free_area_init: allow defining max_zone_pfn in descending order
mm: rename free_area_init_node() to free_area_init_memoryless_node()
mm: clean up free_area_init_node() and its helpers
mm: simplify find_min_pfn_with_active_regions()
docs/vm: update memory-models documentation
Wei Yang <richard.weiyang@gmail.com>:
Patch series "mm/page_alloc.c: cleanup on check page", v3:
mm/page_alloc.c: bad_[reason|flags] is not necessary when PageHWPoison
mm/page_alloc.c: bad_flags is not necessary for bad_page()
mm/page_alloc.c: rename free_pages_check_bad() to check_free_page_bad()
mm/page_alloc.c: rename free_pages_check() to check_free_page()
mm/page_alloc.c: extract check_[new|free]_page_bad() common part to page_bad_reason()
Roman Gushchin <guro@fb.com>:
mm,page_alloc,cma: conditionally prefer cma pageblocks for movable allocations
Baoquan He <bhe@redhat.com>:
mm/page_alloc.c: remove unused free_bootmem_with_active_regions
Patch series "improvements about lowmem_reserve and /proc/zoneinfo", v2:
mm/page_alloc.c: only tune sysctl_lowmem_reserve_ratio value once when changing it
mm/page_alloc.c: clear out zone->lowmem_reserve[] if the zone is empty
mm/vmstat.c: do not show lowmem reserve protection information of empty zone
Joonsoo Kim <iamjoonsoo.kim@lge.com>:
Patch series "integrate classzone_idx and high_zoneidx", v5:
mm/page_alloc: use ac->high_zoneidx for classzone_idx
mm/page_alloc: integrate classzone_idx and high_zoneidx
Wei Yang <richard.weiyang@gmail.com>:
mm/page_alloc.c: use NODE_MASK_NONE in build_zonelists()
mm: rename gfpflags_to_migratetype to gfp_migratetype for same convention
Sandipan Das <sandipan@linux.ibm.com>:
mm/page_alloc.c: reset numa stats for boot pagesets
Charan Teja Reddy <charante@codeaurora.org>:
mm, page_alloc: reset the zone->watermark_boost early
Anshuman Khandual <anshuman.khandual@arm.com>:
mm/page_alloc: restrict and formalize compound_page_dtors[]
Daniel Jordan <daniel.m.jordan@oracle.com>:
Patch series "initialize deferred pages with interrupts enabled", v4:
mm/pagealloc.c: call touch_nmi_watchdog() on max order boundaries in deferred init
Pavel Tatashin <pasha.tatashin@soleen.com>:
mm: initialize deferred pages with interrupts enabled
mm: call cond_resched() from deferred_init_memmap()
Daniel Jordan <daniel.m.jordan@oracle.com>:
Patch series "padata: parallelize deferred page init", v3:
padata: remove exit routine
padata: initialize earlier
padata: allocate work structures for parallel jobs from a pool
padata: add basic support for multithreaded jobs
mm: don't track number of pages during deferred initialization
mm: parallelize deferred_init_memmap()
mm: make deferred init's max threads arch-specific
padata: document multithreaded jobs
Chen Tao <chentao107@huawei.com>:
mm/page_alloc.c: add missing newline
Subsystem: mm/hugetlb
"Kirill A. Shutemov" <kirill.shutemov@linux.intel.com>:
Patch series "thp/khugepaged improvements and CoW semantics", v4:
khugepaged: add self test
khugepaged: do not stop collapse if less than half PTEs are referenced
khugepaged: drain all LRU caches before scanning pages
khugepaged: drain LRU add pagevec after swapin
khugepaged: allow to collapse a page shared across fork
khugepaged: allow to collapse PTE-mapped compound pages
thp: change CoW semantics for anon-THP
khugepaged: introduce 'max_ptes_shared' tunable
Mike Kravetz <mike.kravetz@oracle.com>:
Patch series "Clean up hugetlb boot command line processing", v4:
hugetlbfs: add arch_hugetlb_valid_size
hugetlbfs: move hugepagesz= parsing to arch independent code
hugetlbfs: remove hugetlb_add_hstate() warning for existing hstate
hugetlbfs: clean up command line processing
hugetlbfs: fix changes to command line processing
Li Xinhai <lixinhai.lxh@gmail.com>:
mm/hugetlb: avoid unnecessary check on pud and pmd entry in huge_pte_offset
Anshuman Khandual <anshuman.khandual@arm.com>:
Patch series "mm/hugetlb: Add some new generic fallbacks", v3:
arm64/mm: drop __HAVE_ARCH_HUGE_PTEP_GET
mm/hugetlb: define a generic fallback for is_hugepage_only_range()
mm/hugetlb: define a generic fallback for arch_clear_hugepage_flags()
"Matthew Wilcox (Oracle)" <willy@infradead.org>:
mm: simplify calling a compound page destructor
Subsystem: mm/vmscan
Wei Yang <richard.weiyang@gmail.com>:
mm/vmscan.c: use update_lru_size() in update_lru_sizes()
Jaewon Kim <jaewon31.kim@samsung.com>:
mm/vmscan: count layzfree pages and fix nr_isolated_* mismatch
Maninder Singh <maninder1.s@samsung.com>:
mm/vmscan.c: change prototype for shrink_page_list
Qiwu Chen <qiwuchen55@gmail.com>:
mm/vmscan: update the comment of should_continue_reclaim()
Johannes Weiner <hannes@cmpxchg.org>:
Patch series "mm: memcontrol: charge swapin pages on instantiation", v2:
mm: fix NUMA node file count error in replace_page_cache()
mm: memcontrol: fix stat-corrupting race in charge moving
mm: memcontrol: drop @compound parameter from memcg charging API
mm: shmem: remove rare optimization when swapin races with hole punching
mm: memcontrol: move out cgroup swaprate throttling
mm: memcontrol: convert page cache to a new mem_cgroup_charge() API
mm: memcontrol: prepare uncharging for removal of private page type counters
mm: memcontrol: prepare move_account for removal of private page type counters
mm: memcontrol: prepare cgroup vmstat infrastructure for native anon counters
mm: memcontrol: switch to native NR_FILE_PAGES and NR_SHMEM counters
mm: memcontrol: switch to native NR_ANON_MAPPED counter
mm: memcontrol: switch to native NR_ANON_THPS counter
mm: memcontrol: convert anon and file-thp to new mem_cgroup_charge() API
mm: memcontrol: drop unused try/commit/cancel charge API
mm: memcontrol: prepare swap controller setup for integration
mm: memcontrol: make swap tracking an integral part of memory control
mm: memcontrol: charge swapin pages on instantiation
Alex Shi <alex.shi@linux.alibaba.com>:
mm: memcontrol: document the new swap control behavior
Johannes Weiner <hannes@cmpxchg.org>:
mm: memcontrol: delete unused lrucare handling
mm: memcontrol: update page->mem_cgroup stability rules
mm: fix LRU balancing effect of new transparent huge pages
mm: keep separate anon and file statistics on page reclaim activity
mm: allow swappiness that prefers reclaiming anon over the file workingset
mm: fold and remove lru_cache_add_anon() and lru_cache_add_file()
mm: workingset: let cache workingset challenge anon
mm: remove use-once cache bias from LRU balancing
mm: vmscan: drop unnecessary div0 avoidance rounding in get_scan_count()
mm: base LRU balancing on an explicit cost model
mm: deactivations shouldn't bias the LRU balance
mm: only count actual rotations as LRU reclaim cost
mm: balance LRU lists based on relative thrashing
mm: vmscan: determine anon/file pressure balance at the reclaim root
mm: vmscan: reclaim writepage is IO cost
mm: vmscan: limit the range of LRU type balancing
Shakeel Butt <shakeelb@google.com>:
mm: swap: fix vmstats for huge pages
mm: swap: memcg: fix memcg stats for huge pages
Subsystem: mm/tools
Changhee Han <ch0.han@lge.com>:
tools/vm/page_owner_sort.c: filter out unneeded line
Subsystem: mm/mempolicy
Michal Hocko <mhocko@suse.com>:
mm, mempolicy: fix up gup usage in lookup_node
Subsystem: mm/memblock
chenqiwu <chenqiwu@xiaomi.com>:
include/linux/memblock.h: fix minor typo and unclear comment
Mike Rapoport <rppt@linux.ibm.com>:
sparc32: register memory occupied by kernel as memblock.memory
Subsystem: mm/hugetlbfs
Shijie Hu <hushijie3@huawei.com>:
hugetlbfs: get unmapped area below TASK_UNMAPPED_BASE for hugetlbfs
Subsystem: mm/thp
Yang Shi <yang.shi@linux.alibaba.com>:
mm: thp: don't need to drain lru cache when splitting and mlocking THP
Anshuman Khandual <anshuman.khandual@arm.com>:
Patch series "mm/thp: Rename pmd_mknotpresent() as pmd_mknotvalid()", v2:
powerpc/mm: drop platform defined pmd_mknotpresent()
mm/thp: rename pmd_mknotpresent() as pmd_mkinvalid()
Subsystem: mm/mmap
Scott Cheloha <cheloha@linux.vnet.ibm.com>:
drivers/base/memory.c: cache memory blocks in xarray to accelerate lookup
Subsystem: mm/kconfig
Zong Li <zong.li@sifive.com>:
Patch series "Extract DEBUG_WX to shared use":
mm: add DEBUG_WX support
riscv: support DEBUG_WX
x86: mm: use ARCH_HAS_DEBUG_WX instead of arch defined
arm64: mm: use ARCH_HAS_DEBUG_WX instead of arch defined
Documentation/admin-guide/cgroup-v1/memory.rst | 19
Documentation/admin-guide/kernel-parameters.txt | 40
Documentation/admin-guide/mm/hugetlbpage.rst | 35
Documentation/admin-guide/mm/transhuge.rst | 7
Documentation/admin-guide/sysctl/vm.rst | 23
Documentation/core-api/padata.rst | 41
Documentation/features/vm/numa-memblock/arch-support.txt | 34
Documentation/vm/memory-model.rst | 9
Documentation/vm/page_owner.rst | 3
arch/alpha/mm/init.c | 16
arch/alpha/mm/numa.c | 22
arch/arc/include/asm/hugepage.h | 2
arch/arc/mm/init.c | 41
arch/arm/include/asm/hugetlb.h | 7
arch/arm/include/asm/pgtable-3level.h | 2
arch/arm/mm/init.c | 66
arch/arm64/Kconfig | 2
arch/arm64/Kconfig.debug | 29
arch/arm64/include/asm/hugetlb.h | 13
arch/arm64/include/asm/pgtable.h | 2
arch/arm64/mm/hugetlbpage.c | 48
arch/arm64/mm/init.c | 56
arch/arm64/mm/numa.c | 9
arch/c6x/mm/init.c | 8
arch/csky/kernel/setup.c | 26
arch/h8300/mm/init.c | 6
arch/hexagon/mm/init.c | 6
arch/ia64/Kconfig | 1
arch/ia64/include/asm/hugetlb.h | 5
arch/ia64/mm/contig.c | 2
arch/ia64/mm/discontig.c | 2
arch/m68k/mm/init.c | 6
arch/m68k/mm/mcfmmu.c | 9
arch/m68k/mm/motorola.c | 15
arch/m68k/mm/sun3mmu.c | 10
arch/microblaze/Kconfig | 1
arch/microblaze/mm/init.c | 2
arch/mips/Kconfig | 1
arch/mips/include/asm/hugetlb.h | 11
arch/mips/include/asm/pgtable.h | 2
arch/mips/loongson64/numa.c | 2
arch/mips/mm/init.c | 2
arch/mips/sgi-ip27/ip27-memory.c | 2
arch/nds32/mm/init.c | 11
arch/nios2/mm/init.c | 8
arch/openrisc/mm/init.c | 9
arch/parisc/include/asm/hugetlb.h | 10
arch/parisc/mm/init.c | 22
arch/powerpc/Kconfig | 10
arch/powerpc/include/asm/book3s/64/pgtable.h | 4
arch/powerpc/include/asm/hugetlb.h | 5
arch/powerpc/mm/hugetlbpage.c | 38
arch/powerpc/mm/mem.c | 2
arch/riscv/Kconfig | 2
arch/riscv/include/asm/hugetlb.h | 10
arch/riscv/include/asm/ptdump.h | 11
arch/riscv/mm/hugetlbpage.c | 44
arch/riscv/mm/init.c | 5
arch/s390/Kconfig | 1
arch/s390/include/asm/hugetlb.h | 8
arch/s390/mm/hugetlbpage.c | 34
arch/s390/mm/init.c | 2
arch/sh/Kconfig | 1
arch/sh/include/asm/hugetlb.h | 7
arch/sh/mm/init.c | 2
arch/sparc/Kconfig | 10
arch/sparc/include/asm/hugetlb.h | 10
arch/sparc/mm/init_32.c | 1
arch/sparc/mm/init_64.c | 67
arch/sparc/mm/srmmu.c | 21
arch/um/kernel/mem.c | 12
arch/unicore32/include/asm/memory.h | 2
arch/unicore32/include/mach/memory.h | 6
arch/unicore32/kernel/pci.c | 14
arch/unicore32/mm/init.c | 43
arch/x86/Kconfig | 11
arch/x86/Kconfig.debug | 27
arch/x86/include/asm/hugetlb.h | 10
arch/x86/include/asm/pgtable.h | 2
arch/x86/mm/hugetlbpage.c | 35
arch/x86/mm/init.c | 2
arch/x86/mm/init_64.c | 12
arch/x86/mm/kmmio.c | 2
arch/x86/mm/numa.c | 11
arch/xtensa/mm/init.c | 8
drivers/base/memory.c | 44
drivers/gpu/drm/i915/gem/i915_gem_userptr.c | 22
fs/cifs/file.c | 10
fs/fuse/dev.c | 2
fs/hugetlbfs/inode.c | 67
include/asm-generic/hugetlb.h | 2
include/linux/compaction.h | 9
include/linux/gfp.h | 7
include/linux/hugetlb.h | 16
include/linux/memblock.h | 15
include/linux/memcontrol.h | 102 -
include/linux/mm.h | 52
include/linux/mmzone.h | 46
include/linux/padata.h | 43
include/linux/string.h | 60
include/linux/swap.h | 17
include/linux/vm_event_item.h | 4
include/linux/vmstat.h | 2
include/trace/events/compaction.h | 22
include/trace/events/huge_memory.h | 3
include/trace/events/vmscan.h | 14
init/Kconfig | 17
init/main.c | 2
kernel/events/uprobes.c | 22
kernel/padata.c | 293 +++-
kernel/sysctl.c | 3
lib/test_kasan.c | 29
mm/Kconfig | 9
mm/Kconfig.debug | 32
mm/compaction.c | 70 -
mm/filemap.c | 55
mm/gup.c | 237 ++-
mm/huge_memory.c | 282 ----
mm/hugetlb.c | 260 ++-
mm/internal.h | 25
mm/khugepaged.c | 316 ++--
mm/memblock.c | 19
mm/memcontrol.c | 642 +++------
mm/memory.c | 103 -
mm/memory_hotplug.c | 10
mm/mempolicy.c | 5
mm/migrate.c | 30
mm/oom_kill.c | 4
mm/page_alloc.c | 735 ++++------
mm/page_owner.c | 7
mm/pgtable-generic.c | 2
mm/rmap.c | 53
mm/shmem.c | 156 --
mm/slab.c | 4
mm/slub.c | 8
mm/swap.c | 199 +-
mm/swap_cgroup.c | 10
mm/swap_state.c | 110 -
mm/swapfile.c | 39
mm/userfaultfd.c | 15
mm/vmscan.c | 344 ++--
mm/vmstat.c | 16
mm/workingset.c | 23
tools/testing/selftests/vm/.gitignore | 1
tools/testing/selftests/vm/Makefile | 1
tools/testing/selftests/vm/khugepaged.c | 1035 +++++++++++++++
tools/vm/page_owner_sort.c | 5
147 files changed, 3876 insertions(+), 3108 deletions(-)
^ permalink raw reply [flat|nested] 232+ messages in thread
* incoming
@ 2020-06-04 23:45 Andrew Morton
0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2020-06-04 23:45 UTC (permalink / raw)
To: Linus Torvalds; +Cc: linux-mm, mm-commits
- More MM work. 100ish more to go. Mike's "mm: remove
__ARCH_HAS_5LEVEL_HACK" series should fix the current ppc issue.
- Various other little subsystems
127 patches, based on 6929f71e46bdddbf1c4d67c2728648176c67c555.
Subsystems affected by this patch series:
kcov
mm/pagemap
mm/vmalloc
mm/kmap
mm/util
mm/memory-hotplug
mm/cleanups
mm/zram
procfs
core-kernel
get_maintainer
lib
bitops
checkpatch
binfmt
init
fat
seq_file
exec
rapidio
relay
selftests
ubsan
Subsystem: kcov
Andrey Konovalov <andreyknvl@google.com>:
Patch series "kcov: collect coverage from usb soft interrupts", v4:
kcov: cleanup debug messages
kcov: fix potential use-after-free in kcov_remote_start
kcov: move t->kcov assignments into kcov_start/stop
kcov: move t->kcov_sequence assignment
kcov: use t->kcov_mode as enabled indicator
kcov: collect coverage from interrupts
usb: core: kcov: collect coverage from usb complete callback
Subsystem: mm/pagemap
Feng Tang <feng.tang@intel.com>:
mm/util.c: remove the VM_WARN_ONCE for vm_committed_as underflow check
Mike Rapoport <rppt@linux.ibm.com>:
Patch series "mm: remove __ARCH_HAS_5LEVEL_HACK", v4:
h8300: remove usage of __ARCH_USE_5LEVEL_HACK
arm: add support for folded p4d page tables
arm64: add support for folded p4d page tables
hexagon: remove __ARCH_USE_5LEVEL_HACK
ia64: add support for folded p4d page tables
nios2: add support for folded p4d page tables
openrisc: add support for folded p4d page tables
powerpc: add support for folded p4d page tables
Geert Uytterhoeven <geert+renesas@glider.be>:
sh: fault: modernize printing of kernel messages
Mike Rapoport <rppt@linux.ibm.com>:
sh: drop __pXd_offset() macros that duplicate pXd_index() ones
sh: add support for folded p4d page tables
unicore32: remove __ARCH_USE_5LEVEL_HACK
asm-generic: remove pgtable-nop4d-hack.h
mm: remove __ARCH_HAS_5LEVEL_HACK and include/asm-generic/5level-fixup.h
Anshuman Khandual <anshuman.khandual@arm.com>:
Patch series "mm/debug: Add tests validating architecture page table:
x86/mm: define mm_p4d_folded()
mm/debug: add tests validating architecture page table helpers
Subsystem: mm/vmalloc
Jeongtae Park <jtp.park@samsung.com>:
mm/vmalloc: fix a typo in comment
Subsystem: mm/kmap
Ira Weiny <ira.weiny@intel.com>:
Patch series "Remove duplicated kmap code", v3:
arch/kmap: remove BUG_ON()
arch/xtensa: move kmap build bug out of the way
arch/kmap: remove redundant arch specific kmaps
arch/kunmap: remove duplicate kunmap implementations
{x86,powerpc,microblaze}/kmap: move preempt disable
arch/kmap_atomic: consolidate duplicate code
arch/kunmap_atomic: consolidate duplicate code
arch/kmap: ensure kmap_prot visibility
arch/kmap: don't hard code kmap_prot values
arch/kmap: define kmap_atomic_prot() for all arch's
drm: remove drm specific kmap_atomic code
kmap: remove kmap_atomic_to_page()
parisc/kmap: remove duplicate kmap code
sparc: remove unnecessary includes
kmap: consolidate kmap_prot definitions
Subsystem: mm/util
Waiman Long <longman@redhat.com>:
mm: add kvfree_sensitive() for freeing sensitive data objects
Subsystem: mm/memory-hotplug
Vishal Verma <vishal.l.verma@intel.com>:
mm/memory_hotplug: refrain from adding memory into an impossible node
David Hildenbrand <david@redhat.com>:
powerpc/pseries/hotplug-memory: stop checking is_mem_section_removable()
mm/memory_hotplug: remove is_mem_section_removable()
Patch series "mm/memory_hotplug: handle memblocks only with:
mm/memory_hotplug: set node_start_pfn of hotadded pgdat to 0
mm/memory_hotplug: handle memblocks only with CONFIG_ARCH_KEEP_MEMBLOCK
Patch series "mm/memory_hotplug: Interface to add driver-managed system:
mm/memory_hotplug: introduce add_memory_driver_managed()
kexec_file: don't place kexec images on IORESOURCE_MEM_DRIVER_MANAGED
device-dax: add memory via add_memory_driver_managed()
Michal Hocko <mhocko@kernel.org>:
mm/memory_hotplug: disable the functionality for 32b
Subsystem: mm/cleanups
chenqiwu <chenqiwu@xiaomi.com>:
mm: replace zero-length array with flexible-array member
Ethon Paul <ethp@qq.com>:
mm/memory_hotplug: fix a typo in comment "recoreded"->"recorded"
mm: ksm: fix a typo in comment "alreaady"->"already"
mm: mmap: fix a typo in comment "compatbility"->"compatibility"
mm/hugetlb: fix a typos in comments
mm/vmsan: fix some typos in comment
mm/compaction: fix a typo in comment "pessemistic"->"pessimistic"
mm/memblock: fix a typo in comment "implict"->"implicit"
mm/list_lru: fix a typo in comment "numbesr"->"numbers"
mm/filemap: fix a typo in comment "unneccssary"->"unnecessary"
mm/frontswap: fix some typos in frontswap.c
mm, memcg: fix some typos in memcontrol.c
mm: fix a typo in comment "strucure"->"structure"
mm/slub: fix a typo in comment "disambiguiation"->"disambiguation"
mm/sparse: fix a typo in comment "convienence"->"convenience"
mm/page-writeback: fix a typo in comment "effictive"->"effective"
mm/memory: fix a typo in comment "attampt"->"attempt"
Zou Wei <zou_wei@huawei.com>:
mm: use false for bool variable
Jason Yan <yanaijie@huawei.com>:
include/linux/mm.h: return true in cpupid_pid_unset()
Subsystem: mm/zram
Andy Shevchenko <andriy.shevchenko@linux.intel.com>:
zcomp: Use ARRAY_SIZE() for backends list
Subsystem: procfs
Alexey Dobriyan <adobriyan@gmail.com>:
proc: rename "catch" function argument
Subsystem: core-kernel
Jason Yan <yanaijie@huawei.com>:
user.c: make uidhash_table static
Subsystem: get_maintainer
Joe Perches <joe@perches.com>:
get_maintainer: add email addresses from .yaml files
get_maintainer: fix unexpected behavior for path/to//file (double slashes)
Subsystem: lib
Christophe JAILLET <christophe.jaillet@wanadoo.fr>:
lib/math: avoid trailing newline hidden in pr_fmt()
KP Singh <kpsingh@chromium.org>:
lib: Add might_fault() to strncpy_from_user.
Jason Yan <yanaijie@huawei.com>:
lib/test_lockup.c: make test_inode static
Jann Horn <jannh@google.com>:
lib/zlib: remove outdated and incorrect pre-increment optimization
Joe Perches <joe@perches.com>:
lib/percpu-refcount.c: use a more common logging style
Tan Hu <tan.hu@zte.com.cn>:
lib/flex_proportions.c: cleanup __fprop_inc_percpu_max
Jesse Brandeburg <jesse.brandeburg@intel.com>:
lib: make a test module with set/clear bit
Subsystem: bitops
Arnd Bergmann <arnd@arndb.de>:
include/linux/bitops.h: avoid clang shift-count-overflow warnings
Subsystem: checkpatch
Joe Perches <joe@perches.com>:
checkpatch: additional MAINTAINER section entry ordering checks
checkpatch: look for c99 comments in ctx_locate_comment
checkpatch: disallow --git and --file/--fix
Geert Uytterhoeven <geert+renesas@glider.be>:
checkpatch: use patch subject when reading from stdin
Subsystem: binfmt
Anthony Iliopoulos <ailiop@suse.com>:
fs/binfmt_elf: remove redundant elf_map ifndef
Nick Desaulniers <ndesaulniers@google.com>:
elfnote: mark all .note sections SHF_ALLOC
Subsystem: init
Chris Down <chris@chrisdown.name>:
init: allow distribution configuration of default init
Subsystem: fat
OGAWA Hirofumi <hirofumi@mail.parknet.co.jp>:
fat: don't allow to mount if the FAT length == 0
fat: improve the readahead for FAT entries
Subsystem: seq_file
Joe Perches <joe@perches.com>:
fs/seq_file.c: seq_read: Update pr_info_ratelimited
Kefeng Wang <wangkefeng.wang@huawei.com>:
Patch series "seq_file: Introduce DEFINE_SEQ_ATTRIBUTE() helper macro":
include/linux/seq_file.h: introduce DEFINE_SEQ_ATTRIBUTE() helper macro
mm/vmstat.c: convert to use DEFINE_SEQ_ATTRIBUTE macro
kernel/kprobes.c: convert to use DEFINE_SEQ_ATTRIBUTE macro
Subsystem: exec
Christoph Hellwig <hch@lst.de>:
exec: simplify the copy_strings_kernel calling convention
exec: open code copy_string_kernel
Subsystem: rapidio
Madhuparna Bhowmik <madhuparnabhowmik10@gmail.com>:
rapidio: avoid data race between file operation callbacks and mport_cdev_add().
John Hubbard <jhubbard@nvidia.com>:
rapidio: convert get_user_pages() --> pin_user_pages()
Subsystem: relay
Daniel Axtens <dja@axtens.net>:
kernel/relay.c: handle alloc_percpu returning NULL in relay_open
Pengcheng Yang <yangpc@wangsu.com>:
kernel/relay.c: fix read_pos error when multiple readers
Subsystem: selftests
Ram Pai <linuxram@us.ibm.com>:
Patch series "selftests, powerpc, x86: Memory Protection Keys", v19:
selftests/x86/pkeys: move selftests to arch-neutral directory
selftests/vm/pkeys: rename all references to pkru to a generic name
selftests/vm/pkeys: move generic definitions to header file
Thiago Jung Bauermann <bauerman@linux.ibm.com>:
selftests/vm/pkeys: move some definitions to arch-specific header
selftests/vm/pkeys: make gcc check arguments of sigsafe_printf()
Sandipan Das <sandipan@linux.ibm.com>:
selftests: vm: pkeys: Use sane types for pkey register
selftests: vm: pkeys: add helpers for pkey bits
Ram Pai <linuxram@us.ibm.com>:
selftests/vm/pkeys: fix pkey_disable_clear()
selftests/vm/pkeys: fix assertion in pkey_disable_set/clear()
selftests/vm/pkeys: fix alloc_random_pkey() to make it really random
Sandipan Das <sandipan@linux.ibm.com>:
selftests: vm: pkeys: use the correct huge page size
Ram Pai <linuxram@us.ibm.com>:
selftests/vm/pkeys: introduce generic pkey abstractions
selftests/vm/pkeys: introduce powerpc support
"Desnes A. Nunes do Rosario" <desnesn@linux.vnet.ibm.com>:
selftests/vm/pkeys: fix number of reserved powerpc pkeys
Ram Pai <linuxram@us.ibm.com>:
selftests/vm/pkeys: fix assertion in test_pkey_alloc_exhaust()
selftests/vm/pkeys: improve checks to determine pkey support
selftests/vm/pkeys: associate key on a mapped page and detect access violation
selftests/vm/pkeys: associate key on a mapped page and detect write violation
selftests/vm/pkeys: detect write violation on a mapped access-denied-key page
selftests/vm/pkeys: introduce a sub-page allocator
selftests/vm/pkeys: test correct behaviour of pkey-0
selftests/vm/pkeys: override access right definitions on powerpc
Sandipan Das <sandipan@linux.ibm.com>:
selftests: vm: pkeys: use the correct page size on powerpc
selftests: vm: pkeys: fix multilib builds for x86
Jagadeesh Pagadala <jagdsh.linux@gmail.com>:
tools/testing/selftests/vm: remove duplicate headers
Subsystem: ubsan
Arnd Bergmann <arnd@arndb.de>:
lib/ubsan.c: fix gcc-10 warnings
Documentation/dev-tools/kcov.rst | 17
Documentation/features/debug/debug-vm-pgtable/arch-support.txt | 34
arch/arc/Kconfig | 1
arch/arc/include/asm/highmem.h | 20
arch/arc/mm/highmem.c | 34
arch/arm/include/asm/highmem.h | 9
arch/arm/include/asm/pgtable.h | 1
arch/arm/lib/uaccess_with_memcpy.c | 7
arch/arm/mach-sa1100/assabet.c | 2
arch/arm/mm/dump.c | 29
arch/arm/mm/fault-armv.c | 7
arch/arm/mm/fault.c | 22
arch/arm/mm/highmem.c | 41
arch/arm/mm/idmap.c | 3
arch/arm/mm/init.c | 2
arch/arm/mm/ioremap.c | 12
arch/arm/mm/mm.h | 2
arch/arm/mm/mmu.c | 35
arch/arm/mm/pgd.c | 40
arch/arm64/Kconfig | 1
arch/arm64/include/asm/kvm_mmu.h | 10
arch/arm64/include/asm/pgalloc.h | 10
arch/arm64/include/asm/pgtable-types.h | 5
arch/arm64/include/asm/pgtable.h | 37
arch/arm64/include/asm/stage2_pgtable.h | 48
arch/arm64/kernel/hibernate.c | 44
arch/arm64/kvm/mmu.c | 209
arch/arm64/mm/fault.c | 9
arch/arm64/mm/hugetlbpage.c | 15
arch/arm64/mm/kasan_init.c | 26
arch/arm64/mm/mmu.c | 52
arch/arm64/mm/pageattr.c | 7
arch/csky/include/asm/highmem.h | 12
arch/csky/mm/highmem.c | 64
arch/h8300/include/asm/pgtable.h | 1
arch/hexagon/include/asm/fixmap.h | 4
arch/hexagon/include/asm/pgtable.h | 1
arch/ia64/include/asm/pgalloc.h | 4
arch/ia64/include/asm/pgtable.h | 17
arch/ia64/mm/fault.c | 7
arch/ia64/mm/hugetlbpage.c | 18
arch/ia64/mm/init.c | 28
arch/microblaze/include/asm/highmem.h | 55
arch/microblaze/mm/highmem.c | 21
arch/microblaze/mm/init.c | 3
arch/mips/include/asm/highmem.h | 11
arch/mips/mm/cache.c | 6
arch/mips/mm/highmem.c | 62
arch/nds32/include/asm/highmem.h | 9
arch/nds32/mm/highmem.c | 49
arch/nios2/include/asm/pgtable.h | 3
arch/nios2/mm/fault.c | 9
arch/nios2/mm/ioremap.c | 6
arch/openrisc/include/asm/pgtable.h | 1
arch/openrisc/mm/fault.c | 10
arch/openrisc/mm/init.c | 4
arch/parisc/include/asm/cacheflush.h | 32
arch/powerpc/Kconfig | 1
arch/powerpc/include/asm/book3s/32/pgtable.h | 1
arch/powerpc/include/asm/book3s/64/hash.h | 4
arch/powerpc/include/asm/book3s/64/pgalloc.h | 4
arch/powerpc/include/asm/book3s/64/pgtable.h | 60
arch/powerpc/include/asm/book3s/64/radix.h | 6
arch/powerpc/include/asm/highmem.h | 56
arch/powerpc/include/asm/nohash/32/pgtable.h | 1
arch/powerpc/include/asm/nohash/64/pgalloc.h | 2
arch/powerpc/include/asm/nohash/64/pgtable-4k.h | 32
arch/powerpc/include/asm/nohash/64/pgtable.h | 6
arch/powerpc/include/asm/pgtable.h | 10
arch/powerpc/kvm/book3s_64_mmu_radix.c | 32
arch/powerpc/lib/code-patching.c | 7
arch/powerpc/mm/book3s64/hash_pgtable.c | 4
arch/powerpc/mm/book3s64/radix_pgtable.c | 26
arch/powerpc/mm/book3s64/subpage_prot.c | 6
arch/powerpc/mm/highmem.c | 26
arch/powerpc/mm/hugetlbpage.c | 28
arch/powerpc/mm/kasan/kasan_init_32.c | 2
arch/powerpc/mm/mem.c | 3
arch/powerpc/mm/nohash/book3e_pgtable.c | 15
arch/powerpc/mm/pgtable.c | 30
arch/powerpc/mm/pgtable_64.c | 10
arch/powerpc/mm/ptdump/hashpagetable.c | 20
arch/powerpc/mm/ptdump/ptdump.c | 12
arch/powerpc/platforms/pseries/hotplug-memory.c | 26
arch/powerpc/xmon/xmon.c | 27
arch/s390/Kconfig | 1
arch/sh/include/asm/pgtable-2level.h | 1
arch/sh/include/asm/pgtable-3level.h | 1
arch/sh/include/asm/pgtable_32.h | 5
arch/sh/include/asm/pgtable_64.h | 5
arch/sh/kernel/io_trapped.c | 7
arch/sh/mm/cache-sh4.c | 4
arch/sh/mm/cache-sh5.c | 7
arch/sh/mm/fault.c | 64
arch/sh/mm/hugetlbpage.c | 28
arch/sh/mm/init.c | 15
arch/sh/mm/kmap.c | 2
arch/sh/mm/tlbex_32.c | 6
arch/sh/mm/tlbex_64.c | 7
arch/sparc/include/asm/highmem.h | 29
arch/sparc/mm/highmem.c | 31
arch/sparc/mm/io-unit.c | 1
arch/sparc/mm/iommu.c | 1
arch/unicore32/include/asm/pgtable.h | 1
arch/unicore32/kernel/hibernate.c | 4
arch/x86/Kconfig | 1
arch/x86/include/asm/fixmap.h | 1
arch/x86/include/asm/highmem.h | 37
arch/x86/include/asm/pgtable_64.h | 6
arch/x86/mm/highmem_32.c | 52
arch/xtensa/include/asm/highmem.h | 31
arch/xtensa/mm/highmem.c | 28
drivers/block/zram/zcomp.c | 7
drivers/dax/dax-private.h | 1
drivers/dax/kmem.c | 28
drivers/gpu/drm/ttm/ttm_bo_util.c | 56
drivers/gpu/drm/vmwgfx/vmwgfx_blit.c | 17
drivers/rapidio/devices/rio_mport_cdev.c | 27
drivers/usb/core/hcd.c | 3
fs/binfmt_elf.c | 4
fs/binfmt_em86.c | 6
fs/binfmt_misc.c | 4
fs/binfmt_script.c | 6
fs/exec.c | 58
fs/fat/fatent.c | 103
fs/fat/inode.c | 6
fs/proc/array.c | 8
fs/seq_file.c | 7
include/asm-generic/5level-fixup.h | 59
include/asm-generic/pgtable-nop4d-hack.h | 64
include/asm-generic/pgtable-nopud.h | 4
include/drm/ttm/ttm_bo_api.h | 4
include/linux/binfmts.h | 3
include/linux/bitops.h | 2
include/linux/elfnote.h | 2
include/linux/highmem.h | 89
include/linux/ioport.h | 1
include/linux/memory_hotplug.h | 9
include/linux/mm.h | 12
include/linux/sched.h | 3
include/linux/seq_file.h | 19
init/Kconfig | 10
init/main.c | 10
kernel/kcov.c | 282 -
kernel/kexec_file.c | 5
kernel/kprobes.c | 34
kernel/relay.c | 22
kernel/user.c | 2
lib/Kconfig.debug | 44
lib/Makefile | 2
lib/flex_proportions.c | 7
lib/math/prime_numbers.c | 10
lib/percpu-refcount.c | 6
lib/strncpy_from_user.c | 1
lib/test_bitops.c | 60
lib/test_lockup.c | 2
lib/ubsan.c | 33
lib/zlib_inflate/inffast.c | 91
mm/Kconfig | 4
mm/Makefile | 1
mm/compaction.c | 2
mm/debug_vm_pgtable.c | 382 +
mm/filemap.c | 2
mm/frontswap.c | 6
mm/huge_memory.c | 2
mm/hugetlb.c | 16
mm/internal.h | 2
mm/kasan/init.c | 11
mm/ksm.c | 10
mm/list_lru.c | 2
mm/memblock.c | 2
mm/memcontrol.c | 4
mm/memory.c | 10
mm/memory_hotplug.c | 179
mm/mmap.c | 2
mm/mremap.c | 2
mm/page-writeback.c | 2
mm/slub.c | 2
mm/sparse.c | 2
mm/util.c | 22
mm/vmalloc.c | 2
mm/vmscan.c | 6
mm/vmstat.c | 32
mm/zbud.c | 2
scripts/checkpatch.pl | 62
scripts/get_maintainer.pl | 46
security/keys/internal.h | 11
security/keys/keyctl.c | 16
tools/testing/selftests/lib/config | 1
tools/testing/selftests/vm/.gitignore | 1
tools/testing/selftests/vm/Makefile | 75
tools/testing/selftests/vm/mremap_dontunmap.c | 1
tools/testing/selftests/vm/pkey-helpers.h | 557 +-
tools/testing/selftests/vm/pkey-powerpc.h | 153
tools/testing/selftests/vm/pkey-x86.h | 191
tools/testing/selftests/vm/protection_keys.c | 2370 ++++++++--
tools/testing/selftests/x86/.gitignore | 1
tools/testing/selftests/x86/Makefile | 2
tools/testing/selftests/x86/pkey-helpers.h | 219
tools/testing/selftests/x86/protection_keys.c | 1506 ------
200 files changed, 5182 insertions(+), 4033 deletions(-)
^ permalink raw reply [flat|nested] 232+ messages in thread
* incoming
@ 2020-06-08 4:35 Andrew Morton
0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2020-06-08 4:35 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm
Various trees. Mainly those parts of MM whose linux-next dependents
are now merged. I'm still sitting on ~160 patches which await merges
from -next.
54 patches, based on 9aa900c8094dba7a60dc805ecec1e9f720744ba1.
Subsystems affected by this patch series:
mm/proc
ipc
dynamic-debug
panic
lib
sysctl
mm/gup
mm/pagemap
Subsystem: mm/proc
SeongJae Park <sjpark@amazon.de>:
mm/page_idle.c: skip offline pages
Subsystem: ipc
Jules Irenge <jbi.octave@gmail.com>:
ipc/msg: add missing annotation for freeque()
Giuseppe Scrivano <gscrivan@redhat.com>:
ipc/namespace.c: use a work queue to free_ipc
Subsystem: dynamic-debug
Orson Zhai <orson.zhai@unisoc.com>:
dynamic_debug: add an option to enable dynamic debug for modules only
Subsystem: panic
Rafael Aquini <aquini@redhat.com>:
kernel: add panic_on_taint
Subsystem: lib
Manfred Spraul <manfred@colorfullife.com>:
xarray.h: correct return code documentation for xa_store_{bh,irq}()
Subsystem: sysctl
Vlastimil Babka <vbabka@suse.cz>:
Patch series "support setting sysctl parameters from kernel command line", v3:
kernel/sysctl: support setting sysctl parameters from kernel command line
kernel/sysctl: support handling command line aliases
kernel/hung_task convert hung_task_panic boot parameter to sysctl
tools/testing/selftests/sysctl/sysctl.sh: support CONFIG_TEST_SYSCTL=y
lib/test_sysctl: support testing of sysctl. boot parameter
"Guilherme G. Piccoli" <gpiccoli@canonical.com>:
kernel/watchdog.c: convert {soft/hard}lockup boot parameters to sysctl aliases
kernel/hung_task.c: introduce sysctl to print all traces when a hung task is detected
panic: add sysctl to dump all CPUs backtraces on oops event
Rafael Aquini <aquini@redhat.com>:
kernel/sysctl.c: ignore out-of-range taint bits introduced via kernel.tainted
Subsystem: mm/gup
Souptick Joarder <jrdr.linux@gmail.com>:
mm/gup.c: convert to use get_user_{page|pages}_fast_only()
John Hubbard <jhubbard@nvidia.com>:
mm/gup: update pin_user_pages.rst for "case 3" (mmu notifiers)
Patch series "mm/gup: introduce pin_user_pages_locked(), use it in frame_vector.c", v2:
mm/gup: introduce pin_user_pages_locked()
mm/gup: frame_vector: convert get_user_pages() --> pin_user_pages()
mm/gup: documentation fix for pin_user_pages*() APIs
Patch series "vhost, docs: convert to pin_user_pages(), new "case 5"":
docs: mm/gup: pin_user_pages.rst: add a "case 5"
vhost: convert get_user_pages() --> pin_user_pages()
Subsystem: mm/pagemap
Alexander Gordeev <agordeev@linux.ibm.com>:
mm/mmap.c: add more sanity checks to get_unmapped_area()
mm/mmap.c: do not allow mappings outside of allowed limits
Christoph Hellwig <hch@lst.de>:
Patch series "sort out the flush_icache_range mess", v2:
arm: fix the flush_icache_range arguments in set_fiq_handler
nds32: unexport flush_icache_page
powerpc: unexport flush_icache_user_range
unicore32: remove flush_cache_user_range
asm-generic: fix the inclusion guards for cacheflush.h
asm-generic: don't include <linux/mm.h> in cacheflush.h
asm-generic: improve the flush_dcache_page stub
alpha: use asm-generic/cacheflush.h
arm64: use asm-generic/cacheflush.h
c6x: use asm-generic/cacheflush.h
hexagon: use asm-generic/cacheflush.h
ia64: use asm-generic/cacheflush.h
microblaze: use asm-generic/cacheflush.h
m68knommu: use asm-generic/cacheflush.h
openrisc: use asm-generic/cacheflush.h
powerpc: use asm-generic/cacheflush.h
riscv: use asm-generic/cacheflush.h
arm,sparc,unicore32: remove flush_icache_user_range
mm: rename flush_icache_user_range to flush_icache_user_page
asm-generic: add a flush_icache_user_range stub
sh: implement flush_icache_user_range
xtensa: implement flush_icache_user_range
arm: rename flush_cache_user_range to flush_icache_user_range
m68k: implement flush_icache_user_range
exec: only build read_code when needed
exec: use flush_icache_user_range in read_code
binfmt_flat: use flush_icache_user_range
nommu: use flush_icache_user_range in brk and mmap
module: move the set_fs hack for flush_icache_range to m68k
Konstantin Khlebnikov <khlebnikov@yandex-team.ru>:
doc: cgroup: update note about conditions when oom killer is invoked
Documentation/admin-guide/cgroup-v2.rst | 17 +-
Documentation/admin-guide/dynamic-debug-howto.rst | 5
Documentation/admin-guide/kdump/kdump.rst | 8 +
Documentation/admin-guide/kernel-parameters.txt | 34 +++-
Documentation/admin-guide/sysctl/kernel.rst | 37 ++++
Documentation/core-api/pin_user_pages.rst | 47 ++++--
arch/alpha/include/asm/cacheflush.h | 38 +----
arch/alpha/kernel/smp.c | 2
arch/arm/include/asm/cacheflush.h | 7
arch/arm/kernel/fiq.c | 4
arch/arm/kernel/traps.c | 2
arch/arm64/include/asm/cacheflush.h | 46 ------
arch/c6x/include/asm/cacheflush.h | 19 --
arch/hexagon/include/asm/cacheflush.h | 19 --
arch/ia64/include/asm/cacheflush.h | 30 ----
arch/m68k/include/asm/cacheflush_mm.h | 6
arch/m68k/include/asm/cacheflush_no.h | 19 --
arch/m68k/mm/cache.c | 13 +
arch/microblaze/include/asm/cacheflush.h | 29 ---
arch/nds32/include/asm/cacheflush.h | 4
arch/nds32/mm/cacheflush.c | 3
arch/openrisc/include/asm/cacheflush.h | 33 ----
arch/powerpc/include/asm/cacheflush.h | 46 +-----
arch/powerpc/kvm/book3s_64_mmu_hv.c | 2
arch/powerpc/kvm/book3s_64_mmu_radix.c | 2
arch/powerpc/mm/mem.c | 3
arch/powerpc/perf/callchain_64.c | 4
arch/riscv/include/asm/cacheflush.h | 65 --------
arch/sh/include/asm/cacheflush.h | 1
arch/sparc/include/asm/cacheflush_32.h | 2
arch/sparc/include/asm/cacheflush_64.h | 1
arch/um/include/asm/tlb.h | 2
arch/unicore32/include/asm/cacheflush.h | 11 -
arch/x86/include/asm/cacheflush.h | 2
arch/xtensa/include/asm/cacheflush.h | 2
drivers/media/platform/omap3isp/ispvideo.c | 2
drivers/nvdimm/pmem.c | 3
drivers/vhost/vhost.c | 5
fs/binfmt_flat.c | 2
fs/exec.c | 5
fs/proc/proc_sysctl.c | 163 ++++++++++++++++++++--
include/asm-generic/cacheflush.h | 25 +--
include/linux/dev_printk.h | 6
include/linux/dynamic_debug.h | 2
include/linux/ipc_namespace.h | 2
include/linux/kernel.h | 9 +
include/linux/mm.h | 12 +
include/linux/net.h | 3
include/linux/netdevice.h | 6
include/linux/printk.h | 9 -
include/linux/sched/sysctl.h | 7
include/linux/sysctl.h | 4
include/linux/xarray.h | 4
include/rdma/ib_verbs.h | 6
init/main.c | 2
ipc/msg.c | 2
ipc/namespace.c | 24 ++-
kernel/events/core.c | 4
kernel/events/uprobes.c | 2
kernel/hung_task.c | 30 ++--
kernel/module.c | 8 -
kernel/panic.c | 45 ++++++
kernel/sysctl.c | 38 ++++-
kernel/watchdog.c | 37 +---
lib/Kconfig.debug | 12 +
lib/Makefile | 2
lib/dynamic_debug.c | 9 -
lib/test_sysctl.c | 13 +
mm/frame_vector.c | 7
mm/gup.c | 74 +++++++--
mm/mmap.c | 28 ++-
mm/nommu.c | 4
mm/page_alloc.c | 9 -
mm/page_idle.c | 7
tools/testing/selftests/sysctl/sysctl.sh | 44 +++++
virt/kvm/kvm_main.c | 8 -
76 files changed, 732 insertions(+), 517 deletions(-)
^ permalink raw reply [flat|nested] 232+ messages in thread
* incoming
@ 2020-06-09 4:29 Andrew Morton
0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2020-06-09 4:29 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm
- a kernel-wide sweep of show_stack()
- pagetable cleanups
- abstract out accesses to mmap_sem - prep for mmap_sem scalability work
- hch's user acess work
93 patches, based on abfbb29297c27e3f101f348dc9e467b0fe70f919:
Subsystems affected by this patch series:
debug
mm/pagemap
mm/maccess
mm/documentation
Subsystem: debug
Dmitry Safonov <dima@arista.com>:
Patch series "Add log level to show_stack()", v3:
kallsyms/printk: add loglvl to print_ip_sym()
alpha: add show_stack_loglvl()
arc: add show_stack_loglvl()
arm/asm: add loglvl to c_backtrace()
arm: add loglvl to unwind_backtrace()
arm: add loglvl to dump_backtrace()
arm: wire up dump_backtrace_{entry,stm}
arm: add show_stack_loglvl()
arm64: add loglvl to dump_backtrace()
arm64: add show_stack_loglvl()
c6x: add show_stack_loglvl()
csky: add show_stack_loglvl()
h8300: add show_stack_loglvl()
hexagon: add show_stack_loglvl()
ia64: pass log level as arg into ia64_do_show_stack()
ia64: add show_stack_loglvl()
m68k: add show_stack_loglvl()
microblaze: add loglvl to microblaze_unwind_inner()
microblaze: add loglvl to microblaze_unwind()
microblaze: add show_stack_loglvl()
mips: add show_stack_loglvl()
nds32: add show_stack_loglvl()
nios2: add show_stack_loglvl()
openrisc: add show_stack_loglvl()
parisc: add show_stack_loglvl()
powerpc: add show_stack_loglvl()
riscv: add show_stack_loglvl()
s390: add show_stack_loglvl()
sh: add loglvl to dump_mem()
sh: remove needless printk()
sh: add loglvl to printk_address()
sh: add loglvl to show_trace()
sh: add show_stack_loglvl()
sparc: add show_stack_loglvl()
um/sysrq: remove needless variable sp
um: add show_stack_loglvl()
unicore32: remove unused pmode argument in c_backtrace()
unicore32: add loglvl to c_backtrace()
unicore32: add show_stack_loglvl()
x86: add missing const qualifiers for log_lvl
x86: add show_stack_loglvl()
xtensa: add loglvl to show_trace()
xtensa: add show_stack_loglvl()
sysrq: use show_stack_loglvl()
x86/amd_gart: print stacktrace for a leak with KERN_ERR
power: use show_stack_loglvl()
kdb: don't play with console_loglevel
sched: print stack trace with KERN_INFO
kernel: use show_stack_loglvl()
kernel: rename show_stack_loglvl() => show_stack()
Subsystem: mm/pagemap
Mike Rapoport <rppt@linux.ibm.com>:
Patch series "mm: consolidate definitions of page table accessors", v2:
mm: don't include asm/pgtable.h if linux/mm.h is already included
mm: introduce include/linux/pgtable.h
mm: reorder includes after introduction of linux/pgtable.h
csky: replace definitions of __pXd_offset() with pXd_index()
m68k/mm/motorola: move comment about page table allocation funcitons
m68k/mm: move {cache,nocahe}_page() definitions close to their user
x86/mm: simplify init_trampoline() and surrounding logic
mm: pgtable: add shortcuts for accessing kernel PMD and PTE
mm: consolidate pte_index() and pte_offset_*() definitions
Michel Lespinasse <walken@google.com>:
mmap locking API: initial implementation as rwsem wrappers
MMU notifier: use the new mmap locking API
DMA reservations: use the new mmap locking API
mmap locking API: use coccinelle to convert mmap_sem rwsem call sites
mmap locking API: convert mmap_sem call sites missed by coccinelle
mmap locking API: convert nested write lock sites
mmap locking API: add mmap_read_trylock_non_owner()
mmap locking API: add MMAP_LOCK_INITIALIZER
mmap locking API: add mmap_assert_locked() and mmap_assert_write_locked()
mmap locking API: rename mmap_sem to mmap_lock
mmap locking API: convert mmap_sem API comments
mmap locking API: convert mmap_sem comments
Subsystem: mm/maccess
Christoph Hellwig <hch@lst.de>:
Patch series "clean up and streamline probe_kernel_* and friends", v4:
maccess: unexport probe_kernel_write()
maccess: remove various unused weak aliases
maccess: remove duplicate kerneldoc comments
maccess: clarify kerneldoc comments
maccess: update the top of file comment
maccess: rename strncpy_from_unsafe_user to strncpy_from_user_nofault
maccess: rename strncpy_from_unsafe_strict to strncpy_from_kernel_nofault
maccess: rename strnlen_unsafe_user to strnlen_user_nofault
maccess: remove probe_read_common and probe_write_common
maccess: unify the probe kernel arch hooks
bpf: factor out a bpf_trace_copy_string helper
bpf: handle the compat string in bpf_trace_copy_string better
Andrew Morton <akpm@linux-foundation.org>:
bpf:bpf_seq_printf(): handle potentially unsafe format string better
Christoph Hellwig <hch@lst.de>:
bpf: rework the compat kernel probe handling
tracing/kprobes: handle mixed kernel/userspace probes better
maccess: remove strncpy_from_unsafe
maccess: always use strict semantics for probe_kernel_read
maccess: move user access routines together
maccess: allow architectures to provide kernel probing directly
x86: use non-set_fs based maccess routines
maccess: return -ERANGE when probe_kernel_read() fails
Subsystem: mm/documentation
Luis Chamberlain <mcgrof@kernel.org>:
include/linux/cache.h: expand documentation over __read_mostly
Documentation/admin-guide/mm/numa_memory_policy.rst | 10
Documentation/admin-guide/mm/userfaultfd.rst | 2
Documentation/filesystems/locking.rst | 2
Documentation/vm/hmm.rst | 6
Documentation/vm/transhuge.rst | 4
arch/alpha/boot/bootp.c | 1
arch/alpha/boot/bootpz.c | 1
arch/alpha/boot/main.c | 1
arch/alpha/include/asm/io.h | 1
arch/alpha/include/asm/pgtable.h | 16
arch/alpha/kernel/process.c | 1
arch/alpha/kernel/proto.h | 4
arch/alpha/kernel/ptrace.c | 1
arch/alpha/kernel/setup.c | 1
arch/alpha/kernel/smp.c | 1
arch/alpha/kernel/sys_alcor.c | 1
arch/alpha/kernel/sys_cabriolet.c | 1
arch/alpha/kernel/sys_dp264.c | 1
arch/alpha/kernel/sys_eb64p.c | 1
arch/alpha/kernel/sys_eiger.c | 1
arch/alpha/kernel/sys_jensen.c | 1
arch/alpha/kernel/sys_marvel.c | 1
arch/alpha/kernel/sys_miata.c | 1
arch/alpha/kernel/sys_mikasa.c | 1
arch/alpha/kernel/sys_nautilus.c | 1
arch/alpha/kernel/sys_noritake.c | 1
arch/alpha/kernel/sys_rawhide.c | 1
arch/alpha/kernel/sys_ruffian.c | 1
arch/alpha/kernel/sys_rx164.c | 1
arch/alpha/kernel/sys_sable.c | 1
arch/alpha/kernel/sys_sio.c | 1
arch/alpha/kernel/sys_sx164.c | 1
arch/alpha/kernel/sys_takara.c | 1
arch/alpha/kernel/sys_titan.c | 1
arch/alpha/kernel/sys_wildfire.c | 1
arch/alpha/kernel/traps.c | 40
arch/alpha/mm/fault.c | 12
arch/alpha/mm/init.c | 1
arch/arc/include/asm/bug.h | 3
arch/arc/include/asm/pgtable.h | 24
arch/arc/kernel/process.c | 4
arch/arc/kernel/stacktrace.c | 29
arch/arc/kernel/troubleshoot.c | 6
arch/arc/mm/fault.c | 6
arch/arc/mm/highmem.c | 14
arch/arc/mm/tlbex.S | 4
arch/arm/include/asm/bug.h | 3
arch/arm/include/asm/efi.h | 3
arch/arm/include/asm/fixmap.h | 4
arch/arm/include/asm/idmap.h | 2
arch/arm/include/asm/pgtable-2level.h | 1
arch/arm/include/asm/pgtable-3level.h | 7
arch/arm/include/asm/pgtable-nommu.h | 3
arch/arm/include/asm/pgtable.h | 25
arch/arm/include/asm/traps.h | 3
arch/arm/include/asm/unwind.h | 3
arch/arm/kernel/head.S | 4
arch/arm/kernel/machine_kexec.c | 1
arch/arm/kernel/module.c | 1
arch/arm/kernel/process.c | 4
arch/arm/kernel/ptrace.c | 1
arch/arm/kernel/smp.c | 1
arch/arm/kernel/suspend.c | 4
arch/arm/kernel/swp_emulate.c | 4
arch/arm/kernel/traps.c | 61
arch/arm/kernel/unwind.c | 7
arch/arm/kernel/vdso.c | 2
arch/arm/kernel/vmlinux.lds.S | 4
arch/arm/lib/backtrace-clang.S | 9
arch/arm/lib/backtrace.S | 14
arch/arm/lib/uaccess_with_memcpy.c | 16
arch/arm/mach-ebsa110/core.c | 1
arch/arm/mach-footbridge/common.c | 1
arch/arm/mach-imx/mm-imx21.c | 1
arch/arm/mach-imx/mm-imx27.c | 1
arch/arm/mach-imx/mm-imx3.c | 1
arch/arm/mach-integrator/core.c | 4
arch/arm/mach-iop32x/i2c.c | 1
arch/arm/mach-iop32x/iq31244.c | 1
arch/arm/mach-iop32x/iq80321.c | 1
arch/arm/mach-iop32x/n2100.c | 1
arch/arm/mach-ixp4xx/common.c | 1
arch/arm/mach-keystone/platsmp.c | 4
arch/arm/mach-sa1100/assabet.c | 3
arch/arm/mach-sa1100/hackkit.c | 4
arch/arm/mach-tegra/iomap.h | 2
arch/arm/mach-zynq/common.c | 4
arch/arm/mm/copypage-v4mc.c | 1
arch/arm/mm/copypage-v6.c | 1
arch/arm/mm/copypage-xscale.c | 1
arch/arm/mm/dump.c | 1
arch/arm/mm/fault-armv.c | 1
arch/arm/mm/fault.c | 9
arch/arm/mm/highmem.c | 4
arch/arm/mm/idmap.c | 4
arch/arm/mm/ioremap.c | 31
arch/arm/mm/mm.h | 8
arch/arm/mm/mmu.c | 7
arch/arm/mm/pageattr.c | 1
arch/arm/mm/proc-arm1020.S | 4
arch/arm/mm/proc-arm1020e.S | 4
arch/arm/mm/proc-arm1022.S | 4
arch/arm/mm/proc-arm1026.S | 4
arch/arm/mm/proc-arm720.S | 4
arch/arm/mm/proc-arm740.S | 4
arch/arm/mm/proc-arm7tdmi.S | 4
arch/arm/mm/proc-arm920.S | 4
arch/arm/mm/proc-arm922.S | 4
arch/arm/mm/proc-arm925.S | 4
arch/arm/mm/proc-arm926.S | 4
arch/arm/mm/proc-arm940.S | 4
arch/arm/mm/proc-arm946.S | 4
arch/arm/mm/proc-arm9tdmi.S | 4
arch/arm/mm/proc-fa526.S | 4
arch/arm/mm/proc-feroceon.S | 4
arch/arm/mm/proc-mohawk.S | 4
arch/arm/mm/proc-sa110.S | 4
arch/arm/mm/proc-sa1100.S | 4
arch/arm/mm/proc-v6.S | 4
arch/arm/mm/proc-v7.S | 4
arch/arm/mm/proc-xsc3.S | 4
arch/arm/mm/proc-xscale.S | 4
arch/arm/mm/pv-fixup-asm.S | 4
arch/arm64/include/asm/io.h | 4
arch/arm64/include/asm/kernel-pgtable.h | 2
arch/arm64/include/asm/kvm_mmu.h | 4
arch/arm64/include/asm/mmu_context.h | 4
arch/arm64/include/asm/pgtable.h | 40
arch/arm64/include/asm/stacktrace.h | 3
arch/arm64/include/asm/stage2_pgtable.h | 2
arch/arm64/include/asm/vmap_stack.h | 4
arch/arm64/kernel/acpi.c | 4
arch/arm64/kernel/head.S | 4
arch/arm64/kernel/hibernate.c | 5
arch/arm64/kernel/kaslr.c | 4
arch/arm64/kernel/process.c | 2
arch/arm64/kernel/ptrace.c | 1
arch/arm64/kernel/smp.c | 1
arch/arm64/kernel/suspend.c | 4
arch/arm64/kernel/traps.c | 37
arch/arm64/kernel/vdso.c | 8
arch/arm64/kernel/vmlinux.lds.S | 3
arch/arm64/kvm/mmu.c | 14
arch/arm64/mm/dump.c | 1
arch/arm64/mm/fault.c | 9
arch/arm64/mm/kasan_init.c | 3
arch/arm64/mm/mmu.c | 8
arch/arm64/mm/pageattr.c | 1
arch/arm64/mm/proc.S | 4
arch/c6x/include/asm/pgtable.h | 3
arch/c6x/kernel/traps.c | 28
arch/csky/include/asm/io.h | 2
arch/csky/include/asm/pgtable.h | 37
arch/csky/kernel/module.c | 1
arch/csky/kernel/ptrace.c | 5
arch/csky/kernel/stacktrace.c | 20
arch/csky/kernel/vdso.c | 4
arch/csky/mm/fault.c | 10
arch/csky/mm/highmem.c | 2
arch/csky/mm/init.c | 7
arch/csky/mm/tlb.c | 1
arch/h8300/include/asm/pgtable.h | 1
arch/h8300/kernel/process.c | 1
arch/h8300/kernel/setup.c | 1
arch/h8300/kernel/signal.c | 1
arch/h8300/kernel/traps.c | 26
arch/h8300/mm/fault.c | 1
arch/h8300/mm/init.c | 1
arch/h8300/mm/memory.c | 1
arch/hexagon/include/asm/fixmap.h | 4
arch/hexagon/include/asm/pgtable.h | 55
arch/hexagon/kernel/traps.c | 39
arch/hexagon/kernel/vdso.c | 4
arch/hexagon/mm/uaccess.c | 2
arch/hexagon/mm/vm_fault.c | 9
arch/ia64/include/asm/pgtable.h | 34
arch/ia64/include/asm/ptrace.h | 1
arch/ia64/include/asm/uaccess.h | 2
arch/ia64/kernel/efi.c | 1
arch/ia64/kernel/entry.S | 4
arch/ia64/kernel/head.S | 5
arch/ia64/kernel/irq_ia64.c | 4
arch/ia64/kernel/ivt.S | 4
arch/ia64/kernel/kprobes.c | 4
arch/ia64/kernel/mca.c | 2
arch/ia64/kernel/mca_asm.S | 4
arch/ia64/kernel/perfmon.c | 8
arch/ia64/kernel/process.c | 37
arch/ia64/kernel/ptrace.c | 1
arch/ia64/kernel/relocate_kernel.S | 6
arch/ia64/kernel/setup.c | 4
arch/ia64/kernel/smp.c | 1
arch/ia64/kernel/smpboot.c | 1
arch/ia64/kernel/uncached.c | 4
arch/ia64/kernel/vmlinux.lds.S | 4
arch/ia64/mm/contig.c | 1
arch/ia64/mm/fault.c | 17
arch/ia64/mm/init.c | 12
arch/m68k/68000/m68EZ328.c | 2
arch/m68k/68000/m68VZ328.c | 4
arch/m68k/68000/timers.c | 1
arch/m68k/amiga/config.c | 1
arch/m68k/apollo/config.c | 1
arch/m68k/atari/atasound.c | 1
arch/m68k/atari/stram.c | 1
arch/m68k/bvme6000/config.c | 1
arch/m68k/include/asm/mcf_pgtable.h | 63
arch/m68k/include/asm/motorola_pgalloc.h | 8
arch/m68k/include/asm/motorola_pgtable.h | 84 -
arch/m68k/include/asm/pgtable_mm.h | 1
arch/m68k/include/asm/pgtable_no.h | 2
arch/m68k/include/asm/sun3_pgtable.h | 24
arch/m68k/include/asm/sun3xflop.h | 4
arch/m68k/kernel/head.S | 4
arch/m68k/kernel/process.c | 1
arch/m68k/kernel/ptrace.c | 1
arch/m68k/kernel/setup_no.c | 1
arch/m68k/kernel/signal.c | 1
arch/m68k/kernel/sys_m68k.c | 14
arch/m68k/kernel/traps.c | 27
arch/m68k/kernel/uboot.c | 1
arch/m68k/mac/config.c | 1
arch/m68k/mm/fault.c | 10
arch/m68k/mm/init.c | 2
arch/m68k/mm/mcfmmu.c | 1
arch/m68k/mm/motorola.c | 65
arch/m68k/mm/sun3kmap.c | 1
arch/m68k/mm/sun3mmu.c | 1
arch/m68k/mvme147/config.c | 1
arch/m68k/mvme16x/config.c | 1
arch/m68k/q40/config.c | 1
arch/m68k/sun3/config.c | 1
arch/m68k/sun3/dvma.c | 1
arch/m68k/sun3/mmu_emu.c | 1
arch/m68k/sun3/sun3dvma.c | 1
arch/m68k/sun3x/dvma.c | 1
arch/m68k/sun3x/prom.c | 1
arch/microblaze/include/asm/pgalloc.h | 4
arch/microblaze/include/asm/pgtable.h | 23
arch/microblaze/include/asm/uaccess.h | 2
arch/microblaze/include/asm/unwind.h | 3
arch/microblaze/kernel/hw_exception_handler.S | 4
arch/microblaze/kernel/module.c | 4
arch/microblaze/kernel/setup.c | 4
arch/microblaze/kernel/signal.c | 9
arch/microblaze/kernel/stacktrace.c | 4
arch/microblaze/kernel/traps.c | 28
arch/microblaze/kernel/unwind.c | 46
arch/microblaze/mm/fault.c | 17
arch/microblaze/mm/init.c | 9
arch/microblaze/mm/pgtable.c | 4
arch/mips/fw/arc/memory.c | 1
arch/mips/include/asm/fixmap.h | 3
arch/mips/include/asm/mach-generic/floppy.h | 1
arch/mips/include/asm/mach-jazz/floppy.h | 1
arch/mips/include/asm/pgtable-32.h | 22
arch/mips/include/asm/pgtable-64.h | 32
arch/mips/include/asm/pgtable.h | 2
arch/mips/jazz/irq.c | 4
arch/mips/jazz/jazzdma.c | 1
arch/mips/jazz/setup.c | 4
arch/mips/kernel/module.c | 1
arch/mips/kernel/process.c | 1
arch/mips/kernel/ptrace.c | 1
arch/mips/kernel/ptrace32.c | 1
arch/mips/kernel/smp-bmips.c | 1
arch/mips/kernel/traps.c | 58
arch/mips/kernel/vdso.c | 4
arch/mips/kvm/mips.c | 4
arch/mips/kvm/mmu.c | 20
arch/mips/kvm/tlb.c | 1
arch/mips/kvm/trap_emul.c | 2
arch/mips/lib/dump_tlb.c | 1
arch/mips/lib/r3k_dump_tlb.c | 1
arch/mips/mm/c-octeon.c | 1
arch/mips/mm/c-r3k.c | 11
arch/mips/mm/c-r4k.c | 11
arch/mips/mm/c-tx39.c | 11
arch/mips/mm/fault.c | 12
arch/mips/mm/highmem.c | 2
arch/mips/mm/init.c | 1
arch/mips/mm/page.c | 1
arch/mips/mm/pgtable-32.c | 1
arch/mips/mm/pgtable-64.c | 1
arch/mips/mm/sc-ip22.c | 1
arch/mips/mm/sc-mips.c | 1
arch/mips/mm/sc-r5k.c | 1
arch/mips/mm/tlb-r3k.c | 1
arch/mips/mm/tlb-r4k.c | 1
arch/mips/mm/tlbex.c | 4
arch/mips/sgi-ip27/ip27-init.c | 1
arch/mips/sgi-ip27/ip27-timer.c | 1
arch/mips/sgi-ip32/ip32-memory.c | 1
arch/nds32/include/asm/highmem.h | 3
arch/nds32/include/asm/pgtable.h | 22
arch/nds32/kernel/head.S | 4
arch/nds32/kernel/module.c | 2
arch/nds32/kernel/traps.c | 33
arch/nds32/kernel/vdso.c | 6
arch/nds32/mm/fault.c | 17
arch/nds32/mm/init.c | 13
arch/nds32/mm/proc.c | 7
arch/nios2/include/asm/pgtable.h | 24
arch/nios2/kernel/module.c | 1
arch/nios2/kernel/nios2_ksyms.c | 4
arch/nios2/kernel/traps.c | 35
arch/nios2/mm/fault.c | 14
arch/nios2/mm/init.c | 5
arch/nios2/mm/pgtable.c | 1
arch/nios2/mm/tlb.c | 1
arch/openrisc/include/asm/io.h | 3
arch/openrisc/include/asm/pgtable.h | 33
arch/openrisc/include/asm/tlbflush.h | 1
arch/openrisc/kernel/asm-offsets.c | 1
arch/openrisc/kernel/entry.S | 4
arch/openrisc/kernel/head.S | 4
arch/openrisc/kernel/or32_ksyms.c | 4
arch/openrisc/kernel/process.c | 1
arch/openrisc/kernel/ptrace.c | 1
arch/openrisc/kernel/setup.c | 1
arch/openrisc/kernel/traps.c | 27
arch/openrisc/mm/fault.c | 12
arch/openrisc/mm/init.c | 1
arch/openrisc/mm/ioremap.c | 4
arch/openrisc/mm/tlb.c | 1
arch/parisc/include/asm/io.h | 2
arch/parisc/include/asm/mmu_context.h | 1
arch/parisc/include/asm/pgtable.h | 33
arch/parisc/kernel/asm-offsets.c | 4
arch/parisc/kernel/entry.S | 4
arch/parisc/kernel/head.S | 4
arch/parisc/kernel/module.c | 1
arch/parisc/kernel/pacache.S | 4
arch/parisc/kernel/pci-dma.c | 2
arch/parisc/kernel/pdt.c | 4
arch/parisc/kernel/ptrace.c | 1
arch/parisc/kernel/smp.c | 1
arch/parisc/kernel/traps.c | 42
arch/parisc/lib/memcpy.c | 14
arch/parisc/mm/fault.c | 10
arch/parisc/mm/fixmap.c | 6
arch/parisc/mm/init.c | 1
arch/powerpc/include/asm/book3s/32/pgtable.h | 20
arch/powerpc/include/asm/book3s/64/pgtable.h | 43
arch/powerpc/include/asm/fixmap.h | 4
arch/powerpc/include/asm/io.h | 1
arch/powerpc/include/asm/kup.h | 2
arch/powerpc/include/asm/nohash/32/pgtable.h | 17
arch/powerpc/include/asm/nohash/64/pgtable-4k.h | 4
arch/powerpc/include/asm/nohash/64/pgtable.h | 22
arch/powerpc/include/asm/nohash/pgtable.h | 2
arch/powerpc/include/asm/pgtable.h | 28
arch/powerpc/include/asm/pkeys.h | 2
arch/powerpc/include/asm/tlb.h | 2
arch/powerpc/kernel/asm-offsets.c | 1
arch/powerpc/kernel/btext.c | 4
arch/powerpc/kernel/fpu.S | 3
arch/powerpc/kernel/head_32.S | 4
arch/powerpc/kernel/head_40x.S | 4
arch/powerpc/kernel/head_44x.S | 4
arch/powerpc/kernel/head_8xx.S | 4
arch/powerpc/kernel/head_fsl_booke.S | 4
arch/powerpc/kernel/io-workarounds.c | 4
arch/powerpc/kernel/irq.c | 4
arch/powerpc/kernel/mce_power.c | 4
arch/powerpc/kernel/paca.c | 4
arch/powerpc/kernel/process.c | 30
arch/powerpc/kernel/prom.c | 4
arch/powerpc/kernel/prom_init.c | 4
arch/powerpc/kernel/rtas_pci.c | 4
arch/powerpc/kernel/setup-common.c | 4
arch/powerpc/kernel/setup_32.c | 4
arch/powerpc/kernel/setup_64.c | 4
arch/powerpc/kernel/signal_32.c | 1
arch/powerpc/kernel/signal_64.c | 1
arch/powerpc/kernel/smp.c | 4
arch/powerpc/kernel/stacktrace.c | 2
arch/powerpc/kernel/traps.c | 1
arch/powerpc/kernel/vdso.c | 7
arch/powerpc/kvm/book3s_64_mmu_radix.c | 4
arch/powerpc/kvm/book3s_hv.c | 6
arch/powerpc/kvm/book3s_hv_nested.c | 4
arch/powerpc/kvm/book3s_hv_rm_xics.c | 4
arch/powerpc/kvm/book3s_hv_rm_xive.c | 4
arch/powerpc/kvm/book3s_hv_uvmem.c | 18
arch/powerpc/kvm/e500_mmu_host.c | 4
arch/powerpc/kvm/fpu.S | 4
arch/powerpc/lib/code-patching.c | 1
arch/powerpc/mm/book3s32/hash_low.S | 4
arch/powerpc/mm/book3s32/mmu.c | 2
arch/powerpc/mm/book3s32/tlb.c | 6
arch/powerpc/mm/book3s64/hash_hugetlbpage.c | 1
arch/powerpc/mm/book3s64/hash_native.c | 4
arch/powerpc/mm/book3s64/hash_pgtable.c | 5
arch/powerpc/mm/book3s64/hash_utils.c | 4
arch/powerpc/mm/book3s64/iommu_api.c | 4
arch/powerpc/mm/book3s64/radix_hugetlbpage.c | 1
arch/powerpc/mm/book3s64/radix_pgtable.c | 1
arch/powerpc/mm/book3s64/slb.c | 4
arch/powerpc/mm/book3s64/subpage_prot.c | 16
arch/powerpc/mm/copro_fault.c | 4
arch/powerpc/mm/fault.c | 23
arch/powerpc/mm/hugetlbpage.c | 1
arch/powerpc/mm/init-common.c | 4
arch/powerpc/mm/init_32.c | 1
arch/powerpc/mm/init_64.c | 1
arch/powerpc/mm/kasan/8xx.c | 4
arch/powerpc/mm/kasan/book3s_32.c | 2
arch/powerpc/mm/kasan/kasan_init_32.c | 8
arch/powerpc/mm/mem.c | 1
arch/powerpc/mm/nohash/40x.c | 5
arch/powerpc/mm/nohash/8xx.c | 2
arch/powerpc/mm/nohash/fsl_booke.c | 1
arch/powerpc/mm/nohash/tlb_low_64e.S | 4
arch/powerpc/mm/pgtable.c | 2
arch/powerpc/mm/pgtable_32.c | 5
arch/powerpc/mm/pgtable_64.c | 1
arch/powerpc/mm/ptdump/8xx.c | 2
arch/powerpc/mm/ptdump/bats.c | 4
arch/powerpc/mm/ptdump/book3s64.c | 2
arch/powerpc/mm/ptdump/hashpagetable.c | 1
arch/powerpc/mm/ptdump/ptdump.c | 1
arch/powerpc/mm/ptdump/shared.c | 2
arch/powerpc/oprofile/cell/spu_task_sync.c | 6
arch/powerpc/perf/callchain.c | 1
arch/powerpc/perf/callchain_32.c | 1
arch/powerpc/perf/callchain_64.c | 1
arch/powerpc/platforms/85xx/corenet_generic.c | 4
arch/powerpc/platforms/85xx/mpc85xx_cds.c | 4
arch/powerpc/platforms/85xx/qemu_e500.c | 4
arch/powerpc/platforms/85xx/sbc8548.c | 4
arch/powerpc/platforms/85xx/smp.c | 4
arch/powerpc/platforms/86xx/mpc86xx_smp.c | 4
arch/powerpc/platforms/8xx/cpm1.c | 1
arch/powerpc/platforms/8xx/micropatch.c | 1
arch/powerpc/platforms/cell/cbe_regs.c | 4
arch/powerpc/platforms/cell/interrupt.c | 4
arch/powerpc/platforms/cell/pervasive.c | 4
arch/powerpc/platforms/cell/setup.c | 1
arch/powerpc/platforms/cell/smp.c | 4
arch/powerpc/platforms/cell/spider-pic.c | 4
arch/powerpc/platforms/cell/spufs/file.c | 10
arch/powerpc/platforms/chrp/pci.c | 4
arch/powerpc/platforms/chrp/setup.c | 1
arch/powerpc/platforms/chrp/smp.c | 4
arch/powerpc/platforms/maple/setup.c | 1
arch/powerpc/platforms/maple/time.c | 1
arch/powerpc/platforms/powermac/setup.c | 1
arch/powerpc/platforms/powermac/smp.c | 4
arch/powerpc/platforms/powermac/time.c | 1
arch/powerpc/platforms/pseries/lpar.c | 4
arch/powerpc/platforms/pseries/setup.c | 1
arch/powerpc/platforms/pseries/smp.c | 4
arch/powerpc/sysdev/cpm2.c | 1
arch/powerpc/sysdev/fsl_85xx_cache_sram.c | 2
arch/powerpc/sysdev/mpic.c | 4
arch/powerpc/xmon/xmon.c | 1
arch/riscv/include/asm/fixmap.h | 4
arch/riscv/include/asm/io.h | 4
arch/riscv/include/asm/kasan.h | 4
arch/riscv/include/asm/pgtable-64.h | 7
arch/riscv/include/asm/pgtable.h | 22
arch/riscv/kernel/module.c | 2
arch/riscv/kernel/setup.c | 1
arch/riscv/kernel/soc.c | 2
arch/riscv/kernel/stacktrace.c | 23
arch/riscv/kernel/vdso.c | 4
arch/riscv/mm/cacheflush.c | 3
arch/riscv/mm/fault.c | 14
arch/riscv/mm/init.c | 31
arch/riscv/mm/kasan_init.c | 4
arch/riscv/mm/pageattr.c | 6
arch/riscv/mm/ptdump.c | 2
arch/s390/boot/ipl_parm.c | 4
arch/s390/boot/kaslr.c | 4
arch/s390/include/asm/hugetlb.h | 4
arch/s390/include/asm/kasan.h | 4
arch/s390/include/asm/pgtable.h | 15
arch/s390/include/asm/tlbflush.h | 1
arch/s390/kernel/asm-offsets.c | 4
arch/s390/kernel/dumpstack.c | 25
arch/s390/kernel/machine_kexec.c | 1
arch/s390/kernel/ptrace.c | 1
arch/s390/kernel/uv.c | 4
arch/s390/kernel/vdso.c | 5
arch/s390/kvm/gaccess.c | 8
arch/s390/kvm/interrupt.c | 4
arch/s390/kvm/kvm-s390.c | 32
arch/s390/kvm/priv.c | 38
arch/s390/mm/dump_pagetables.c | 1
arch/s390/mm/extmem.c | 4
arch/s390/mm/fault.c | 17
arch/s390/mm/gmap.c | 80
arch/s390/mm/init.c | 1
arch/s390/mm/kasan_init.c | 4
arch/s390/mm/pageattr.c | 13
arch/s390/mm/pgalloc.c | 2
arch/s390/mm/pgtable.c | 1
arch/s390/mm/vmem.c | 1
arch/s390/pci/pci_mmio.c | 4
arch/sh/include/asm/io.h | 2
arch/sh/include/asm/kdebug.h | 6
arch/sh/include/asm/pgtable-3level.h | 7
arch/sh/include/asm/pgtable.h | 2
arch/sh/include/asm/pgtable_32.h | 25
arch/sh/include/asm/processor_32.h | 2
arch/sh/kernel/dumpstack.c | 54
arch/sh/kernel/machine_kexec.c | 1
arch/sh/kernel/process_32.c | 2
arch/sh/kernel/ptrace_32.c | 1
arch/sh/kernel/signal_32.c | 1
arch/sh/kernel/sys_sh.c | 6
arch/sh/kernel/traps.c | 4
arch/sh/kernel/vsyscall/vsyscall.c | 4
arch/sh/mm/cache-sh3.c | 1
arch/sh/mm/cache-sh4.c | 11
arch/sh/mm/cache-sh7705.c | 1
arch/sh/mm/fault.c | 16
arch/sh/mm/kmap.c | 5
arch/sh/mm/nommu.c | 1
arch/sh/mm/pmb.c | 4
arch/sparc/include/asm/floppy_32.h | 4
arch/sparc/include/asm/highmem.h | 4
arch/sparc/include/asm/ide.h | 2
arch/sparc/include/asm/io-unit.h | 4
arch/sparc/include/asm/pgalloc_32.h | 4
arch/sparc/include/asm/pgalloc_64.h | 2
arch/sparc/include/asm/pgtable_32.h | 34
arch/sparc/include/asm/pgtable_64.h | 32
arch/sparc/kernel/cpu.c | 4
arch/sparc/kernel/entry.S | 4
arch/sparc/kernel/head_64.S | 4
arch/sparc/kernel/ktlb.S | 4
arch/sparc/kernel/leon_smp.c | 1
arch/sparc/kernel/pci.c | 4
arch/sparc/kernel/process_32.c | 29
arch/sparc/kernel/process_64.c | 3
arch/sparc/kernel/ptrace_32.c | 1
arch/sparc/kernel/ptrace_64.c | 1
arch/sparc/kernel/setup_32.c | 1
arch/sparc/kernel/setup_64.c | 1
arch/sparc/kernel/signal32.c | 1
arch/sparc/kernel/signal_32.c | 1
arch/sparc/kernel/signal_64.c | 1
arch/sparc/kernel/smp_32.c | 1
arch/sparc/kernel/smp_64.c | 1
arch/sparc/kernel/sun4m_irq.c | 4
arch/sparc/kernel/trampoline_64.S | 4
arch/sparc/kernel/traps_32.c | 4
arch/sparc/kernel/traps_64.c | 24
arch/sparc/lib/clear_page.S | 4
arch/sparc/lib/copy_page.S | 2
arch/sparc/mm/fault_32.c | 21
arch/sparc/mm/fault_64.c | 17
arch/sparc/mm/highmem.c | 12
arch/sparc/mm/hugetlbpage.c | 1
arch/sparc/mm/init_32.c | 1
arch/sparc/mm/init_64.c | 7
arch/sparc/mm/io-unit.c | 11
arch/sparc/mm/iommu.c | 9
arch/sparc/mm/tlb.c | 1
arch/sparc/mm/tsb.c | 4
arch/sparc/mm/ultra.S | 4
arch/sparc/vdso/vma.c | 4
arch/um/drivers/mconsole_kern.c | 2
arch/um/include/asm/mmu_context.h | 5
arch/um/include/asm/pgtable-3level.h | 4
arch/um/include/asm/pgtable.h | 69
arch/um/kernel/maccess.c | 12
arch/um/kernel/mem.c | 10
arch/um/kernel/process.c | 1
arch/um/kernel/skas/mmu.c | 3
arch/um/kernel/skas/uaccess.c | 1
arch/um/kernel/sysrq.c | 35
arch/um/kernel/tlb.c | 5
arch/um/kernel/trap.c | 15
arch/um/kernel/um_arch.c | 1
arch/unicore32/include/asm/pgtable.h | 19
arch/unicore32/kernel/hibernate.c | 4
arch/unicore32/kernel/hibernate_asm.S | 4
arch/unicore32/kernel/module.c | 1
arch/unicore32/kernel/setup.h | 4
arch/unicore32/kernel/traps.c | 50
arch/unicore32/lib/backtrace.S | 24
arch/unicore32/mm/alignment.c | 4
arch/unicore32/mm/fault.c | 9
arch/unicore32/mm/mm.h | 10
arch/unicore32/mm/proc-ucv2.S | 4
arch/x86/boot/compressed/kaslr_64.c | 4
arch/x86/entry/vdso/vma.c | 14
arch/x86/events/core.c | 4
arch/x86/include/asm/agp.h | 2
arch/x86/include/asm/asm-prototypes.h | 4
arch/x86/include/asm/efi.h | 4
arch/x86/include/asm/iomap.h | 1
arch/x86/include/asm/kaslr.h | 2
arch/x86/include/asm/mmu.h | 2
arch/x86/include/asm/pgtable-3level.h | 8
arch/x86/include/asm/pgtable.h | 89 -
arch/x86/include/asm/pgtable_32.h | 11
arch/x86/include/asm/pgtable_64.h | 4
arch/x86/include/asm/setup.h | 12
arch/x86/include/asm/stacktrace.h | 2
arch/x86/include/asm/uaccess.h | 16
arch/x86/include/asm/xen/hypercall.h | 4
arch/x86/include/asm/xen/page.h | 1
arch/x86/kernel/acpi/boot.c | 4
arch/x86/kernel/acpi/sleep.c | 4
arch/x86/kernel/alternative.c | 1
arch/x86/kernel/amd_gart_64.c | 5
arch/x86/kernel/apic/apic_numachip.c | 4
arch/x86/kernel/cpu/bugs.c | 4
arch/x86/kernel/cpu/common.c | 4
arch/x86/kernel/cpu/intel.c | 4
arch/x86/kernel/cpu/resctrl/pseudo_lock.c | 6
arch/x86/kernel/cpu/resctrl/rdtgroup.c | 6
arch/x86/kernel/crash_core_32.c | 4
arch/x86/kernel/crash_core_64.c | 4
arch/x86/kernel/doublefault_32.c | 1
arch/x86/kernel/dumpstack.c | 21
arch/x86/kernel/early_printk.c | 4
arch/x86/kernel/espfix_64.c | 2
arch/x86/kernel/head64.c | 4
arch/x86/kernel/head_64.S | 4
arch/x86/kernel/i8259.c | 4
arch/x86/kernel/irqinit.c | 4
arch/x86/kernel/kprobes/core.c | 4
arch/x86/kernel/kprobes/opt.c | 4
arch/x86/kernel/ldt.c | 2
arch/x86/kernel/machine_kexec_32.c | 1
arch/x86/kernel/machine_kexec_64.c | 1
arch/x86/kernel/module.c | 1
arch/x86/kernel/paravirt.c | 4
arch/x86/kernel/process_32.c | 1
arch/x86/kernel/process_64.c | 1
arch/x86/kernel/ptrace.c | 1
arch/x86/kernel/reboot.c | 4
arch/x86/kernel/smpboot.c | 4
arch/x86/kernel/tboot.c | 3
arch/x86/kernel/vm86_32.c | 4
arch/x86/kvm/mmu/paging_tmpl.h | 8
arch/x86/mm/cpu_entry_area.c | 4
arch/x86/mm/debug_pagetables.c | 2
arch/x86/mm/dump_pagetables.c | 1
arch/x86/mm/fault.c | 22
arch/x86/mm/init.c | 22
arch/x86/mm/init_32.c | 27
arch/x86/mm/init_64.c | 1
arch/x86/mm/ioremap.c | 4
arch/x86/mm/kasan_init_64.c | 1
arch/x86/mm/kaslr.c | 37
arch/x86/mm/maccess.c | 44
arch/x86/mm/mem_encrypt_boot.S | 2
arch/x86/mm/mmio-mod.c | 4
arch/x86/mm/pat/cpa-test.c | 1
arch/x86/mm/pat/memtype.c | 1
arch/x86/mm/pat/memtype_interval.c | 4
arch/x86/mm/pgtable.c | 1
arch/x86/mm/pgtable_32.c | 1
arch/x86/mm/pti.c | 1
arch/x86/mm/setup_nx.c | 4
arch/x86/platform/efi/efi_32.c | 4
arch/x86/platform/efi/efi_64.c | 1
arch/x86/platform/olpc/olpc_ofw.c | 4
arch/x86/power/cpu.c | 4
arch/x86/power/hibernate.c | 4
arch/x86/power/hibernate_32.c | 4
arch/x86/power/hibernate_64.c | 4
arch/x86/realmode/init.c | 4
arch/x86/um/vdso/vma.c | 4
arch/x86/xen/enlighten_pv.c | 1
arch/x86/xen/grant-table.c | 1
arch/x86/xen/mmu_pv.c | 4
arch/x86/xen/smp_pv.c | 2
arch/xtensa/include/asm/fixmap.h | 12
arch/xtensa/include/asm/highmem.h | 4
arch/xtensa/include/asm/initialize_mmu.h | 2
arch/xtensa/include/asm/mmu_context.h | 4
arch/xtensa/include/asm/pgtable.h | 20
arch/xtensa/kernel/entry.S | 4
arch/xtensa/kernel/process.c | 1
arch/xtensa/kernel/ptrace.c | 1
arch/xtensa/kernel/setup.c | 1
arch/xtensa/kernel/traps.c | 42
arch/xtensa/kernel/vectors.S | 4
arch/xtensa/mm/cache.c | 4
arch/xtensa/mm/fault.c | 12
arch/xtensa/mm/highmem.c | 2
arch/xtensa/mm/ioremap.c | 4
arch/xtensa/mm/kasan_init.c | 10
arch/xtensa/mm/misc.S | 4
arch/xtensa/mm/mmu.c | 5
drivers/acpi/scan.c | 3
drivers/android/binder_alloc.c | 14
drivers/atm/fore200e.c | 4
drivers/base/power/main.c | 4
drivers/block/z2ram.c | 4
drivers/char/agp/frontend.c | 1
drivers/char/agp/generic.c | 1
drivers/char/bsr.c | 1
drivers/char/mspec.c | 3
drivers/dma-buf/dma-resv.c | 5
drivers/firmware/efi/arm-runtime.c | 4
drivers/firmware/efi/efi.c | 2
drivers/gpu/drm/amd/amdgpu/amdgpu_amdkfd.h | 2
drivers/gpu/drm/amd/amdgpu/amdgpu_amdkfd_gfx_v7.c | 2
drivers/gpu/drm/amd/amdgpu/amdgpu_amdkfd_gfx_v8.c | 2
drivers/gpu/drm/amd/amdgpu/amdgpu_amdkfd_gpuvm.c | 4
drivers/gpu/drm/amd/amdgpu/amdgpu_ttm.c | 10
drivers/gpu/drm/amd/amdkfd/kfd_events.c | 4
drivers/gpu/drm/drm_vm.c | 4
drivers/gpu/drm/etnaviv/etnaviv_gem.c | 2
drivers/gpu/drm/i915/gem/i915_gem_mman.c | 4
drivers/gpu/drm/i915/gem/i915_gem_userptr.c | 14
drivers/gpu/drm/i915/i915_mm.c | 1
drivers/gpu/drm/i915/i915_perf.c | 2
drivers/gpu/drm/nouveau/nouveau_svm.c | 22
drivers/gpu/drm/radeon/radeon_cs.c | 4
drivers/gpu/drm/radeon/radeon_gem.c | 6
drivers/gpu/drm/ttm/ttm_bo_vm.c | 10
drivers/infiniband/core/umem_odp.c | 4
drivers/infiniband/core/uverbs_main.c | 6
drivers/infiniband/hw/hfi1/mmu_rb.c | 2
drivers/infiniband/hw/mlx4/mr.c | 4
drivers/infiniband/hw/qib/qib_file_ops.c | 4
drivers/infiniband/hw/qib/qib_user_pages.c | 6
drivers/infiniband/hw/usnic/usnic_uiom.c | 4
drivers/infiniband/sw/rdmavt/mmap.c | 1
drivers/infiniband/sw/rxe/rxe_mmap.c | 1
drivers/infiniband/sw/siw/siw_mem.c | 4
drivers/iommu/amd_iommu_v2.c | 4
drivers/iommu/intel-svm.c | 4
drivers/macintosh/macio-adb.c | 4
drivers/macintosh/mediabay.c | 4
drivers/macintosh/via-pmu.c | 4
drivers/media/pci/bt8xx/bt878.c | 4
drivers/media/pci/bt8xx/btcx-risc.c | 4
drivers/media/pci/bt8xx/bttv-risc.c | 4
drivers/media/platform/davinci/vpbe_display.c | 1
drivers/media/v4l2-core/v4l2-common.c | 1
drivers/media/v4l2-core/videobuf-core.c | 4
drivers/media/v4l2-core/videobuf-dma-contig.c | 4
drivers/media/v4l2-core/videobuf-dma-sg.c | 10
drivers/media/v4l2-core/videobuf-vmalloc.c | 4
drivers/misc/cxl/cxllib.c | 9
drivers/misc/cxl/fault.c | 4
drivers/misc/genwqe/card_utils.c | 2
drivers/misc/sgi-gru/grufault.c | 25
drivers/misc/sgi-gru/grufile.c | 4
drivers/mtd/ubi/ubi.h | 2
drivers/net/ethernet/amd/7990.c | 4
drivers/net/ethernet/amd/hplance.c | 4
drivers/net/ethernet/amd/mvme147.c | 4
drivers/net/ethernet/amd/sun3lance.c | 4
drivers/net/ethernet/amd/sunlance.c | 4
drivers/net/ethernet/apple/bmac.c | 4
drivers/net/ethernet/apple/mace.c | 4
drivers/net/ethernet/freescale/fs_enet/fs_enet-main.c | 4
drivers/net/ethernet/freescale/fs_enet/mac-fcc.c | 4
drivers/net/ethernet/freescale/fs_enet/mii-fec.c | 4
drivers/net/ethernet/i825xx/82596.c | 4
drivers/net/ethernet/korina.c | 4
drivers/net/ethernet/marvell/pxa168_eth.c | 4
drivers/net/ethernet/natsemi/jazzsonic.c | 4
drivers/net/ethernet/natsemi/macsonic.c | 4
drivers/net/ethernet/natsemi/xtsonic.c | 4
drivers/net/ethernet/sun/sunbmac.c | 4
drivers/net/ethernet/sun/sunhme.c | 1
drivers/net/ethernet/sun/sunqe.c | 4
drivers/oprofile/buffer_sync.c | 12
drivers/sbus/char/flash.c | 1
drivers/sbus/char/uctrl.c | 1
drivers/scsi/53c700.c | 4
drivers/scsi/a2091.c | 1
drivers/scsi/a3000.c | 1
drivers/scsi/arm/cumana_2.c | 4
drivers/scsi/arm/eesox.c | 4
drivers/scsi/arm/powertec.c | 4
drivers/scsi/dpt_i2o.c | 4
drivers/scsi/gvp11.c | 1
drivers/scsi/lasi700.c | 1
drivers/scsi/mac53c94.c | 4
drivers/scsi/mesh.c | 4
drivers/scsi/mvme147.c | 1
drivers/scsi/qlogicpti.c | 4
drivers/scsi/sni_53c710.c | 1
drivers/scsi/zorro_esp.c | 4
drivers/staging/android/ashmem.c | 4
drivers/staging/comedi/comedi_fops.c | 2
drivers/staging/kpc2000/kpc_dma/fileops.c | 4
drivers/staging/media/atomisp/pci/hmm/hmm_bo.c | 4
drivers/tee/optee/call.c | 4
drivers/tty/sysrq.c | 4
drivers/tty/vt/consolemap.c | 2
drivers/vfio/pci/vfio_pci.c | 22
drivers/vfio/vfio_iommu_type1.c | 8
drivers/vhost/vdpa.c | 4
drivers/video/console/newport_con.c | 1
drivers/video/fbdev/acornfb.c | 1
drivers/video/fbdev/atafb.c | 1
drivers/video/fbdev/cirrusfb.c | 1
drivers/video/fbdev/cyber2000fb.c | 1
drivers/video/fbdev/fb-puv3.c | 1
drivers/video/fbdev/hitfb.c | 1
drivers/video/fbdev/neofb.c | 1
drivers/video/fbdev/q40fb.c | 1
drivers/video/fbdev/savage/savagefb_driver.c | 1
drivers/xen/balloon.c | 1
drivers/xen/gntdev.c | 6
drivers/xen/grant-table.c | 1
drivers/xen/privcmd.c | 15
drivers/xen/xenbus/xenbus_probe.c | 1
drivers/xen/xenbus/xenbus_probe_backend.c | 1
drivers/xen/xenbus/xenbus_probe_frontend.c | 1
fs/aio.c | 4
fs/coredump.c | 8
fs/exec.c | 18
fs/ext2/file.c | 2
fs/ext4/super.c | 6
fs/hugetlbfs/inode.c | 2
fs/io_uring.c | 4
fs/kernfs/file.c | 4
fs/proc/array.c | 1
fs/proc/base.c | 24
fs/proc/meminfo.c | 1
fs/proc/nommu.c | 1
fs/proc/task_mmu.c | 34
fs/proc/task_nommu.c | 18
fs/proc/vmcore.c | 1
fs/userfaultfd.c | 46
fs/xfs/xfs_file.c | 2
fs/xfs/xfs_inode.c | 14
fs/xfs/xfs_iops.c | 4
include/asm-generic/io.h | 2
include/asm-generic/pgtable-nopmd.h | 1
include/asm-generic/pgtable-nopud.h | 1
include/asm-generic/pgtable.h | 1322 ----------------
include/linux/cache.h | 10
include/linux/crash_dump.h | 3
include/linux/dax.h | 1
include/linux/dma-noncoherent.h | 2
include/linux/fs.h | 4
include/linux/hmm.h | 2
include/linux/huge_mm.h | 2
include/linux/hugetlb.h | 2
include/linux/io-mapping.h | 4
include/linux/kallsyms.h | 4
include/linux/kasan.h | 4
include/linux/mempolicy.h | 2
include/linux/mm.h | 15
include/linux/mm_types.h | 4
include/linux/mmap_lock.h | 128 +
include/linux/mmu_notifier.h | 13
include/linux/pagemap.h | 2
include/linux/pgtable.h | 1444 +++++++++++++++++-
include/linux/rmap.h | 2
include/linux/sched/debug.h | 7
include/linux/sched/mm.h | 10
include/linux/uaccess.h | 62
include/xen/arm/page.h | 4
init/init_task.c | 1
ipc/shm.c | 8
kernel/acct.c | 6
kernel/bpf/stackmap.c | 21
kernel/bpf/syscall.c | 2
kernel/cgroup/cpuset.c | 4
kernel/debug/kdb/kdb_bt.c | 17
kernel/events/core.c | 10
kernel/events/uprobes.c | 20
kernel/exit.c | 11
kernel/fork.c | 15
kernel/futex.c | 4
kernel/locking/lockdep.c | 4
kernel/locking/rtmutex-debug.c | 4
kernel/power/snapshot.c | 1
kernel/relay.c | 2
kernel/sched/core.c | 10
kernel/sched/fair.c | 4
kernel/sys.c | 22
kernel/trace/bpf_trace.c | 176 +-
kernel/trace/ftrace.c | 8
kernel/trace/trace_kprobe.c | 80
kernel/trace/trace_output.c | 4
lib/dump_stack.c | 4
lib/ioremap.c | 1
lib/test_hmm.c | 14
lib/test_lockup.c | 16
mm/debug.c | 10
mm/debug_vm_pgtable.c | 1
mm/filemap.c | 46
mm/frame_vector.c | 6
mm/gup.c | 73
mm/hmm.c | 2
mm/huge_memory.c | 8
mm/hugetlb.c | 3
mm/init-mm.c | 6
mm/internal.h | 6
mm/khugepaged.c | 72
mm/ksm.c | 48
mm/maccess.c | 496 +++---
mm/madvise.c | 40
mm/memcontrol.c | 10
mm/memory.c | 61
mm/mempolicy.c | 36
mm/migrate.c | 16
mm/mincore.c | 8
mm/mlock.c | 22
mm/mmap.c | 74
mm/mmu_gather.c | 2
mm/mmu_notifier.c | 22
mm/mprotect.c | 22
mm/mremap.c | 14
mm/msync.c | 8
mm/nommu.c | 22
mm/oom_kill.c | 14
mm/page_io.c | 1
mm/page_reporting.h | 2
mm/pagewalk.c | 12
mm/pgtable-generic.c | 6
mm/process_vm_access.c | 4
mm/ptdump.c | 4
mm/rmap.c | 12
mm/shmem.c | 5
mm/sparse-vmemmap.c | 1
mm/sparse.c | 1
mm/swap_state.c | 5
mm/swapfile.c | 5
mm/userfaultfd.c | 26
mm/util.c | 12
mm/vmacache.c | 1
mm/zsmalloc.c | 4
net/ipv4/tcp.c | 8
net/xdp/xdp_umem.c | 4
security/keys/keyctl.c | 2
sound/core/oss/pcm_oss.c | 2
sound/core/sgbuf.c | 1
sound/pci/hda/hda_intel.c | 4
sound/soc/intel/common/sst-firmware.c | 4
sound/soc/intel/haswell/sst-haswell-pcm.c | 4
tools/include/linux/kallsyms.h | 2
virt/kvm/async_pf.c | 4
virt/kvm/kvm_main.c | 9
942 files changed, 4580 insertions(+), 5662 deletions(-)
^ permalink raw reply [flat|nested] 232+ messages in thread
* incoming
@ 2020-06-11 1:40 Andrew Morton
0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2020-06-11 1:40 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm
- various hotfixes and minor things
- hch's use_mm/unuse_mm clearnups
- new syscall process_madvise(): perform madvise() on a process other
than self
25 patches, based on 6f630784cc0d92fb58ea326e2bc01aa056279ecb.
Subsystems affected by this patch series:
mm/hugetlb
scripts
kcov
lib
nilfs
checkpatch
lib
mm/debug
ocfs2
lib
misc
mm/madvise
Subsystem: mm/hugetlb
Dan Carpenter <dan.carpenter@oracle.com>:
khugepaged: selftests: fix timeout condition in wait_for_scan()
Subsystem: scripts
SeongJae Park <sjpark@amazon.de>:
scripts/spelling: add a few more typos
Subsystem: kcov
Andrey Konovalov <andreyknvl@google.com>:
kcov: check kcov_softirq in kcov_remote_stop()
Subsystem: lib
Joe Perches <joe@perches.com>:
lib/lz4/lz4_decompress.c: document deliberate use of `&'
Subsystem: nilfs
Ryusuke Konishi <konishi.ryusuke@gmail.com>:
nilfs2: fix null pointer dereference at nilfs_segctor_do_construct()
Subsystem: checkpatch
Tim Froidcoeur <tim.froidcoeur@tessares.net>:
checkpatch: correct check for kernel parameters doc
Subsystem: lib
Alexander Gordeev <agordeev@linux.ibm.com>:
lib: fix bitmap_parse() on 64-bit big endian archs
Subsystem: mm/debug
"Aneesh Kumar K.V" <aneesh.kumar@linux.ibm.com>:
mm/debug_vm_pgtable: fix kernel crash by checking for THP support
Subsystem: ocfs2
Keyur Patel <iamkeyur96@gmail.com>:
ocfs2: fix spelling mistake and grammar
Ben Widawsky <ben.widawsky@intel.com>:
mm: add comments on pglist_data zones
Subsystem: lib
Wei Yang <richard.weiyang@gmail.com>:
lib: test get_count_order/long in test_bitops.c
Subsystem: misc
Walter Wu <walter-zh.wu@mediatek.com>:
stacktrace: cleanup inconsistent variable type
Christoph Hellwig <hch@lst.de>:
Patch series "improve use_mm / unuse_mm", v2:
kernel: move use_mm/unuse_mm to kthread.c
kernel: move use_mm/unuse_mm to kthread.c
kernel: better document the use_mm/unuse_mm API contract
kernel: set USER_DS in kthread_use_mm
Subsystem: mm/madvise
Minchan Kim <minchan@kernel.org>:
Patch series "introduce memory hinting API for external process", v7:
mm/madvise: pass task and mm to do_madvise
mm/madvise: introduce process_madvise() syscall: an external memory hinting API
mm/madvise: check fatal signal pending of target process
pid: move pidfd_get_pid() to pid.c
mm/madvise: support both pid and pidfd for process_madvise
Oleksandr Natalenko <oleksandr@redhat.com>:
mm/madvise: allow KSM hints for remote API
Minchan Kim <minchan@kernel.org>:
mm: support vector address ranges for process_madvise
mm: use only pidfd for process_madvise syscall
YueHaibing <yuehaibing@huawei.com>:
mm/madvise.c: remove duplicated include
arch/alpha/kernel/syscalls/syscall.tbl | 1
arch/arm/tools/syscall.tbl | 1
arch/arm64/include/asm/unistd.h | 2
arch/arm64/include/asm/unistd32.h | 4
arch/ia64/kernel/syscalls/syscall.tbl | 1
arch/m68k/kernel/syscalls/syscall.tbl | 1
arch/microblaze/kernel/syscalls/syscall.tbl | 1
arch/mips/kernel/syscalls/syscall_n32.tbl | 3
arch/mips/kernel/syscalls/syscall_n64.tbl | 1
arch/mips/kernel/syscalls/syscall_o32.tbl | 3
arch/parisc/kernel/syscalls/syscall.tbl | 3
arch/powerpc/kernel/syscalls/syscall.tbl | 3
arch/powerpc/platforms/powernv/vas-fault.c | 4
arch/s390/kernel/syscalls/syscall.tbl | 3
arch/sh/kernel/syscalls/syscall.tbl | 1
arch/sparc/kernel/syscalls/syscall.tbl | 3
arch/x86/entry/syscalls/syscall_32.tbl | 3
arch/x86/entry/syscalls/syscall_64.tbl | 5
arch/xtensa/kernel/syscalls/syscall.tbl | 1
drivers/gpu/drm/amd/amdgpu/amdgpu_amdkfd.h | 5
drivers/gpu/drm/amd/amdgpu/amdgpu_amdkfd_arcturus.c | 1
drivers/gpu/drm/amd/amdgpu/amdgpu_amdkfd_gfx_v10.c | 1
drivers/gpu/drm/amd/amdgpu/amdgpu_amdkfd_gfx_v7.c | 2
drivers/gpu/drm/amd/amdgpu/amdgpu_amdkfd_gfx_v8.c | 2
drivers/gpu/drm/amd/amdgpu/amdgpu_amdkfd_gfx_v9.c | 2
drivers/gpu/drm/i915/gvt/kvmgt.c | 2
drivers/usb/gadget/function/f_fs.c | 10
drivers/usb/gadget/legacy/inode.c | 6
drivers/vfio/vfio_iommu_type1.c | 6
drivers/vhost/vhost.c | 8
fs/aio.c | 1
fs/io-wq.c | 15 -
fs/io_uring.c | 11
fs/nilfs2/segment.c | 2
fs/ocfs2/mmap.c | 2
include/linux/compat.h | 10
include/linux/kthread.h | 9
include/linux/mm.h | 3
include/linux/mmu_context.h | 5
include/linux/mmzone.h | 14
include/linux/pid.h | 1
include/linux/stacktrace.h | 2
include/linux/syscalls.h | 16 -
include/uapi/asm-generic/unistd.h | 7
kernel/exit.c | 17 -
kernel/kcov.c | 26 +
kernel/kthread.c | 95 +++++-
kernel/pid.c | 17 +
kernel/sys_ni.c | 2
lib/Kconfig.debug | 10
lib/bitmap.c | 9
lib/lz4/lz4_decompress.c | 3
lib/test_bitops.c | 53 +++
mm/Makefile | 2
mm/debug_vm_pgtable.c | 6
mm/madvise.c | 295 ++++++++++++++------
mm/mmu_context.c | 64 ----
mm/oom_kill.c | 6
mm/vmacache.c | 4
scripts/checkpatch.pl | 4
scripts/spelling.txt | 9
tools/testing/selftests/vm/khugepaged.c | 2
62 files changed, 526 insertions(+), 285 deletions(-)
^ permalink raw reply [flat|nested] 232+ messages in thread
* incoming
@ 2020-06-12 0:30 Andrew Morton
0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2020-06-12 0:30 UTC (permalink / raw)
To: Linus Torvalds; +Cc: linux-mm, mm-commits
A few fixes and stragglers.
5 patches, based on 623f6dc593eaf98b91916836785278eddddaacf8.
Subsystems affected by this patch series:
mm/memory-failure
ocfs2
lib/lzo
misc
Subsystem: mm/memory-failure
Naoya Horiguchi <nao.horiguchi@gmail.com>:
Patch series "hwpoison: fixes signaling on memory error":
mm/memory-failure: prioritize prctl(PR_MCE_KILL) over vm.memory_failure_early_kill
mm/memory-failure: send SIGBUS(BUS_MCEERR_AR) only to current thread
Subsystem: ocfs2
Tom Seewald <tseewald@gmail.com>:
ocfs2: fix build failure when TCP/IP is disabled
Subsystem: lib/lzo
Dave Rodgman <dave.rodgman@arm.com>:
lib/lzo: fix ambiguous encoding bug in lzo-rle
Subsystem: misc
Christoph Hellwig <hch@lst.de>:
amdgpu: a NULL ->mm does not mean a thread is a kthread
Documentation/lzo.txt | 8 ++++-
drivers/gpu/drm/amd/amdgpu/amdgpu_amdkfd.h | 2 -
fs/ocfs2/Kconfig | 2 -
lib/lzo/lzo1x_compress.c | 13 ++++++++
mm/memory-failure.c | 43 +++++++++++++++++------------
5 files changed, 47 insertions(+), 21 deletions(-)
^ permalink raw reply [flat|nested] 232+ messages in thread
* incoming
@ 2020-06-26 3:28 Andrew Morton
0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2020-06-26 3:28 UTC (permalink / raw)
To: Linus Torvalds; +Cc: linux-mm, mm-commits
32 patches, based on 908f7d12d3ba51dfe0449b9723199b423f97ca9a.
Subsystems affected by this patch series:
hotfixes
mm/pagealloc
kexec
ocfs2
lib
misc
mm/slab
mm/slab
mm/slub
mm/swap
mm/pagemap
mm/vmalloc
mm/memcg
mm/gup
mm/thp
mm/vmscan
x86
mm/memory-hotplug
MAINTAINERS
Subsystem: hotfixes
Stafford Horne <shorne@gmail.com>:
openrisc: fix boot oops when DEBUG_VM is enabled
Michal Hocko <mhocko@suse.com>:
mm: do_swap_page(): fix up the error code
Subsystem: mm/pagealloc
Vlastimil Babka <vbabka@suse.cz>:
mm, compaction: make capture control handling safe wrt interrupts
Subsystem: kexec
Lianbo Jiang <lijiang@redhat.com>:
kexec: do not verify the signature without the lockdown or mandatory signature
Subsystem: ocfs2
Junxiao Bi <junxiao.bi@oracle.com>:
Patch series "ocfs2: fix nfsd over ocfs2 issues", v2:
ocfs2: avoid inode removal while nfsd is accessing it
ocfs2: load global_inode_alloc
ocfs2: fix panic on nfs server over ocfs2
ocfs2: fix value of OCFS2_INVALID_SLOT
Subsystem: lib
Randy Dunlap <rdunlap@infradead.org>:
lib: fix test_hmm.c reference after free
Subsystem: misc
Rikard Falkeborn <rikard.falkeborn@gmail.com>:
linux/bits.h: fix unsigned less than zero warnings
Subsystem: mm/slab
Waiman Long <longman@redhat.com>:
mm, slab: fix sign conversion problem in memcg_uncharge_slab()
Subsystem: mm/slab
Waiman Long <longman@redhat.com>:
mm/slab: use memzero_explicit() in kzfree()
Subsystem: mm/slub
Sebastian Andrzej Siewior <bigeasy@linutronix.de>:
slub: cure list_slab_objects() from double fix
Subsystem: mm/swap
Hugh Dickins <hughd@google.com>:
mm: fix swap cache node allocation mask
Subsystem: mm/pagemap
Arjun Roy <arjunroy@google.com>:
mm/memory.c: properly pte_offset_map_lock/unlock in vm_insert_pages()
Christophe Leroy <christophe.leroy@csgroup.eu>:
mm/debug_vm_pgtable: fix build failure with powerpc 8xx
Stephen Rothwell <sfr@canb.auug.org.au>:
make asm-generic/cacheflush.h more standalone
Nathan Chancellor <natechancellor@gmail.com>:
media: omap3isp: remove cacheflush.h
Subsystem: mm/vmalloc
Masanari Iida <standby24x7@gmail.com>:
mm/vmalloc.c: fix a warning while make xmldocs
Subsystem: mm/memcg
Johannes Weiner <hannes@cmpxchg.org>:
mm: memcontrol: handle div0 crash race condition in memory.low
Muchun Song <songmuchun@bytedance.com>:
mm/memcontrol.c: add missed css_put()
Chris Down <chris@chrisdown.name>:
mm/memcontrol.c: prevent missed memory.low load tears
Subsystem: mm/gup
Souptick Joarder <jrdr.linux@gmail.com>:
docs: mm/gup: minor documentation update
Subsystem: mm/thp
Yang Shi <yang.shi@linux.alibaba.com>:
doc: THP CoW fault no longer allocate THP
Subsystem: mm/vmscan
Johannes Weiner <hannes@cmpxchg.org>:
Patch series "fix for "mm: balance LRU lists based on relative thrashing" patchset":
mm: workingset: age nonresident information alongside anonymous pages
Joonsoo Kim <iamjoonsoo.kim@lge.com>:
mm/swap: fix for "mm: workingset: age nonresident information alongside anonymous pages"
mm/memory: fix IO cost for anonymous page
Subsystem: x86
Christoph Hellwig <hch@lst.de>:
Patch series "fix a hyperv W^X violation and remove vmalloc_exec":
x86/hyperv: allocate the hypercall page with only read and execute bits
arm64: use PAGE_KERNEL_ROX directly in alloc_insn_page
mm: remove vmalloc_exec
Subsystem: mm/memory-hotplug
Ben Widawsky <ben.widawsky@intel.com>:
mm/memory_hotplug.c: fix false softlockup during pfn range removal
Subsystem: MAINTAINERS
Luc Van Oostenryck <luc.vanoostenryck@gmail.com>:
MAINTAINERS: update info for sparse
Documentation/admin-guide/cgroup-v2.rst | 4 +-
Documentation/admin-guide/mm/transhuge.rst | 3 -
Documentation/core-api/pin_user_pages.rst | 2 -
MAINTAINERS | 4 +-
arch/arm64/kernel/probes/kprobes.c | 12 +------
arch/openrisc/kernel/dma.c | 5 +++
arch/x86/hyperv/hv_init.c | 4 +-
arch/x86/include/asm/pgtable_types.h | 2 +
drivers/media/platform/omap3isp/isp.c | 2 -
drivers/media/platform/omap3isp/ispvideo.c | 1
fs/ocfs2/dlmglue.c | 17 ++++++++++
fs/ocfs2/ocfs2.h | 1
fs/ocfs2/ocfs2_fs.h | 4 +-
fs/ocfs2/suballoc.c | 9 +++--
include/asm-generic/cacheflush.h | 5 +++
include/linux/bits.h | 3 +
include/linux/mmzone.h | 4 +-
include/linux/swap.h | 1
include/linux/vmalloc.h | 1
kernel/kexec_file.c | 36 ++++------------------
kernel/module.c | 4 +-
lib/test_hmm.c | 3 -
mm/compaction.c | 17 ++++++++--
mm/debug_vm_pgtable.c | 4 +-
mm/memcontrol.c | 18 ++++++++---
mm/memory.c | 33 +++++++++++++-------
mm/memory_hotplug.c | 13 ++++++--
mm/nommu.c | 17 ----------
mm/slab.h | 4 +-
mm/slab_common.c | 2 -
mm/slub.c | 19 ++---------
mm/swap.c | 3 -
mm/swap_state.c | 4 +-
mm/vmalloc.c | 21 -------------
mm/vmscan.c | 3 +
mm/workingset.c | 46 +++++++++++++++++------------
36 files changed, 168 insertions(+), 163 deletions(-)
^ permalink raw reply [flat|nested] 232+ messages in thread
* incoming
@ 2020-07-03 22:14 Andrew Morton
0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2020-07-03 22:14 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm
5 patches, based on cdd3bb54332f82295ed90cd0c09c78cd0c0ee822.
Subsystems affected by this patch series:
mm/hugetlb
samples
mm/cma
mm/vmalloc
mm/pagealloc
Subsystem: mm/hugetlb
Mike Kravetz <mike.kravetz@oracle.com>:
mm/hugetlb.c: fix pages per hugetlb calculation
Subsystem: samples
Kees Cook <keescook@chromium.org>:
samples/vfs: avoid warning in statx override
Subsystem: mm/cma
Barry Song <song.bao.hua@hisilicon.com>:
mm/cma.c: use exact_nid true to fix possible per-numa cma leak
Subsystem: mm/vmalloc
Christoph Hellwig <hch@lst.de>:
vmalloc: fix the owner argument for the new __vmalloc_node_range callers
Subsystem: mm/pagealloc
Joel Savitz <jsavitz@redhat.com>:
mm/page_alloc: fix documentation error
arch/arm64/kernel/probes/kprobes.c | 2 +-
arch/x86/hyperv/hv_init.c | 3 ++-
kernel/module.c | 2 +-
mm/cma.c | 4 ++--
mm/hugetlb.c | 2 +-
mm/page_alloc.c | 2 +-
samples/vfs/test-statx.c | 2 ++
7 files changed, 10 insertions(+), 7 deletions(-)
^ permalink raw reply [flat|nested] 232+ messages in thread
* incoming
@ 2020-07-24 4:14 Andrew Morton
0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2020-07-24 4:14 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm
15 patches, based on f37e99aca03f63aa3f2bd13ceaf769455d12c4b0.
Subsystems affected by this patch series:
mm/pagemap
mm/shmem
mm/hotfixes
mm/memcg
mm/hugetlb
mailmap
squashfs
scripts
io-mapping
MAINTAINERS
gdb
Subsystem: mm/pagemap
Yang Shi <yang.shi@linux.alibaba.com>:
mm/memory.c: avoid access flag update TLB flush for retried page fault
"Kirill A. Shutemov" <kirill.shutemov@linux.intel.com>:
mm/mmap.c: close race between munmap() and expand_upwards()/downwards()
Subsystem: mm/shmem
Chengguang Xu <cgxu519@mykernel.net>:
vfs/xattr: mm/shmem: kernfs: release simple xattr entry in a right way
Subsystem: mm/hotfixes
Tom Rix <trix@redhat.com>:
mm: initialize return of vm_insert_pages
Bhupesh Sharma <bhsharma@redhat.com>:
mm/memcontrol: fix OOPS inside mem_cgroup_get_nr_swap_pages()
Subsystem: mm/memcg
Hugh Dickins <hughd@google.com>:
mm/memcg: fix refcount error while moving and swapping
Muchun Song <songmuchun@bytedance.com>:
mm: memcg/slab: fix memory leak at non-root kmem_cache destroy
Subsystem: mm/hugetlb
Barry Song <song.bao.hua@hisilicon.com>:
mm/hugetlb: avoid hardcoding while checking if cma is enabled
"Kirill A. Shutemov" <kirill.shutemov@linux.intel.com>:
khugepaged: fix null-pointer dereference due to race
Subsystem: mailmap
Mike Rapoport <rppt@linux.ibm.com>:
mailmap: add entry for Mike Rapoport
Subsystem: squashfs
Phillip Lougher <phillip@squashfs.org.uk>:
squashfs: fix length field overlap check in metadata reading
Subsystem: scripts
Pi-Hsun Shih <pihsun@chromium.org>:
scripts/decode_stacktrace: strip basepath from all paths
Subsystem: io-mapping
"Michael J. Ruhl" <michael.j.ruhl@intel.com>:
io-mapping: indicate mapping failure
Subsystem: MAINTAINERS
Andrey Konovalov <andreyknvl@google.com>:
MAINTAINERS: add KCOV section
Subsystem: gdb
Stefano Garzarella <sgarzare@redhat.com>:
scripts/gdb: fix lx-symbols 'gdb.error' while loading modules
.mailmap | 3 +++
MAINTAINERS | 11 +++++++++++
fs/squashfs/block.c | 2 +-
include/linux/io-mapping.h | 5 ++++-
include/linux/xattr.h | 3 ++-
mm/hugetlb.c | 15 ++++++++++-----
mm/khugepaged.c | 3 +++
mm/memcontrol.c | 13 ++++++++++---
mm/memory.c | 9 +++++++--
mm/mmap.c | 16 ++++++++++++++--
mm/shmem.c | 2 +-
mm/slab_common.c | 35 ++++++++++++++++++++++++++++-------
scripts/decode_stacktrace.sh | 4 ++--
scripts/gdb/linux/symbols.py | 2 +-
14 files changed, 97 insertions(+), 26 deletions(-)
^ permalink raw reply [flat|nested] 232+ messages in thread
* incoming
@ 2020-08-07 6:16 Andrew Morton
0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2020-08-07 6:16 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm
- A few MM hotfixes
- kthread, tools, scripts, ntfs and ocfs2
- Some of MM
163 patches, based on d6efb3ac3e6c19ab722b28bdb9252bae0b9676b6.
Subsystems affected by this patch series:
mm/pagemap
mm/hofixes
mm/pagealloc
kthread
tools
scripts
ntfs
ocfs2
mm/slab-generic
mm/slab
mm/slub
mm/kcsan
mm/debug
mm/pagecache
mm/gup
mm/swap
mm/shmem
mm/memcg
mm/pagemap
mm/mremap
mm/mincore
mm/sparsemem
mm/vmalloc
mm/kasan
mm/pagealloc
mm/hugetlb
mm/vmscan
Subsystem: mm/pagemap
Yang Shi <yang.shi@linux.alibaba.com>:
mm/memory.c: avoid access flag update TLB flush for retried page fault
Subsystem: mm/hofixes
Ralph Campbell <rcampbell@nvidia.com>:
mm/migrate: fix migrate_pgmap_owner w/o CONFIG_MMU_NOTIFIER
Subsystem: mm/pagealloc
David Hildenbrand <david@redhat.com>:
mm/shuffle: don't move pages between zones and don't read garbage memmaps
Subsystem: kthread
Peter Zijlstra <peterz@infradead.org>:
mm: fix kthread_use_mm() vs TLB invalidate
Ilias Stamatis <stamatis.iliass@gmail.com>:
kthread: remove incorrect comment in kthread_create_on_cpu()
Subsystem: tools
"Alexander A. Klimov" <grandmaster@al2klimov.de>:
tools/: replace HTTP links with HTTPS ones
Gaurav Singh <gaurav1086@gmail.com>:
tools/testing/selftests/cgroup/cgroup_util.c: cg_read_strcmp: fix null pointer dereference
Subsystem: scripts
Jialu Xu <xujialu@vimux.org>:
scripts/tags.sh: collect compiled source precisely
Nikolay Borisov <nborisov@suse.com>:
scripts/bloat-o-meter: Support comparing library archives
Konstantin Khlebnikov <khlebnikov@yandex-team.ru>:
scripts/decode_stacktrace.sh: skip missing symbols
scripts/decode_stacktrace.sh: guess basepath if not specified
scripts/decode_stacktrace.sh: guess path to modules
scripts/decode_stacktrace.sh: guess path to vmlinux by release name
Joe Perches <joe@perches.com>:
const_structs.checkpatch: add regulator_ops
Colin Ian King <colin.king@canonical.com>:
scripts/spelling.txt: add more spellings to spelling.txt
Subsystem: ntfs
Luca Stefani <luca.stefani.ge1@gmail.com>:
ntfs: fix ntfs_test_inode and ntfs_init_locked_inode function type
Subsystem: ocfs2
Gang He <ghe@suse.com>:
ocfs2: fix remounting needed after setfacl command
Randy Dunlap <rdunlap@infradead.org>:
ocfs2: suballoc.h: delete a duplicated word
Junxiao Bi <junxiao.bi@oracle.com>:
ocfs2: change slot number type s16 to u16
"Alexander A. Klimov" <grandmaster@al2klimov.de>:
ocfs2: replace HTTP links with HTTPS ones
Pavel Machek <pavel@ucw.cz>:
ocfs2: fix unbalanced locking
Subsystem: mm/slab-generic
Waiman Long <longman@redhat.com>:
mm, treewide: rename kzfree() to kfree_sensitive()
William Kucharski <william.kucharski@oracle.com>:
mm: ksize() should silently accept a NULL pointer
Subsystem: mm/slab
Kees Cook <keescook@chromium.org>:
Patch series "mm: Expand CONFIG_SLAB_FREELIST_HARDENED to include SLAB":
mm/slab: expand CONFIG_SLAB_FREELIST_HARDENED to include SLAB
mm/slab: add naive detection of double free
Long Li <lonuxli.64@gmail.com>:
mm, slab: check GFP_SLAB_BUG_MASK before alloc_pages in kmalloc_order
Xiao Yang <yangx.jy@cn.fujitsu.com>:
mm/slab.c: update outdated kmem_list3 in a comment
Subsystem: mm/slub
Vlastimil Babka <vbabka@suse.cz>:
Patch series "slub_debug fixes and improvements":
mm, slub: extend slub_debug syntax for multiple blocks
mm, slub: make some slub_debug related attributes read-only
mm, slub: remove runtime allocation order changes
mm, slub: make remaining slub_debug related attributes read-only
mm, slub: make reclaim_account attribute read-only
mm, slub: introduce static key for slub_debug()
mm, slub: introduce kmem_cache_debug_flags()
mm, slub: extend checks guarded by slub_debug static key
mm, slab/slub: move and improve cache_from_obj()
mm, slab/slub: improve error reporting and overhead of cache_from_obj()
Sebastian Andrzej Siewior <bigeasy@linutronix.de>:
mm/slub.c: drop lockdep_assert_held() from put_map()
Subsystem: mm/kcsan
Marco Elver <elver@google.com>:
mm, kcsan: instrument SLAB/SLUB free with "ASSERT_EXCLUSIVE_ACCESS"
Subsystem: mm/debug
Anshuman Khandual <anshuman.khandual@arm.com>:
Patch series "mm/debug_vm_pgtable: Add some more tests", v5:
mm/debug_vm_pgtable: add tests validating arch helpers for core MM features
mm/debug_vm_pgtable: add tests validating advanced arch page table helpers
mm/debug_vm_pgtable: add debug prints for individual tests
Documentation/mm: add descriptions for arch page table helpers
"Matthew Wilcox (Oracle)" <willy@infradead.org>:
Patch series "Improvements for dump_page()", v2:
mm/debug: handle page->mapping better in dump_page
mm/debug: dump compound page information on a second line
mm/debug: print head flags in dump_page
mm/debug: switch dump_page to get_kernel_nofault
mm/debug: print the inode number in dump_page
mm/debug: print hashed address of struct page
John Hubbard <jhubbard@nvidia.com>:
mm, dump_page: do not crash with bad compound_mapcount()
Subsystem: mm/pagecache
Yang Shi <yang.shi@linux.alibaba.com>:
mm: filemap: clear idle flag for writes
mm: filemap: add missing FGP_ flags in kerneldoc comment for pagecache_get_page
Subsystem: mm/gup
Tang Yizhou <tangyizhou@huawei.com>:
mm/gup.c: fix the comment of return value for populate_vma_page_range()
Subsystem: mm/swap
Zhen Lei <thunder.leizhen@huawei.com>:
Patch series "clean up some functions in mm/swap_slots.c":
mm/swap_slots.c: simplify alloc_swap_slot_cache()
mm/swap_slots.c: simplify enable_swap_slots_cache()
mm/swap_slots.c: remove redundant check for swap_slot_cache_initialized
Krzysztof Kozlowski <krzk@kernel.org>:
mm: swap: fix kerneldoc of swap_vma_readahead()
Xianting Tian <xianting_tian@126.com>:
mm/page_io.c: use blk_io_schedule() for avoiding task hung in sync io
Subsystem: mm/shmem
Chris Down <chris@chrisdown.name>:
Patch series "tmpfs: inode: Reduce risk of inum overflow", v7:
tmpfs: per-superblock i_ino support
tmpfs: support 64-bit inums per-sb
Subsystem: mm/memcg
Roman Gushchin <guro@fb.com>:
mm: kmem: make memcg_kmem_enabled() irreversible
Patch series "The new cgroup slab memory controller", v7:
mm: memcg: factor out memcg- and lruvec-level changes out of __mod_lruvec_state()
mm: memcg: prepare for byte-sized vmstat items
mm: memcg: convert vmstat slab counters to bytes
mm: slub: implement SLUB version of obj_to_index()
Johannes Weiner <hannes@cmpxchg.org>:
mm: memcontrol: decouple reference counting from page accounting
Roman Gushchin <guro@fb.com>:
mm: memcg/slab: obj_cgroup API
mm: memcg/slab: allocate obj_cgroups for non-root slab pages
mm: memcg/slab: save obj_cgroup for non-root slab objects
mm: memcg/slab: charge individual slab objects instead of pages
mm: memcg/slab: deprecate memory.kmem.slabinfo
mm: memcg/slab: move memcg_kmem_bypass() to memcontrol.h
mm: memcg/slab: use a single set of kmem_caches for all accounted allocations
mm: memcg/slab: simplify memcg cache creation
mm: memcg/slab: remove memcg_kmem_get_cache()
mm: memcg/slab: deprecate slab_root_caches
mm: memcg/slab: remove redundant check in memcg_accumulate_slabinfo()
mm: memcg/slab: use a single set of kmem_caches for all allocations
kselftests: cgroup: add kernel memory accounting tests
tools/cgroup: add memcg_slabinfo.py tool
Shakeel Butt <shakeelb@google.com>:
mm: memcontrol: account kernel stack per node
Roman Gushchin <guro@fb.com>:
mm: memcg/slab: remove unused argument by charge_slab_page()
mm: slab: rename (un)charge_slab_page() to (un)account_slab_page()
mm: kmem: switch to static_branch_likely() in memcg_kmem_enabled()
mm: memcontrol: avoid workload stalls when lowering memory.high
Chris Down <chris@chrisdown.name>:
Patch series "mm, memcg: reclaim harder before high throttling", v2:
mm, memcg: reclaim more aggressively before high allocator throttling
mm, memcg: unify reclaim retry limits with page allocator
Yafang Shao <laoar.shao@gmail.com>:
Patch series "mm, memcg: memory.{low,min} reclaim fix & cleanup", v4:
mm, memcg: avoid stale protection values when cgroup is above protection
Chris Down <chris@chrisdown.name>:
mm, memcg: decouple e{low,min} state mutations from protection checks
Yafang Shao <laoar.shao@gmail.com>:
memcg, oom: check memcg margin for parallel oom
Johannes Weiner <hannes@cmpxchg.org>:
mm: memcontrol: restore proper dirty throttling when memory.high changes
mm: memcontrol: don't count limit-setting reclaim as memory pressure
Michal Koutný <mkoutny@suse.com>:
mm/page_counter.c: fix protection usage propagation
Subsystem: mm/pagemap
Ralph Campbell <rcampbell@nvidia.com>:
mm: remove redundant check non_swap_entry()
Alex Zhang <zhangalex@google.com>:
mm/memory.c: make remap_pfn_range() reject unaligned addr
Mike Rapoport <rppt@linux.ibm.com>:
Patch series "mm: cleanup usage of <asm/pgalloc.h>":
mm: remove unneeded includes of <asm/pgalloc.h>
opeinrisc: switch to generic version of pte allocation
xtensa: switch to generic version of pte allocation
asm-generic: pgalloc: provide generic pmd_alloc_one() and pmd_free_one()
asm-generic: pgalloc: provide generic pud_alloc_one() and pud_free_one()
asm-generic: pgalloc: provide generic pgd_free()
mm: move lib/ioremap.c to mm/
Joerg Roedel <jroedel@suse.de>:
mm: move p?d_alloc_track to separate header file
Zhen Lei <thunder.leizhen@huawei.com>:
mm/mmap: optimize a branch judgment in ksys_mmap_pgoff()
Feng Tang <feng.tang@intel.com>:
Patch series "make vm_committed_as_batch aware of vm overcommit policy", v6:
proc/meminfo: avoid open coded reading of vm_committed_as
mm/util.c: make vm_memory_committed() more accurate
percpu_counter: add percpu_counter_sync()
mm: adjust vm_committed_as_batch according to vm overcommit policy
Anshuman Khandual <anshuman.khandual@arm.com>:
Patch series "arm64: Enable vmemmap mapping from device memory", v4:
mm/sparsemem: enable vmem_altmap support in vmemmap_populate_basepages()
mm/sparsemem: enable vmem_altmap support in vmemmap_alloc_block_buf()
arm64/mm: enable vmem_altmap support for vmemmap mappings
Miaohe Lin <linmiaohe@huawei.com>:
mm: mmap: merge vma after call_mmap() if possible
Peter Collingbourne <pcc@google.com>:
mm: remove unnecessary wrapper function do_mmap_pgoff()
Subsystem: mm/mremap
Wei Yang <richard.weiyang@linux.alibaba.com>:
Patch series "mm/mremap: cleanup move_page_tables() a little", v5:
mm/mremap: it is sure to have enough space when extent meets requirement
mm/mremap: calculate extent in one place
mm/mremap: start addresses are properly aligned
Subsystem: mm/mincore
Ricardo Cañuelo <ricardo.canuelo@collabora.com>:
selftests: add mincore() tests
Subsystem: mm/sparsemem
Wei Yang <richard.weiyang@linux.alibaba.com>:
mm/sparse: never partially remove memmap for early section
mm/sparse: only sub-section aligned range would be populated
Mike Rapoport <rppt@linux.ibm.com>:
mm/sparse: cleanup the code surrounding memory_present()
Subsystem: mm/vmalloc
"Matthew Wilcox (Oracle)" <willy@infradead.org>:
vmalloc: convert to XArray
"Uladzislau Rezki (Sony)" <urezki@gmail.com>:
mm/vmalloc: simplify merge_or_add_vmap_area()
mm/vmalloc: simplify augment_tree_propagate_check()
mm/vmalloc: switch to "propagate()" callback
mm/vmalloc: update the header about KVA rework
Mike Rapoport <rppt@linux.ibm.com>:
mm: vmalloc: remove redundant assignment in unmap_kernel_range_noflush()
"Uladzislau Rezki (Sony)" <urezki@gmail.com>:
mm/vmalloc.c: remove BUG() from the find_va_links()
Subsystem: mm/kasan
Marco Elver <elver@google.com>:
kasan: improve and simplify Kconfig.kasan
kasan: update required compiler versions in documentation
Walter Wu <walter-zh.wu@mediatek.com>:
Patch series "kasan: memorize and print call_rcu stack", v8:
rcu: kasan: record and print call_rcu() call stack
kasan: record and print the free track
kasan: add tests for call_rcu stack recording
kasan: update documentation for generic kasan
Vincenzo Frascino <vincenzo.frascino@arm.com>:
kasan: remove kasan_unpoison_stack_above_sp_to()
Walter Wu <walter-zh.wu@mediatek.com>:
lib/test_kasan.c: fix KASAN unit tests for tag-based KASAN
Andrey Konovalov <andreyknvl@google.com>:
Patch series "kasan: support stack instrumentation for tag-based mode", v2:
kasan: don't tag stacks allocated with pagealloc
efi: provide empty efi_enter_virtual_mode implementation
kasan, arm64: don't instrument functions that enable kasan
kasan: allow enabling stack tagging for tag-based mode
kasan: adjust kasan_stack_oob for tag-based mode
Subsystem: mm/pagealloc
Vlastimil Babka <vbabka@suse.cz>:
mm, page_alloc: use unlikely() in task_capc()
Jaewon Kim <jaewon31.kim@samsung.com>:
page_alloc: consider highatomic reserve in watermark fast
Charan Teja Reddy <charante@codeaurora.org>:
mm, page_alloc: skip ->waternark_boost for atomic order-0 allocations
David Hildenbrand <david@redhat.com>:
mm: remove vm_total_pages
mm/page_alloc: remove nr_free_pagecache_pages()
mm/memory_hotplug: document why shuffle_zone() is relevant
mm/shuffle: remove dynamic reconfiguration
Wei Yang <richard.weiyang@linux.alibaba.com>:
mm/page_alloc.c: replace the definition of NR_MIGRATETYPE_BITS with PB_migratetype_bits
mm/page_alloc.c: extract the common part in pfn_to_bitidx()
mm/page_alloc.c: simplify pageblock bitmap access
mm/page_alloc.c: remove unnecessary end_bitidx for [set|get]_pfnblock_flags_mask()
Qian Cai <cai@lca.pw>:
mm/page_alloc: silence a KASAN false positive
Wei Yang <richard.weiyang@linux.alibaba.com>:
mm/page_alloc: fallbacks at most has 3 elements
Muchun Song <songmuchun@bytedance.com>:
mm/page_alloc.c: skip setting nodemask when we are in interrupt
Joonsoo Kim <iamjoonsoo.kim@lge.com>:
mm/page_alloc: fix memalloc_nocma_{save/restore} APIs
Subsystem: mm/hugetlb
"Alexander A. Klimov" <grandmaster@al2klimov.de>:
mm: thp: replace HTTP links with HTTPS ones
Peter Xu <peterx@redhat.com>:
mm/hugetlb: fix calculation of adjust_range_if_pmd_sharing_possible
Hugh Dickins <hughd@google.com>:
khugepaged: collapse_pte_mapped_thp() flush the right range
khugepaged: collapse_pte_mapped_thp() protect the pmd lock
khugepaged: retract_page_tables() remember to test exit
khugepaged: khugepaged_test_exit() check mmget_still_valid()
Subsystem: mm/vmscan
dylan-meiners <spacct.spacct@gmail.com>:
mm/vmscan.c: fix typo
Shakeel Butt <shakeelb@google.com>:
mm: vmscan: consistent update to pgrefill
Documentation/admin-guide/kernel-parameters.txt | 2
Documentation/dev-tools/kasan.rst | 10
Documentation/filesystems/dlmfs.rst | 2
Documentation/filesystems/ocfs2.rst | 2
Documentation/filesystems/tmpfs.rst | 18
Documentation/vm/arch_pgtable_helpers.rst | 258 +++++
Documentation/vm/memory-model.rst | 9
Documentation/vm/slub.rst | 51 -
arch/alpha/include/asm/pgalloc.h | 21
arch/alpha/include/asm/tlbflush.h | 1
arch/alpha/kernel/core_irongate.c | 1
arch/alpha/kernel/core_marvel.c | 1
arch/alpha/kernel/core_titan.c | 1
arch/alpha/kernel/machvec_impl.h | 2
arch/alpha/kernel/smp.c | 1
arch/alpha/mm/numa.c | 1
arch/arc/mm/fault.c | 1
arch/arc/mm/init.c | 1
arch/arm/include/asm/pgalloc.h | 12
arch/arm/include/asm/tlb.h | 1
arch/arm/kernel/machine_kexec.c | 1
arch/arm/kernel/smp.c | 1
arch/arm/kernel/suspend.c | 1
arch/arm/mach-omap2/omap-mpuss-lowpower.c | 1
arch/arm/mm/hugetlbpage.c | 1
arch/arm/mm/init.c | 9
arch/arm/mm/mmu.c | 1
arch/arm64/include/asm/pgalloc.h | 39
arch/arm64/kernel/setup.c | 2
arch/arm64/kernel/smp.c | 1
arch/arm64/mm/hugetlbpage.c | 1
arch/arm64/mm/init.c | 6
arch/arm64/mm/ioremap.c | 1
arch/arm64/mm/mmu.c | 63 -
arch/csky/include/asm/pgalloc.h | 7
arch/csky/kernel/smp.c | 1
arch/hexagon/include/asm/pgalloc.h | 7
arch/ia64/include/asm/pgalloc.h | 24
arch/ia64/include/asm/tlb.h | 1
arch/ia64/kernel/process.c | 1
arch/ia64/kernel/smp.c | 1
arch/ia64/kernel/smpboot.c | 1
arch/ia64/mm/contig.c | 1
arch/ia64/mm/discontig.c | 4
arch/ia64/mm/hugetlbpage.c | 1
arch/ia64/mm/tlb.c | 1
arch/m68k/include/asm/mmu_context.h | 2
arch/m68k/include/asm/sun3_pgalloc.h | 7
arch/m68k/kernel/dma.c | 2
arch/m68k/kernel/traps.c | 3
arch/m68k/mm/cache.c | 2
arch/m68k/mm/fault.c | 1
arch/m68k/mm/kmap.c | 2
arch/m68k/mm/mcfmmu.c | 1
arch/m68k/mm/memory.c | 1
arch/m68k/sun3x/dvma.c | 2
arch/microblaze/include/asm/pgalloc.h | 6
arch/microblaze/include/asm/tlbflush.h | 1
arch/microblaze/kernel/process.c | 1
arch/microblaze/kernel/signal.c | 1
arch/microblaze/mm/init.c | 3
arch/mips/include/asm/pgalloc.h | 19
arch/mips/kernel/setup.c | 8
arch/mips/loongson64/numa.c | 1
arch/mips/sgi-ip27/ip27-memory.c | 2
arch/mips/sgi-ip32/ip32-memory.c | 1
arch/nds32/mm/mm-nds32.c | 2
arch/nios2/include/asm/pgalloc.h | 7
arch/openrisc/include/asm/pgalloc.h | 33
arch/openrisc/include/asm/tlbflush.h | 1
arch/openrisc/kernel/or32_ksyms.c | 1
arch/parisc/include/asm/mmu_context.h | 1
arch/parisc/include/asm/pgalloc.h | 12
arch/parisc/kernel/cache.c | 1
arch/parisc/kernel/pci-dma.c | 1
arch/parisc/kernel/process.c | 1
arch/parisc/kernel/signal.c | 1
arch/parisc/kernel/smp.c | 1
arch/parisc/mm/hugetlbpage.c | 1
arch/parisc/mm/init.c | 5
arch/parisc/mm/ioremap.c | 2
arch/powerpc/include/asm/tlb.h | 1
arch/powerpc/mm/book3s64/hash_hugetlbpage.c | 1
arch/powerpc/mm/book3s64/hash_pgtable.c | 1
arch/powerpc/mm/book3s64/hash_tlb.c | 1
arch/powerpc/mm/book3s64/radix_hugetlbpage.c | 1
arch/powerpc/mm/init_32.c | 1
arch/powerpc/mm/init_64.c | 4
arch/powerpc/mm/kasan/8xx.c | 1
arch/powerpc/mm/kasan/book3s_32.c | 1
arch/powerpc/mm/mem.c | 3
arch/powerpc/mm/nohash/40x.c | 1
arch/powerpc/mm/nohash/8xx.c | 1
arch/powerpc/mm/nohash/fsl_booke.c | 1
arch/powerpc/mm/nohash/kaslr_booke.c | 1
arch/powerpc/mm/nohash/tlb.c | 1
arch/powerpc/mm/numa.c | 1
arch/powerpc/mm/pgtable.c | 1
arch/powerpc/mm/pgtable_64.c | 1
arch/powerpc/mm/ptdump/hashpagetable.c | 2
arch/powerpc/mm/ptdump/ptdump.c | 1
arch/powerpc/platforms/pseries/cmm.c | 1
arch/riscv/include/asm/pgalloc.h | 18
arch/riscv/mm/fault.c | 1
arch/riscv/mm/init.c | 3
arch/s390/crypto/prng.c | 4
arch/s390/include/asm/tlb.h | 1
arch/s390/include/asm/tlbflush.h | 1
arch/s390/kernel/machine_kexec.c | 1
arch/s390/kernel/ptrace.c | 1
arch/s390/kvm/diag.c | 1
arch/s390/kvm/priv.c | 1
arch/s390/kvm/pv.c | 1
arch/s390/mm/cmm.c | 1
arch/s390/mm/init.c | 1
arch/s390/mm/mmap.c | 1
arch/s390/mm/pgtable.c | 1
arch/sh/include/asm/pgalloc.h | 4
arch/sh/kernel/idle.c | 1
arch/sh/kernel/machine_kexec.c | 1
arch/sh/mm/cache-sh3.c | 1
arch/sh/mm/cache-sh7705.c | 1
arch/sh/mm/hugetlbpage.c | 1
arch/sh/mm/init.c | 7
arch/sh/mm/ioremap_fixed.c | 1
arch/sh/mm/numa.c | 3
arch/sh/mm/tlb-sh3.c | 1
arch/sparc/include/asm/ide.h | 1
arch/sparc/include/asm/tlb_64.h | 1
arch/sparc/kernel/leon_smp.c | 1
arch/sparc/kernel/process_32.c | 1
arch/sparc/kernel/signal_32.c | 1
arch/sparc/kernel/smp_32.c | 1
arch/sparc/kernel/smp_64.c | 1
arch/sparc/kernel/sun4m_irq.c | 1
arch/sparc/mm/highmem.c | 1
arch/sparc/mm/init_64.c | 1
arch/sparc/mm/io-unit.c | 1
arch/sparc/mm/iommu.c | 1
arch/sparc/mm/tlb.c | 1
arch/um/include/asm/pgalloc.h | 9
arch/um/include/asm/pgtable-3level.h | 3
arch/um/kernel/mem.c | 17
arch/x86/ia32/ia32_aout.c | 1
arch/x86/include/asm/mmu_context.h | 1
arch/x86/include/asm/pgalloc.h | 42
arch/x86/kernel/alternative.c | 1
arch/x86/kernel/apic/apic.c | 1
arch/x86/kernel/mpparse.c | 1
arch/x86/kernel/traps.c | 1
arch/x86/mm/fault.c | 1
arch/x86/mm/hugetlbpage.c | 1
arch/x86/mm/init_32.c | 2
arch/x86/mm/init_64.c | 12
arch/x86/mm/kaslr.c | 1
arch/x86/mm/pgtable_32.c | 1
arch/x86/mm/pti.c | 1
arch/x86/platform/uv/bios_uv.c | 1
arch/x86/power/hibernate.c | 2
arch/xtensa/include/asm/pgalloc.h | 46
arch/xtensa/kernel/xtensa_ksyms.c | 1
arch/xtensa/mm/cache.c | 1
arch/xtensa/mm/fault.c | 1
crypto/adiantum.c | 2
crypto/ahash.c | 4
crypto/api.c | 2
crypto/asymmetric_keys/verify_pefile.c | 4
crypto/deflate.c | 2
crypto/drbg.c | 10
crypto/ecc.c | 8
crypto/ecdh.c | 2
crypto/gcm.c | 2
crypto/gf128mul.c | 4
crypto/jitterentropy-kcapi.c | 2
crypto/rng.c | 2
crypto/rsa-pkcs1pad.c | 6
crypto/seqiv.c | 2
crypto/shash.c | 2
crypto/skcipher.c | 2
crypto/testmgr.c | 6
crypto/zstd.c | 2
drivers/base/node.c | 10
drivers/block/xen-blkback/common.h | 1
drivers/crypto/allwinner/sun8i-ce/sun8i-ce-cipher.c | 2
drivers/crypto/allwinner/sun8i-ss/sun8i-ss-cipher.c | 2
drivers/crypto/amlogic/amlogic-gxl-cipher.c | 4
drivers/crypto/atmel-ecc.c | 2
drivers/crypto/caam/caampkc.c | 28
drivers/crypto/cavium/cpt/cptvf_main.c | 6
drivers/crypto/cavium/cpt/cptvf_reqmanager.c | 12
drivers/crypto/cavium/nitrox/nitrox_lib.c | 4
drivers/crypto/cavium/zip/zip_crypto.c | 6
drivers/crypto/ccp/ccp-crypto-rsa.c | 6
drivers/crypto/ccree/cc_aead.c | 4
drivers/crypto/ccree/cc_buffer_mgr.c | 4
drivers/crypto/ccree/cc_cipher.c | 6
drivers/crypto/ccree/cc_hash.c | 8
drivers/crypto/ccree/cc_request_mgr.c | 2
drivers/crypto/marvell/cesa/hash.c | 2
drivers/crypto/marvell/octeontx/otx_cptvf_main.c | 6
drivers/crypto/marvell/octeontx/otx_cptvf_reqmgr.h | 2
drivers/crypto/nx/nx.c | 4
drivers/crypto/virtio/virtio_crypto_algs.c | 12
drivers/crypto/virtio/virtio_crypto_core.c | 2
drivers/iommu/ipmmu-vmsa.c | 1
drivers/md/dm-crypt.c | 32
drivers/md/dm-integrity.c | 6
drivers/misc/ibmvmc.c | 6
drivers/net/ethernet/hisilicon/hns3/hns3pf/hclge_mbx.c | 2
drivers/net/ethernet/intel/ixgbe/ixgbe_ipsec.c | 6
drivers/net/ppp/ppp_mppe.c | 6
drivers/net/wireguard/noise.c | 4
drivers/net/wireguard/peer.c | 2
drivers/net/wireless/intel/iwlwifi/pcie/rx.c | 2
drivers/net/wireless/intel/iwlwifi/pcie/tx-gen2.c | 6
drivers/net/wireless/intel/iwlwifi/pcie/tx.c | 6
drivers/net/wireless/intersil/orinoco/wext.c | 4
drivers/s390/crypto/ap_bus.h | 4
drivers/staging/ks7010/ks_hostif.c | 2
drivers/staging/rtl8723bs/core/rtw_security.c | 2
drivers/staging/wlan-ng/p80211netdev.c | 2
drivers/target/iscsi/iscsi_target_auth.c | 2
drivers/xen/balloon.c | 1
drivers/xen/privcmd.c | 1
fs/Kconfig | 21
fs/aio.c | 6
fs/binfmt_elf_fdpic.c | 1
fs/cifs/cifsencrypt.c | 2
fs/cifs/connect.c | 10
fs/cifs/dfs_cache.c | 2
fs/cifs/misc.c | 8
fs/crypto/inline_crypt.c | 5
fs/crypto/keyring.c | 6
fs/crypto/keysetup_v1.c | 4
fs/ecryptfs/keystore.c | 4
fs/ecryptfs/messaging.c | 2
fs/hugetlbfs/inode.c | 2
fs/ntfs/dir.c | 2
fs/ntfs/inode.c | 27
fs/ntfs/inode.h | 4
fs/ntfs/mft.c | 4
fs/ocfs2/Kconfig | 6
fs/ocfs2/acl.c | 2
fs/ocfs2/blockcheck.c | 2
fs/ocfs2/dlmglue.c | 8
fs/ocfs2/ocfs2.h | 4
fs/ocfs2/suballoc.c | 4
fs/ocfs2/suballoc.h | 2
fs/ocfs2/super.c | 4
fs/proc/meminfo.c | 10
include/asm-generic/pgalloc.h | 80 +
include/asm-generic/tlb.h | 1
include/crypto/aead.h | 2
include/crypto/akcipher.h | 2
include/crypto/gf128mul.h | 2
include/crypto/hash.h | 2
include/crypto/internal/acompress.h | 2
include/crypto/kpp.h | 2
include/crypto/skcipher.h | 2
include/linux/efi.h | 4
include/linux/fs.h | 17
include/linux/huge_mm.h | 2
include/linux/kasan.h | 4
include/linux/memcontrol.h | 209 +++-
include/linux/mm.h | 86 -
include/linux/mm_types.h | 5
include/linux/mman.h | 4
include/linux/mmu_notifier.h | 13
include/linux/mmzone.h | 54 -
include/linux/pageblock-flags.h | 30
include/linux/percpu_counter.h | 4
include/linux/sched/mm.h | 8
include/linux/shmem_fs.h | 3
include/linux/slab.h | 11
include/linux/slab_def.h | 9
include/linux/slub_def.h | 31
include/linux/swap.h | 2
include/linux/vmstat.h | 14
init/Kconfig | 9
init/main.c | 2
ipc/shm.c | 2
kernel/fork.c | 54 -
kernel/kthread.c | 8
kernel/power/snapshot.c | 2
kernel/rcu/tree.c | 2
kernel/scs.c | 2
kernel/sysctl.c | 2
lib/Kconfig.kasan | 39
lib/Makefile | 1
lib/ioremap.c | 287 -----
lib/mpi/mpiutil.c | 6
lib/percpu_counter.c | 19
lib/test_kasan.c | 87 +
mm/Kconfig | 6
mm/Makefile | 2
mm/debug.c | 103 +-
mm/debug_vm_pgtable.c | 666 +++++++++++++
mm/filemap.c | 9
mm/gup.c | 3
mm/huge_memory.c | 14
mm/hugetlb.c | 25
mm/ioremap.c | 289 +++++
mm/kasan/common.c | 41
mm/kasan/generic.c | 43
mm/kasan/generic_report.c | 1
mm/kasan/kasan.h | 25
mm/kasan/quarantine.c | 1
mm/kasan/report.c | 54 -
mm/kasan/tags.c | 37
mm/khugepaged.c | 75 -
mm/memcontrol.c | 832 ++++++++++-------
mm/memory.c | 15
mm/memory_hotplug.c | 11
mm/migrate.c | 6
mm/mm_init.c | 20
mm/mmap.c | 45
mm/mremap.c | 19
mm/nommu.c | 6
mm/oom_kill.c | 2
mm/page-writeback.c | 6
mm/page_alloc.c | 226 ++--
mm/page_counter.c | 6
mm/page_io.c | 2
mm/pgalloc-track.h | 51 +
mm/shmem.c | 133 ++
mm/shuffle.c | 46
mm/shuffle.h | 17
mm/slab.c | 129 +-
mm/slab.h | 755 ++++++---------
mm/slab_common.c | 829 ++--------------
mm/slob.c | 12
mm/slub.c | 680 ++++---------
mm/sparse-vmemmap.c | 62 -
mm/sparse.c | 31
mm/swap_slots.c | 45
mm/swap_state.c | 2
mm/util.c | 52 +
mm/vmalloc.c | 176 +--
mm/vmscan.c | 39
mm/vmstat.c | 38
mm/workingset.c | 6
net/atm/mpoa_caches.c | 4
net/bluetooth/ecdh_helper.c | 6
net/bluetooth/smp.c | 24
net/core/sock.c | 2
net/ipv4/tcp_fastopen.c | 2
net/mac80211/aead_api.c | 4
net/mac80211/aes_gmac.c | 2
net/mac80211/key.c | 2
net/mac802154/llsec.c | 20
net/sctp/auth.c | 2
net/sunrpc/auth_gss/gss_krb5_crypto.c | 4
net/sunrpc/auth_gss/gss_krb5_keys.c | 6
net/sunrpc/auth_gss/gss_krb5_mech.c | 2
net/tipc/crypto.c | 10
net/wireless/core.c | 2
net/wireless/ibss.c | 4
net/wireless/lib80211_crypt_tkip.c | 2
net/wireless/lib80211_crypt_wep.c | 2
net/wireless/nl80211.c | 24
net/wireless/sme.c | 6
net/wireless/util.c | 2
net/wireless/wext-sme.c | 2
scripts/Makefile.kasan | 3
scripts/bloat-o-meter | 2
scripts/coccinelle/free/devm_free.cocci | 4
scripts/coccinelle/free/ifnullfree.cocci | 4
scripts/coccinelle/free/kfree.cocci | 6
scripts/coccinelle/free/kfreeaddr.cocci | 2
scripts/const_structs.checkpatch | 1
scripts/decode_stacktrace.sh | 85 +
scripts/spelling.txt | 19
scripts/tags.sh | 18
security/apparmor/domain.c | 4
security/apparmor/include/file.h | 2
security/apparmor/policy.c | 24
security/apparmor/policy_ns.c | 6
security/apparmor/policy_unpack.c | 14
security/keys/big_key.c | 6
security/keys/dh.c | 14
security/keys/encrypted-keys/encrypted.c | 14
security/keys/trusted-keys/trusted_tpm1.c | 34
security/keys/user_defined.c | 6
tools/cgroup/memcg_slabinfo.py | 226 ++++
tools/include/linux/jhash.h | 2
tools/lib/rbtree.c | 2
tools/lib/traceevent/event-parse.h | 2
tools/testing/ktest/examples/README | 2
tools/testing/ktest/examples/crosstests.conf | 2
tools/testing/selftests/Makefile | 1
tools/testing/selftests/cgroup/.gitignore | 1
tools/testing/selftests/cgroup/Makefile | 2
tools/testing/selftests/cgroup/cgroup_util.c | 2
tools/testing/selftests/cgroup/test_kmem.c | 382 +++++++
tools/testing/selftests/mincore/.gitignore | 2
tools/testing/selftests/mincore/Makefile | 6
tools/testing/selftests/mincore/mincore_selftest.c | 361 +++++++
397 files changed, 5547 insertions(+), 4072 deletions(-)
^ permalink raw reply [flat|nested] 232+ messages in thread
* incoming
@ 2020-08-12 1:29 Andrew Morton
0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2020-08-12 1:29 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm
- Most of the rest of MM
- various other subsystems
165 patches, based on 00e4db51259a5f936fec1424b884f029479d3981.
Subsystems affected by this patch series:
mm/memcg
mm/hugetlb
mm/vmscan
mm/proc
mm/compaction
mm/mempolicy
mm/oom-kill
mm/hugetlbfs
mm/migration
mm/thp
mm/cma
mm/util
mm/memory-hotplug
mm/cleanups
mm/uaccess
alpha
misc
sparse
bitmap
lib
lz4
bitops
checkpatch
autofs
minix
nilfs
ufs
fat
signals
kmod
coredump
exec
kdump
rapidio
panic
kcov
kgdb
ipc
mm/migration
mm/gup
mm/pagemap
Subsystem: mm/memcg
Roman Gushchin <guro@fb.com>:
Patch series "mm: memcg accounting of percpu memory", v3:
percpu: return number of released bytes from pcpu_free_area()
mm: memcg/percpu: account percpu memory to memory cgroups
mm: memcg/percpu: per-memcg percpu memory statistics
mm: memcg: charge memcg percpu memory to the parent cgroup
kselftests: cgroup: add perpcu memory accounting test
Subsystem: mm/hugetlb
Muchun Song <songmuchun@bytedance.com>:
mm/hugetlb: add mempolicy check in the reservation routine
Subsystem: mm/vmscan
Joonsoo Kim <iamjoonsoo.kim@lge.com>:
Patch series "workingset protection/detection on the anonymous LRU list", v7:
mm/vmscan: make active/inactive ratio as 1:1 for anon lru
mm/vmscan: protect the workingset on anonymous LRU
mm/workingset: prepare the workingset detection infrastructure for anon LRU
mm/swapcache: support to handle the shadow entries
mm/swap: implement workingset detection for anonymous LRU
mm/vmscan: restore active/inactive ratio for anonymous LRU
Subsystem: mm/proc
Michal Koutný <mkoutny@suse.com>:
/proc/PID/smaps: consistent whitespace output format
Subsystem: mm/compaction
Nitin Gupta <nigupta@nvidia.com>:
mm: proactive compaction
mm: fix compile error due to COMPACTION_HPAGE_ORDER
mm: use unsigned types for fragmentation score
Alex Shi <alex.shi@linux.alibaba.com>:
mm/compaction: correct the comments of compact_defer_shift
Subsystem: mm/mempolicy
Krzysztof Kozlowski <krzk@kernel.org>:
mm: mempolicy: fix kerneldoc of numa_map_to_online_node()
Wenchao Hao <haowenchao22@gmail.com>:
mm/mempolicy.c: check parameters first in kernel_get_mempolicy
Yanfei Xu <yanfei.xu@windriver.com>:
include/linux/mempolicy.h: fix typo
Subsystem: mm/oom-kill
Yafang Shao <laoar.shao@gmail.com>:
mm, oom: make the calculation of oom badness more accurate
Michal Hocko <mhocko@suse.com>:
doc, mm: sync up oom_score_adj documentation
doc, mm: clarify /proc/<pid>/oom_score value range
Yafang Shao <laoar.shao@gmail.com>:
mm, oom: show process exiting information in __oom_kill_process()
Subsystem: mm/hugetlbfs
Mike Kravetz <mike.kravetz@oracle.com>:
hugetlbfs: prevent filesystem stacking of hugetlbfs
hugetlbfs: remove call to huge_pte_alloc without i_mmap_rwsem
Subsystem: mm/migration
Ralph Campbell <rcampbell@nvidia.com>:
Patch series "mm/migrate: optimize migrate_vma_setup() for holes":
mm/migrate: optimize migrate_vma_setup() for holes
mm/migrate: add migrate-shared test for migrate_vma_*()
Subsystem: mm/thp
Yang Shi <yang.shi@linux.alibaba.com>:
mm: thp: remove debug_cow switch
Anshuman Khandual <anshuman.khandual@arm.com>:
mm/vmstat: add events for THP migration without split
Subsystem: mm/cma
Jianqun Xu <jay.xu@rock-chips.com>:
mm/cma.c: fix NULL pointer dereference when cma could not be activated
Barry Song <song.bao.hua@hisilicon.com>:
Patch series "mm: fix the names of general cma and hugetlb cma", v2:
mm: cma: fix the name of CMA areas
mm: hugetlb: fix the name of hugetlb CMA
Mike Kravetz <mike.kravetz@oracle.com>:
cma: don't quit at first error when activating reserved areas
Subsystem: mm/util
Waiman Long <longman@redhat.com>:
include/linux/sched/mm.h: optimize current_gfp_context()
Krzysztof Kozlowski <krzk@kernel.org>:
mm: mmu_notifier: fix and extend kerneldoc
Subsystem: mm/memory-hotplug
Daniel Jordan <daniel.m.jordan@oracle.com>:
x86/mm: use max memory block size on bare metal
Jia He <justin.he@arm.com>:
mm/memory_hotplug: introduce default dummy memory_add_physaddr_to_nid()
mm/memory_hotplug: fix unpaired mem_hotplug_begin/done
Charan Teja Reddy <charante@codeaurora.org>:
mm, memory_hotplug: update pcp lists everytime onlining a memory block
Subsystem: mm/cleanups
Randy Dunlap <rdunlap@infradead.org>:
mm: drop duplicated words in <linux/pgtable.h>
mm: drop duplicated words in <linux/mm.h>
include/linux/highmem.h: fix duplicated words in a comment
include/linux/frontswap.h: drop duplicated word in a comment
include/linux/memcontrol.h: drop duplicate word and fix spello
Arvind Sankar <nivedita@alum.mit.edu>:
sh/mm: drop unused MAX_PHYSADDR_BITS
sparc: drop unused MAX_PHYSADDR_BITS
Randy Dunlap <rdunlap@infradead.org>:
mm/compaction.c: delete duplicated word
mm/filemap.c: delete duplicated word
mm/hmm.c: delete duplicated word
mm/hugetlb.c: delete duplicated words
mm/memcontrol.c: delete duplicated words
mm/memory.c: delete duplicated words
mm/migrate.c: delete duplicated word
mm/nommu.c: delete duplicated words
mm/page_alloc.c: delete or fix duplicated words
mm/shmem.c: delete duplicated word
mm/slab_common.c: delete duplicated word
mm/usercopy.c: delete duplicated word
mm/vmscan.c: delete or fix duplicated words
mm/zpool.c: delete duplicated word and fix grammar
mm/zsmalloc.c: fix duplicated words
Subsystem: mm/uaccess
Christoph Hellwig <hch@lst.de>:
Patch series "clean up address limit helpers", v2:
syscalls: use uaccess_kernel in addr_limit_user_check
nds32: use uaccess_kernel in show_regs
riscv: include <asm/pgtable.h> in <asm/uaccess.h>
uaccess: remove segment_eq
uaccess: add force_uaccess_{begin,end} helpers
exec: use force_uaccess_begin during exec and exit
Subsystem: alpha
Luc Van Oostenryck <luc.vanoostenryck@gmail.com>:
alpha: fix annotation of io{read,write}{16,32}be()
Subsystem: misc
Randy Dunlap <rdunlap@infradead.org>:
include/linux/compiler-clang.h: drop duplicated word in a comment
include/linux/exportfs.h: drop duplicated word in a comment
include/linux/async_tx.h: drop duplicated word in a comment
include/linux/xz.h: drop duplicated word
Christoph Hellwig <hch@lst.de>:
kernel: add a kernel_wait helper
Feng Tang <feng.tang@intel.com>:
./Makefile: add debug option to enable function aligned on 32 bytes
Arvind Sankar <nivedita@alum.mit.edu>:
kernel.h: remove duplicate include of asm/div64.h
"Alexander A. Klimov" <grandmaster@al2klimov.de>:
include/: replace HTTP links with HTTPS ones
Matthew Wilcox <willy@infradead.org>:
include/linux/poison.h: remove obsolete comment
Subsystem: sparse
Luc Van Oostenryck <luc.vanoostenryck@gmail.com>:
sparse: group the defines by functionality
Subsystem: bitmap
Stefano Brivio <sbrivio@redhat.com>:
Patch series "lib: Fix bitmap_cut() for overlaps, add test":
lib/bitmap.c: fix bitmap_cut() for partial overlapping case
lib/test_bitmap.c: add test for bitmap_cut()
Subsystem: lib
Luc Van Oostenryck <luc.vanoostenryck@gmail.com>:
lib/generic-radix-tree.c: remove unneeded __rcu
Geert Uytterhoeven <geert@linux-m68k.org>:
lib/test_bitops: do the full test during module init
Wei Yongjun <weiyongjun1@huawei.com>:
lib/test_lockup.c: make symbol 'test_works' static
Tiezhu Yang <yangtiezhu@loongson.cn>:
lib/Kconfig.debug: make TEST_LOCKUP depend on module
lib/test_lockup.c: fix return value of test_lockup_init()
"Alexander A. Klimov" <grandmaster@al2klimov.de>:
lib/: replace HTTP links with HTTPS ones
"Kars Mulder" <kerneldev@karsmulder.nl>:
kstrto*: correct documentation references to simple_strto*()
kstrto*: do not describe simple_strto*() as obsolete/replaced
Subsystem: lz4
Nick Terrell <terrelln@fb.com>:
lz4: fix kernel decompression speed
Subsystem: bitops
Rikard Falkeborn <rikard.falkeborn@gmail.com>:
lib/test_bits.c: add tests of GENMASK
Subsystem: checkpatch
Joe Perches <joe@perches.com>:
checkpatch: add test for possible misuse of IS_ENABLED() without CONFIG_
checkpatch: add --fix option for ASSIGN_IN_IF
Quentin Monnet <quentin@isovalent.com>:
checkpatch: fix CONST_STRUCT when const_structs.checkpatch is missing
Joe Perches <joe@perches.com>:
checkpatch: add test for repeated words
checkpatch: remove missing switch/case break test
Subsystem: autofs
Randy Dunlap <rdunlap@infradead.org>:
autofs: fix doubled word
Subsystem: minix
Eric Biggers <ebiggers@google.com>:
Patch series "fs/minix: fix syzbot bugs and set s_maxbytes":
fs/minix: check return value of sb_getblk()
fs/minix: don't allow getting deleted inodes
fs/minix: reject too-large maximum file size
fs/minix: set s_maxbytes correctly
fs/minix: fix block limit check for V1 filesystems
fs/minix: remove expected error message in block_to_path()
Subsystem: nilfs
Eric Biggers <ebiggers@google.com>:
Patch series "nilfs2 updates":
nilfs2: only call unlock_new_inode() if I_NEW
Joe Perches <joe@perches.com>:
nilfs2: convert __nilfs_msg to integrate the level and format
nilfs2: use a more common logging style
Subsystem: ufs
Colin Ian King <colin.king@canonical.com>:
fs/ufs: avoid potential u32 multiplication overflow
Subsystem: fat
Yubo Feng <fengyubo3@huawei.com>:
fatfs: switch write_lock to read_lock in fat_ioctl_get_attributes
"Alexander A. Klimov" <grandmaster@al2klimov.de>:
VFAT/FAT/MSDOS FILESYSTEM: replace HTTP links with HTTPS ones
OGAWA Hirofumi <hirofumi@mail.parknet.co.jp>:
fat: fix fat_ra_init() for data clusters == 0
Subsystem: signals
Helge Deller <deller@gmx.de>:
fs/signalfd.c: fix inconsistent return codes for signalfd4
Subsystem: kmod
Tiezhu Yang <yangtiezhu@loongson.cn>:
Patch series "kmod/umh: a few fixes":
selftests: kmod: use variable NAME in kmod_test_0001()
kmod: remove redundant "be an" in the comment
test_kmod: avoid potential double free in trigger_config_run_type()
Subsystem: coredump
Lepton Wu <ytht.net@gmail.com>:
coredump: add %f for executable filename
Subsystem: exec
Kees Cook <keescook@chromium.org>:
Patch series "Relocate execve() sanity checks", v2:
exec: change uselib(2) IS_SREG() failure to EACCES
exec: move S_ISREG() check earlier
exec: move path_noexec() check earlier
Subsystem: kdump
Vijay Balakrishna <vijayb@linux.microsoft.com>:
kdump: append kernel build-id string to VMCOREINFO
Subsystem: rapidio
"Gustavo A. R. Silva" <gustavoars@kernel.org>:
drivers/rapidio/devices/rio_mport_cdev.c: use struct_size() helper
drivers/rapidio/rio-scan.c: use struct_size() helper
rapidio/rio_mport_cdev: use array_size() helper in copy_{from,to}_user()
Subsystem: panic
Tiezhu Yang <yangtiezhu@loongson.cn>:
kernel/panic.c: make oops_may_print() return bool
lib/Kconfig.debug: fix typo in the help text of CONFIG_PANIC_TIMEOUT
Yue Hu <huyue2@yulong.com>:
panic: make print_oops_end_marker() static
Subsystem: kcov
Marco Elver <elver@google.com>:
kcov: unconditionally add -fno-stack-protector to compiler options
Wei Yongjun <weiyongjun1@huawei.com>:
kcov: make some symbols static
Subsystem: kgdb
Nick Desaulniers <ndesaulniers@google.com>:
scripts/gdb: fix python 3.8 SyntaxWarning
Subsystem: ipc
Alexey Dobriyan <adobriyan@gmail.com>:
ipc: uninline functions
Liao Pingfang <liao.pingfang@zte.com.cn>:
ipc/shm.c: remove the superfluous break
Subsystem: mm/migration
Joonsoo Kim <iamjoonsoo.kim@lge.com>:
Patch series "clean-up the migration target allocation functions", v5:
mm/page_isolation: prefer the node of the source page
mm/migrate: move migration helper from .h to .c
mm/hugetlb: unify migration callbacks
mm/migrate: clear __GFP_RECLAIM to make the migration callback consistent with regular THP allocations
mm/migrate: introduce a standard migration target allocation function
mm/mempolicy: use a standard migration target allocation callback
mm/page_alloc: remove a wrapper for alloc_migration_target()
Subsystem: mm/gup
Joonsoo Kim <iamjoonsoo.kim@lge.com>:
mm/gup: restrict CMA region by using allocation scope API
mm/hugetlb: make hugetlb migration callback CMA aware
mm/gup: use a standard migration target allocation callback
Subsystem: mm/pagemap
Peter Xu <peterx@redhat.com>:
Patch series "mm: Page fault accounting cleanups", v5:
mm: do page fault accounting in handle_mm_fault
mm/alpha: use general page fault accounting
mm/arc: use general page fault accounting
mm/arm: use general page fault accounting
mm/arm64: use general page fault accounting
mm/csky: use general page fault accounting
mm/hexagon: use general page fault accounting
mm/ia64: use general page fault accounting
mm/m68k: use general page fault accounting
mm/microblaze: use general page fault accounting
mm/mips: use general page fault accounting
mm/nds32: use general page fault accounting
mm/nios2: use general page fault accounting
mm/openrisc: use general page fault accounting
mm/parisc: use general page fault accounting
mm/powerpc: use general page fault accounting
mm/riscv: use general page fault accounting
mm/s390: use general page fault accounting
mm/sh: use general page fault accounting
mm/sparc32: use general page fault accounting
mm/sparc64: use general page fault accounting
mm/x86: use general page fault accounting
mm/xtensa: use general page fault accounting
mm: clean up the last pieces of page fault accountings
mm/gup: remove task_struct pointer for all gup code
Documentation/admin-guide/cgroup-v2.rst | 4
Documentation/admin-guide/sysctl/kernel.rst | 3
Documentation/admin-guide/sysctl/vm.rst | 15 +
Documentation/filesystems/proc.rst | 11 -
Documentation/vm/page_migration.rst | 27 +++
Makefile | 4
arch/alpha/include/asm/io.h | 8
arch/alpha/include/asm/uaccess.h | 2
arch/alpha/mm/fault.c | 10 -
arch/arc/include/asm/segment.h | 3
arch/arc/kernel/process.c | 2
arch/arc/mm/fault.c | 20 --
arch/arm/include/asm/uaccess.h | 4
arch/arm/kernel/signal.c | 2
arch/arm/mm/fault.c | 27 ---
arch/arm64/include/asm/uaccess.h | 2
arch/arm64/kernel/sdei.c | 2
arch/arm64/mm/fault.c | 31 ---
arch/arm64/mm/numa.c | 10 -
arch/csky/include/asm/segment.h | 2
arch/csky/mm/fault.c | 15 -
arch/h8300/include/asm/segment.h | 2
arch/hexagon/mm/vm_fault.c | 11 -
arch/ia64/include/asm/uaccess.h | 2
arch/ia64/mm/fault.c | 11 -
arch/ia64/mm/numa.c | 2
arch/m68k/include/asm/segment.h | 2
arch/m68k/include/asm/tlbflush.h | 6
arch/m68k/mm/fault.c | 16 -
arch/microblaze/include/asm/uaccess.h | 2
arch/microblaze/mm/fault.c | 11 -
arch/mips/include/asm/uaccess.h | 2
arch/mips/kernel/unaligned.c | 27 +--
arch/mips/mm/fault.c | 16 -
arch/nds32/include/asm/uaccess.h | 2
arch/nds32/kernel/process.c | 2
arch/nds32/mm/alignment.c | 7
arch/nds32/mm/fault.c | 21 --
arch/nios2/include/asm/uaccess.h | 2
arch/nios2/mm/fault.c | 16 -
arch/openrisc/include/asm/uaccess.h | 2
arch/openrisc/mm/fault.c | 11 -
arch/parisc/include/asm/uaccess.h | 2
arch/parisc/mm/fault.c | 10 -
arch/powerpc/include/asm/uaccess.h | 3
arch/powerpc/mm/copro_fault.c | 7
arch/powerpc/mm/fault.c | 13 -
arch/riscv/include/asm/uaccess.h | 6
arch/riscv/mm/fault.c | 18 --
arch/s390/include/asm/uaccess.h | 2
arch/s390/kvm/interrupt.c | 2
arch/s390/kvm/kvm-s390.c | 2
arch/s390/kvm/priv.c | 8
arch/s390/mm/fault.c | 18 --
arch/s390/mm/gmap.c | 4
arch/sh/include/asm/segment.h | 3
arch/sh/include/asm/sparsemem.h | 4
arch/sh/kernel/traps_32.c | 12 -
arch/sh/mm/fault.c | 13 -
arch/sh/mm/init.c | 9 -
arch/sparc/include/asm/sparsemem.h | 1
arch/sparc/include/asm/uaccess_32.h | 2
arch/sparc/include/asm/uaccess_64.h | 2
arch/sparc/mm/fault_32.c | 15 -
arch/sparc/mm/fault_64.c | 13 -
arch/um/kernel/trap.c | 6
arch/x86/include/asm/uaccess.h | 2
arch/x86/mm/fault.c | 19 --
arch/x86/mm/init_64.c | 9 +
arch/x86/mm/numa.c | 1
arch/xtensa/include/asm/uaccess.h | 2
arch/xtensa/mm/fault.c | 17 -
drivers/firmware/arm_sdei.c | 5
drivers/gpu/drm/i915/gem/i915_gem_userptr.c | 2
drivers/infiniband/core/umem_odp.c | 2
drivers/iommu/amd/iommu_v2.c | 2
drivers/iommu/intel/svm.c | 3
drivers/rapidio/devices/rio_mport_cdev.c | 7
drivers/rapidio/rio-scan.c | 8
drivers/vfio/vfio_iommu_type1.c | 4
fs/coredump.c | 17 +
fs/exec.c | 38 ++--
fs/fat/Kconfig | 2
fs/fat/fatent.c | 3
fs/fat/file.c | 4
fs/hugetlbfs/inode.c | 6
fs/minix/inode.c | 48 ++++-
fs/minix/itree_common.c | 8
fs/minix/itree_v1.c | 16 -
fs/minix/itree_v2.c | 15 -
fs/minix/minix.h | 1
fs/namei.c | 10 -
fs/nilfs2/alloc.c | 38 ++--
fs/nilfs2/btree.c | 42 ++--
fs/nilfs2/cpfile.c | 10 -
fs/nilfs2/dat.c | 14 -
fs/nilfs2/direct.c | 14 -
fs/nilfs2/gcinode.c | 2
fs/nilfs2/ifile.c | 4
fs/nilfs2/inode.c | 32 +--
fs/nilfs2/ioctl.c | 37 ++--
fs/nilfs2/mdt.c | 2
fs/nilfs2/namei.c | 6
fs/nilfs2/nilfs.h | 18 +-
fs/nilfs2/page.c | 11 -
fs/nilfs2/recovery.c | 32 +--
fs/nilfs2/segbuf.c | 2
fs/nilfs2/segment.c | 38 ++--
fs/nilfs2/sufile.c | 29 +--
fs/nilfs2/super.c | 73 ++++----
fs/nilfs2/sysfs.c | 29 +--
fs/nilfs2/the_nilfs.c | 85 ++++-----
fs/open.c | 6
fs/proc/base.c | 11 +
fs/proc/task_mmu.c | 4
fs/signalfd.c | 10 -
fs/ufs/super.c | 2
include/asm-generic/uaccess.h | 4
include/clocksource/timer-ti-dm.h | 2
include/linux/async_tx.h | 2
include/linux/btree.h | 2
include/linux/compaction.h | 6
include/linux/compiler-clang.h | 2
include/linux/compiler_types.h | 44 ++---
include/linux/crash_core.h | 6
include/linux/delay.h | 2
include/linux/dma/k3-psil.h | 2
include/linux/dma/k3-udma-glue.h | 2
include/linux/dma/ti-cppi5.h | 2
include/linux/exportfs.h | 2
include/linux/frontswap.h | 2
include/linux/fs.h | 10 +
include/linux/generic-radix-tree.h | 2
include/linux/highmem.h | 2
include/linux/huge_mm.h | 7
include/linux/hugetlb.h | 53 ++++--
include/linux/irqchip/irq-omap-intc.h | 2
include/linux/jhash.h | 2
include/linux/kernel.h | 12 -
include/linux/leds-ti-lmu-common.h | 2
include/linux/memcontrol.h | 12 +
include/linux/mempolicy.h | 18 +-
include/linux/migrate.h | 42 +---
include/linux/mm.h | 20 +-
include/linux/mmzone.h | 17 +
include/linux/oom.h | 4
include/linux/pgtable.h | 12 -
include/linux/platform_data/davinci-cpufreq.h | 2
include/linux/platform_data/davinci_asp.h | 2
include/linux/platform_data/elm.h | 2
include/linux/platform_data/gpio-davinci.h | 2
include/linux/platform_data/gpmc-omap.h | 2
include/linux/platform_data/mtd-davinci-aemif.h | 2
include/linux/platform_data/omap-twl4030.h | 2
include/linux/platform_data/uio_pruss.h | 2
include/linux/platform_data/usb-omap.h | 2
include/linux/poison.h | 4
include/linux/sched/mm.h | 8
include/linux/sched/task.h | 1
include/linux/soc/ti/k3-ringacc.h | 2
include/linux/soc/ti/knav_qmss.h | 2
include/linux/soc/ti/ti-msgmgr.h | 2
include/linux/swap.h | 25 ++
include/linux/syscalls.h | 2
include/linux/uaccess.h | 20 ++
include/linux/vm_event_item.h | 3
include/linux/wkup_m3_ipc.h | 2
include/linux/xxhash.h | 2
include/linux/xz.h | 4
include/linux/zlib.h | 2
include/soc/arc/aux.h | 2
include/trace/events/migrate.h | 17 +
include/uapi/linux/auto_dev-ioctl.h | 2
include/uapi/linux/elf.h | 2
include/uapi/linux/map_to_7segment.h | 2
include/uapi/linux/types.h | 2
include/uapi/linux/usb/ch9.h | 2
ipc/sem.c | 3
ipc/shm.c | 4
kernel/Makefile | 2
kernel/crash_core.c | 50 +++++
kernel/events/callchain.c | 5
kernel/events/core.c | 5
kernel/events/uprobes.c | 8
kernel/exit.c | 18 +-
kernel/futex.c | 2
kernel/kcov.c | 6
kernel/kmod.c | 5
kernel/kthread.c | 5
kernel/panic.c | 4
kernel/stacktrace.c | 5
kernel/sysctl.c | 11 +
kernel/umh.c | 29 ---
lib/Kconfig.debug | 27 ++-
lib/Makefile | 1
lib/bitmap.c | 4
lib/crc64.c | 2
lib/decompress_bunzip2.c | 2
lib/decompress_unlzma.c | 6
lib/kstrtox.c | 20 --
lib/lz4/lz4_compress.c | 4
lib/lz4/lz4_decompress.c | 18 +-
lib/lz4/lz4defs.h | 10 +
lib/lz4/lz4hc_compress.c | 2
lib/math/rational.c | 2
lib/rbtree.c | 2
lib/test_bitmap.c | 58 ++++++
lib/test_bitops.c | 18 +-
lib/test_bits.c | 75 ++++++++
lib/test_kmod.c | 2
lib/test_lockup.c | 6
lib/ts_bm.c | 2
lib/xxhash.c | 2
lib/xz/xz_crc32.c | 2
lib/xz/xz_dec_bcj.c | 2
lib/xz/xz_dec_lzma2.c | 2
lib/xz/xz_lzma2.h | 2
lib/xz/xz_stream.h | 2
mm/cma.c | 40 +---
mm/cma.h | 4
mm/compaction.c | 207 +++++++++++++++++++++--
mm/filemap.c | 2
mm/gup.c | 195 ++++++----------------
mm/hmm.c | 5
mm/huge_memory.c | 23 --
mm/hugetlb.c | 93 ++++------
mm/internal.h | 9 -
mm/khugepaged.c | 2
mm/ksm.c | 3
mm/maccess.c | 22 +-
mm/memcontrol.c | 42 +++-
mm/memory-failure.c | 7
mm/memory.c | 107 +++++++++---
mm/memory_hotplug.c | 30 ++-
mm/mempolicy.c | 49 +----
mm/migrate.c | 151 ++++++++++++++---
mm/mmu_notifier.c | 9 -
mm/nommu.c | 4
mm/oom_kill.c | 24 +-
mm/page_alloc.c | 14 +
mm/page_isolation.c | 21 --
mm/percpu-internal.h | 55 ++++++
mm/percpu-km.c | 5
mm/percpu-stats.c | 36 ++--
mm/percpu-vm.c | 5
mm/percpu.c | 208 +++++++++++++++++++++---
mm/process_vm_access.c | 2
mm/rmap.c | 2
mm/shmem.c | 5
mm/slab_common.c | 2
mm/swap.c | 13 -
mm/swap_state.c | 80 +++++++--
mm/swapfile.c | 4
mm/usercopy.c | 2
mm/userfaultfd.c | 2
mm/vmscan.c | 36 ++--
mm/vmstat.c | 32 +++
mm/workingset.c | 23 +-
mm/zpool.c | 8
mm/zsmalloc.c | 2
scripts/checkpatch.pl | 116 +++++++++----
scripts/gdb/linux/rbtree.py | 4
security/tomoyo/domain.c | 2
tools/testing/selftests/cgroup/test_kmem.c | 70 +++++++-
tools/testing/selftests/kmod/kmod.sh | 4
tools/testing/selftests/vm/hmm-tests.c | 35 ++++
virt/kvm/async_pf.c | 2
virt/kvm/kvm_main.c | 2
268 files changed, 2481 insertions(+), 1551 deletions(-)
^ permalink raw reply [flat|nested] 232+ messages in thread
* incoming
@ 2020-08-15 0:29 Andrew Morton
0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2020-08-15 0:29 UTC (permalink / raw)
To: Linus Torvalds; +Cc: linux-mm, mm-commits
39 patches, based on b923f1247b72fc100b87792fd2129d026bb10e66.
Subsystems affected by this patch series:
mm/hotfixes
lz4
exec
mailmap
mm/thp
autofs
mm/madvise
sysctl
mm/kmemleak
mm/misc
lib
Subsystem: mm/hotfixes
Mike Rapoport <rppt@linux.ibm.com>:
asm-generic: pgalloc.h: use correct #ifdef to enable pud_alloc_one()
Baoquan He <bhe@redhat.com>:
Revert "mm/vmstat.c: do not show lowmem reserve protection information of empty zone"
Subsystem: lz4
Nick Terrell <terrelln@fb.com>:
lz4: fix kernel decompression speed
Subsystem: exec
Kees Cook <keescook@chromium.org>:
Patch series "Fix S_ISDIR execve() errno":
exec: restore EACCES of S_ISDIR execve()
selftests/exec: add file type errno tests
Subsystem: mailmap
Greg Kurz <groug@kaod.org>:
mailmap: add entry for Greg Kurz
Subsystem: mm/thp
"Matthew Wilcox (Oracle)" <willy@infradead.org>:
Patch series "THP prep patches":
mm: store compound_nr as well as compound_order
mm: move page-flags include to top of file
mm: add thp_order
mm: add thp_size
mm: replace hpage_nr_pages with thp_nr_pages
mm: add thp_head
mm: introduce offset_in_thp
Subsystem: autofs
Randy Dunlap <rdunlap@infradead.org>:
fs: autofs: delete repeated words in comments
Subsystem: mm/madvise
Minchan Kim <minchan@kernel.org>:
Patch series "introduce memory hinting API for external process", v8:
mm/madvise: pass task and mm to do_madvise
pid: move pidfd_get_pid() to pid.c
mm/madvise: introduce process_madvise() syscall: an external memory hinting API
mm/madvise: check fatal signal pending of target process
Subsystem: sysctl
Xiaoming Ni <nixiaoming@huawei.com>:
all arch: remove system call sys_sysctl
Subsystem: mm/kmemleak
Qian Cai <cai@lca.pw>:
mm/kmemleak: silence KCSAN splats in checksum
Subsystem: mm/misc
Qian Cai <cai@lca.pw>:
mm/frontswap: mark various intentional data races
mm/page_io: mark various intentional data races
mm/swap_state: mark various intentional data races
Kirill A. Shutemov <kirill@shutemov.name>:
mm/filemap.c: fix a data race in filemap_fault()
Qian Cai <cai@lca.pw>:
mm/swapfile: fix and annotate various data races
mm/page_counter: fix various data races at memsw
mm/memcontrol: fix a data race in scan count
mm/list_lru: fix a data race in list_lru_count_one
mm/mempool: fix a data race in mempool_free()
mm/rmap: annotate a data race at tlb_flush_batched
mm/swap.c: annotate data races for lru_rotate_pvecs
mm: annotate a data race in page_zonenum()
Romain Naour <romain.naour@gmail.com>:
include/asm-generic/vmlinux.lds.h: align ro_after_init
Kuninori Morimoto <kuninori.morimoto.gx@renesas.com>:
sh: clkfwk: remove r8/r16/r32
sh: use generic strncpy()
Subsystem: lib
Krzysztof Kozlowski <krzk@kernel.org>:
Patch series "iomap: Constify ioreadX() iomem argument", v3:
iomap: constify ioreadX() iomem argument (as in generic implementation)
rtl818x: constify ioreadX() iomem argument (as in generic implementation)
ntb: intel: constify ioreadX() iomem argument (as in generic implementation)
virtio: pci: constify ioreadX() iomem argument (as in generic implementation)
.mailmap | 1
arch/alpha/include/asm/core_apecs.h | 6
arch/alpha/include/asm/core_cia.h | 6
arch/alpha/include/asm/core_lca.h | 6
arch/alpha/include/asm/core_marvel.h | 4
arch/alpha/include/asm/core_mcpcia.h | 6
arch/alpha/include/asm/core_t2.h | 2
arch/alpha/include/asm/io.h | 12 -
arch/alpha/include/asm/io_trivial.h | 16 -
arch/alpha/include/asm/jensen.h | 2
arch/alpha/include/asm/machvec.h | 6
arch/alpha/kernel/core_marvel.c | 2
arch/alpha/kernel/io.c | 12 -
arch/alpha/kernel/syscalls/syscall.tbl | 3
arch/arm/configs/am200epdkit_defconfig | 1
arch/arm/tools/syscall.tbl | 3
arch/arm64/include/asm/unistd.h | 2
arch/arm64/include/asm/unistd32.h | 6
arch/ia64/kernel/syscalls/syscall.tbl | 3
arch/m68k/kernel/syscalls/syscall.tbl | 3
arch/microblaze/kernel/syscalls/syscall.tbl | 3
arch/mips/configs/cu1000-neo_defconfig | 1
arch/mips/kernel/syscalls/syscall_n32.tbl | 3
arch/mips/kernel/syscalls/syscall_n64.tbl | 3
arch/mips/kernel/syscalls/syscall_o32.tbl | 3
arch/parisc/include/asm/io.h | 4
arch/parisc/kernel/syscalls/syscall.tbl | 3
arch/parisc/lib/iomap.c | 72 +++---
arch/powerpc/kernel/iomap.c | 28 +-
arch/powerpc/kernel/syscalls/syscall.tbl | 3
arch/s390/kernel/syscalls/syscall.tbl | 3
arch/sh/configs/dreamcast_defconfig | 1
arch/sh/configs/espt_defconfig | 1
arch/sh/configs/hp6xx_defconfig | 1
arch/sh/configs/landisk_defconfig | 1
arch/sh/configs/lboxre2_defconfig | 1
arch/sh/configs/microdev_defconfig | 1
arch/sh/configs/migor_defconfig | 1
arch/sh/configs/r7780mp_defconfig | 1
arch/sh/configs/r7785rp_defconfig | 1
arch/sh/configs/rts7751r2d1_defconfig | 1
arch/sh/configs/rts7751r2dplus_defconfig | 1
arch/sh/configs/se7206_defconfig | 1
arch/sh/configs/se7343_defconfig | 1
arch/sh/configs/se7619_defconfig | 1
arch/sh/configs/se7705_defconfig | 1
arch/sh/configs/se7750_defconfig | 1
arch/sh/configs/se7751_defconfig | 1
arch/sh/configs/secureedge5410_defconfig | 1
arch/sh/configs/sh03_defconfig | 1
arch/sh/configs/sh7710voipgw_defconfig | 1
arch/sh/configs/sh7757lcr_defconfig | 1
arch/sh/configs/sh7763rdp_defconfig | 1
arch/sh/configs/shmin_defconfig | 1
arch/sh/configs/titan_defconfig | 1
arch/sh/include/asm/string_32.h | 26 --
arch/sh/kernel/iomap.c | 22 -
arch/sh/kernel/syscalls/syscall.tbl | 3
arch/sparc/kernel/syscalls/syscall.tbl | 3
arch/x86/entry/syscalls/syscall_32.tbl | 3
arch/x86/entry/syscalls/syscall_64.tbl | 4
arch/xtensa/kernel/syscalls/syscall.tbl | 3
drivers/mailbox/bcm-pdc-mailbox.c | 2
drivers/net/wireless/realtek/rtl818x/rtl8180/rtl8180.h | 6
drivers/ntb/hw/intel/ntb_hw_gen1.c | 2
drivers/ntb/hw/intel/ntb_hw_gen3.h | 2
drivers/ntb/hw/intel/ntb_hw_intel.h | 2
drivers/nvdimm/btt.c | 4
drivers/nvdimm/pmem.c | 6
drivers/sh/clk/cpg.c | 25 --
drivers/virtio/virtio_pci_modern.c | 6
fs/autofs/dev-ioctl.c | 4
fs/io_uring.c | 2
fs/namei.c | 4
include/asm-generic/iomap.h | 28 +-
include/asm-generic/pgalloc.h | 2
include/asm-generic/vmlinux.lds.h | 1
include/linux/compat.h | 5
include/linux/huge_mm.h | 58 ++++-
include/linux/io-64-nonatomic-hi-lo.h | 4
include/linux/io-64-nonatomic-lo-hi.h | 4
include/linux/memcontrol.h | 2
include/linux/mm.h | 16 -
include/linux/mm_inline.h | 6
include/linux/mm_types.h | 1
include/linux/pagemap.h | 6
include/linux/pid.h | 1
include/linux/syscalls.h | 4
include/linux/sysctl.h | 6
include/uapi/asm-generic/unistd.h | 4
kernel/Makefile | 2
kernel/exit.c | 17 -
kernel/pid.c | 17 +
kernel/sys_ni.c | 3
kernel/sysctl_binary.c | 171 --------------
lib/iomap.c | 30 +-
lib/lz4/lz4_compress.c | 4
lib/lz4/lz4_decompress.c | 18 -
lib/lz4/lz4defs.h | 10
lib/lz4/lz4hc_compress.c | 2
mm/compaction.c | 2
mm/filemap.c | 22 +
mm/frontswap.c | 8
mm/gup.c | 2
mm/internal.h | 4
mm/kmemleak.c | 2
mm/list_lru.c | 2
mm/madvise.c | 190 ++++++++++++++--
mm/memcontrol.c | 10
mm/memory.c | 4
mm/memory_hotplug.c | 7
mm/mempolicy.c | 2
mm/mempool.c | 2
mm/migrate.c | 18 -
mm/mlock.c | 9
mm/page_alloc.c | 5
mm/page_counter.c | 13 -
mm/page_io.c | 12 -
mm/page_vma_mapped.c | 6
mm/rmap.c | 10
mm/swap.c | 21 -
mm/swap_state.c | 10
mm/swapfile.c | 33 +-
mm/vmscan.c | 6
mm/vmstat.c | 12 -
mm/workingset.c | 6
tools/perf/arch/powerpc/entry/syscalls/syscall.tbl | 2
tools/perf/arch/s390/entry/syscalls/syscall.tbl | 2
tools/perf/arch/x86/entry/syscalls/syscall_64.tbl | 2
tools/testing/selftests/exec/.gitignore | 1
tools/testing/selftests/exec/Makefile | 5
tools/testing/selftests/exec/non-regular.c | 196 +++++++++++++++++
132 files changed, 815 insertions(+), 614 deletions(-)
^ permalink raw reply [flat|nested] 232+ messages in thread
* incoming
@ 2020-08-21 0:41 Andrew Morton
0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2020-08-21 0:41 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm
11 patches, based on 7eac66d0456fe12a462e5c14c68e97c7460989da.
Subsystems affected by this patch series:
misc
mm/hugetlb
mm/vmalloc
mm/misc
romfs
relay
uprobes
squashfs
mm/cma
mm/pagealloc
Subsystem: misc
Nick Desaulniers <ndesaulniers@google.com>:
mailmap: add Andi Kleen
Subsystem: mm/hugetlb
Xu Wang <vulab@iscas.ac.cn>:
hugetlb_cgroup: convert comma to semicolon
Hugh Dickins <hughd@google.com>:
khugepaged: adjust VM_BUG_ON_MM() in __khugepaged_enter()
Subsystem: mm/vmalloc
"Aneesh Kumar K.V" <aneesh.kumar@linux.ibm.com>:
mm/vunmap: add cond_resched() in vunmap_pmd_range
Subsystem: mm/misc
Leon Romanovsky <leonro@nvidia.com>:
mm/rodata_test.c: fix missing function declaration
Subsystem: romfs
Jann Horn <jannh@google.com>:
romfs: fix uninitialized memory leak in romfs_dev_read()
Subsystem: relay
Wei Yongjun <weiyongjun1@huawei.com>:
kernel/relay.c: fix memleak on destroy relay channel
Subsystem: uprobes
Hugh Dickins <hughd@google.com>:
uprobes: __replace_page() avoid BUG in munlock_vma_page()
Subsystem: squashfs
Phillip Lougher <phillip@squashfs.org.uk>:
squashfs: avoid bio_alloc() failure with 1Mbyte blocks
Subsystem: mm/cma
Doug Berger <opendmb@gmail.com>:
mm: include CMA pages in lowmem_reserve at boot
Subsystem: mm/pagealloc
Charan Teja Reddy <charante@codeaurora.org>:
mm, page_alloc: fix core hung in free_pcppages_bulk()
.mailmap | 1 +
fs/romfs/storage.c | 4 +---
fs/squashfs/block.c | 6 +++++-
kernel/events/uprobes.c | 2 +-
kernel/relay.c | 1 +
mm/hugetlb_cgroup.c | 4 ++--
mm/khugepaged.c | 2 +-
mm/page_alloc.c | 7 ++++++-
mm/rodata_test.c | 1 +
mm/vmalloc.c | 2 ++
10 files changed, 21 insertions(+), 9 deletions(-)
^ permalink raw reply [flat|nested] 232+ messages in thread
* incoming
@ 2020-09-04 23:34 Andrew Morton
0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2020-09-04 23:34 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm
19 patches, based on 59126901f200f5fc907153468b03c64e0081b6e6.
Subsystems affected by this patch series:
mm/memcg
mm/slub
MAINTAINERS
mm/pagemap
ipc
fork
checkpatch
mm/madvise
mm/migration
mm/hugetlb
lib
Subsystem: mm/memcg
Michal Hocko <mhocko@suse.com>:
memcg: fix use-after-free in uncharge_batch
Xunlei Pang <xlpang@linux.alibaba.com>:
mm: memcg: fix memcg reclaim soft lockup
Subsystem: mm/slub
Eugeniu Rosca <erosca@de.adit-jv.com>:
mm: slub: fix conversion of freelist_corrupted()
Subsystem: MAINTAINERS
Robert Richter <rric@kernel.org>:
MAINTAINERS: update Cavium/Marvell entries
Nick Desaulniers <ndesaulniers@google.com>:
MAINTAINERS: add LLVM maintainers
Randy Dunlap <rdunlap@infradead.org>:
MAINTAINERS: IA64: mark Status as Odd Fixes only
Subsystem: mm/pagemap
Joerg Roedel <jroedel@suse.de>:
mm: track page table modifications in __apply_to_page_range()
Subsystem: ipc
Tobias Klauser <tklauser@distanz.ch>:
ipc: adjust proc_ipc_sem_dointvec definition to match prototype
Subsystem: fork
Tobias Klauser <tklauser@distanz.ch>:
fork: adjust sysctl_max_threads definition to match prototype
Subsystem: checkpatch
Mrinal Pandey <mrinalmni@gmail.com>:
checkpatch: fix the usage of capture group ( ... )
Subsystem: mm/madvise
Yang Shi <shy828301@gmail.com>:
mm: madvise: fix vma user-after-free
Subsystem: mm/migration
Alistair Popple <alistair@popple.id.au>:
mm/migrate: fixup setting UFFD_WP flag
mm/rmap: fixup copying of soft dirty and uffd ptes
Ralph Campbell <rcampbell@nvidia.com>:
Patch series "mm/migrate: preserve soft dirty in remove_migration_pte()":
mm/migrate: remove unnecessary is_zone_device_page() check
mm/migrate: preserve soft dirty in remove_migration_pte()
Subsystem: mm/hugetlb
Li Xinhai <lixinhai.lxh@gmail.com>:
mm/hugetlb: try preferred node first when alloc gigantic page from cma
Muchun Song <songmuchun@bytedance.com>:
mm/hugetlb: fix a race between hugetlb sysctl handlers
David Howells <dhowells@redhat.com>:
mm/khugepaged.c: fix khugepaged's request size in collapse_file
Subsystem: lib
Jason Gunthorpe <jgg@nvidia.com>:
include/linux/log2.h: add missing () around n in roundup_pow_of_two()
MAINTAINERS | 32 ++++++++++++++++----------------
include/linux/log2.h | 2 +-
ipc/ipc_sysctl.c | 2 +-
kernel/fork.c | 2 +-
mm/hugetlb.c | 49 +++++++++++++++++++++++++++++++++++++------------
mm/khugepaged.c | 2 +-
mm/madvise.c | 2 +-
mm/memcontrol.c | 6 ++++++
mm/memory.c | 37 ++++++++++++++++++++++++-------------
mm/migrate.c | 31 +++++++++++++++++++------------
mm/rmap.c | 9 +++++++--
mm/slub.c | 12 ++++++------
mm/vmscan.c | 8 ++++++++
scripts/checkpatch.pl | 4 ++--
14 files changed, 130 insertions(+), 68 deletions(-)
^ permalink raw reply [flat|nested] 232+ messages in thread
* incoming
@ 2020-09-19 4:19 Andrew Morton
0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2020-09-19 4:19 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm
15 patches, based on 92ab97adeefccf375de7ebaad9d5b75d4125fe8b.
Subsystems affected by this patch series:
mailmap
mm/hotfixes
mm/thp
mm/memory-hotplug
misc
kcsan
Subsystem: mailmap
Kees Cook <keescook@chromium.org>:
mailmap: add older email addresses for Kees Cook
Subsystem: mm/hotfixes
Hugh Dickins <hughd@google.com>:
Patch series "mm: fixes to past from future testing":
ksm: reinstate memcg charge on copied pages
mm: migration of hugetlbfs page skip memcg
shmem: shmem_writepage() split unlikely i915 THP
mm: fix check_move_unevictable_pages() on THP
mlock: fix unevictable_pgs event counts on THP
Byron Stanoszek <gandalf@winds.org>:
tmpfs: restore functionality of nr_inodes=0
Muchun Song <songmuchun@bytedance.com>:
kprobes: fix kill kprobe which has been marked as gone
Subsystem: mm/thp
Ralph Campbell <rcampbell@nvidia.com>:
mm/thp: fix __split_huge_pmd_locked() for migration PMD
Christophe Leroy <christophe.leroy@csgroup.eu>:
selftests/vm: fix display of page size in map_hugetlb
Subsystem: mm/memory-hotplug
Pavel Tatashin <pasha.tatashin@soleen.com>:
mm/memory_hotplug: drain per-cpu pages again during memory offline
Subsystem: misc
Tobias Klauser <tklauser@distanz.ch>:
ftrace: let ftrace_enable_sysctl take a kernel pointer buffer
stackleak: let stack_erasing_sysctl take a kernel pointer buffer
fs/fs-writeback.c: adjust dirtytime_interval_handler definition to match prototype
Subsystem: kcsan
Changbin Du <changbin.du@gmail.com>:
kcsan: kconfig: move to menu 'Generic Kernel Debugging Instruments'
.mailmap | 4 ++
fs/fs-writeback.c | 2 -
include/linux/ftrace.h | 3 --
include/linux/stackleak.h | 2 -
kernel/kprobes.c | 9 +++++-
kernel/stackleak.c | 2 -
kernel/trace/ftrace.c | 3 --
lib/Kconfig.debug | 4 --
mm/huge_memory.c | 42 ++++++++++++++++---------------
mm/ksm.c | 4 ++
mm/memory_hotplug.c | 14 ++++++++++
mm/migrate.c | 3 +-
mm/mlock.c | 24 +++++++++++------
mm/page_isolation.c | 8 +++++
mm/shmem.c | 20 +++++++++++---
mm/swap.c | 6 ++--
mm/vmscan.c | 10 +++++--
tools/testing/selftests/vm/map_hugetlb.c | 2 -
18 files changed, 111 insertions(+), 51 deletions(-)
^ permalink raw reply [flat|nested] 232+ messages in thread
* incoming
@ 2020-09-26 4:17 Andrew Morton
0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2020-09-26 4:17 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm
9 patches, based on 7c7ec3226f5f33f9c050d85ec20f18419c622ad6.
Subsystems affected by this patch series:
mm/thp
mm/memcg
mm/gup
mm/migration
lib
x86
mm/memory-hotplug
Subsystem: mm/thp
Gao Xiang <hsiangkao@redhat.com>:
mm, THP, swap: fix allocating cluster for swapfile by mistake
Subsystem: mm/memcg
Muchun Song <songmuchun@bytedance.com>:
mm: memcontrol: fix missing suffix of workingset_restore
Subsystem: mm/gup
Vasily Gorbik <gor@linux.ibm.com>:
mm/gup: fix gup_fast with dynamic page table folding
Subsystem: mm/migration
Zi Yan <ziy@nvidia.com>:
mm/migrate: correct thp migration stats
Subsystem: lib
Nick Desaulniers <ndesaulniers@google.com>:
lib/string.c: implement stpcpy
Jason Yan <yanaijie@huawei.com>:
lib/memregion.c: include memregion.h
Subsystem: x86
Mikulas Patocka <mpatocka@redhat.com>:
arch/x86/lib/usercopy_64.c: fix __copy_user_flushcache() cache writeback
Subsystem: mm/memory-hotplug
Laurent Dufour <ldufour@linux.ibm.com>:
Patch series "mm: fix memory to node bad links in sysfs", v3:
mm: replace memmap_context by meminit_context
mm: don't rely on system state to detect hot-plug operations
Documentation/admin-guide/cgroup-v2.rst | 25 ++++++---
arch/ia64/mm/init.c | 6 +-
arch/s390/include/asm/pgtable.h | 42 +++++++++++----
arch/x86/lib/usercopy_64.c | 2
drivers/base/node.c | 85 ++++++++++++++++++++------------
include/linux/mm.h | 2
include/linux/mmzone.h | 11 +++-
include/linux/node.h | 11 ++--
include/linux/pgtable.h | 10 +++
lib/memregion.c | 1
lib/string.c | 24 +++++++++
mm/gup.c | 18 +++---
mm/memcontrol.c | 4 -
mm/memory_hotplug.c | 5 +
mm/migrate.c | 7 +-
mm/page_alloc.c | 10 +--
mm/swapfile.c | 2
17 files changed, 181 insertions(+), 84 deletions(-)
^ permalink raw reply [flat|nested] 232+ messages in thread
* incoming
@ 2020-10-03 5:20 Andrew Morton
0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2020-10-03 5:20 UTC (permalink / raw)
To: Linus Torvalds; +Cc: linux-mm, mm-commits
3 patches, based on d3d45f8220d60a0b2aaaacf8fb2be4e6ffd9008e.
Subsystems affected by this patch series:
mm/slub
mm/cma
scripts
Subsystem: mm/slub
Eric Farman <farman@linux.ibm.com>:
mm, slub: restore initial kmem_cache flags
Subsystem: mm/cma
Joonsoo Kim <iamjoonsoo.kim@lge.com>:
mm/page_alloc: handle a missing case for memalloc_nocma_{save/restore} APIs
Subsystem: scripts
Eric Biggers <ebiggers@google.com>:
scripts/spelling.txt: fix malformed entry
mm/page_alloc.c | 19 ++++++++++++++++---
mm/slub.c | 6 +-----
scripts/spelling.txt | 2 +-
3 files changed, 18 insertions(+), 9 deletions(-)
^ permalink raw reply [flat|nested] 232+ messages in thread
* incoming
@ 2020-10-11 6:15 Andrew Morton
0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2020-10-11 6:15 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm
5 patches, based on da690031a5d6d50a361e3f19f3eeabd086a6f20d.
Subsystems affected by this patch series:
MAINTAINERS
mm/pagemap
mm/swap
mm/hugetlb
Subsystem: MAINTAINERS
Kees Cook <keescook@chromium.org>:
MAINTAINERS: change hardening mailing list
Antoine Tenart <atenart@kernel.org>:
MAINTAINERS: Antoine Tenart's email address
Subsystem: mm/pagemap
Miaohe Lin <linmiaohe@huawei.com>:
mm: mmap: Fix general protection fault in unlink_file_vma()
Subsystem: mm/swap
Minchan Kim <minchan@kernel.org>:
mm: validate inode in mapping_set_error()
Subsystem: mm/hugetlb
Vijay Balakrishna <vijayb@linux.microsoft.com>:
mm: khugepaged: recalculate min_free_kbytes after memory hotplug as expected by khugepaged
.mailmap | 4 +++-
MAINTAINERS | 8 ++++----
include/linux/khugepaged.h | 5 +++++
include/linux/pagemap.h | 3 ++-
mm/khugepaged.c | 13 +++++++++++--
mm/mmap.c | 6 +++++-
mm/page_alloc.c | 3 +++
7 files changed, 33 insertions(+), 9 deletions(-)
^ permalink raw reply [flat|nested] 232+ messages in thread
* incoming
@ 2020-10-13 23:46 Andrew Morton
0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2020-10-13 23:46 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm
181 patches, based on 029f56db6ac248769f2c260bfaf3c3c0e23e904c.
Subsystems affected by this patch series:
kbuild
scripts
ntfs
ocfs2
vfs
mm/slab
mm/slub
mm/kmemleak
mm/dax
mm/debug
mm/pagecache
mm/fadvise
mm/gup
mm/swap
mm/memremap
mm/memcg
mm/selftests
mm/pagemap
mm/mincore
mm/hmm
mm/dma
mm/memory-failure
mm/vmalloc
mm/documentation
mm/kasan
mm/pagealloc
mm/hugetlb
mm/vmscan
mm/z3fold
mm/zbud
mm/compaction
mm/mempolicy
mm/mempool
mm/memblock
mm/oom-kill
mm/migration
Subsystem: kbuild
Nick Desaulniers <ndesaulniers@google.com>:
Patch series "set clang minimum version to 10.0.1", v3:
compiler-clang: add build check for clang 10.0.1
Revert "kbuild: disable clang's default use of -fmerge-all-constants"
Revert "arm64: bti: Require clang >= 10.0.1 for in-kernel BTI support"
Revert "arm64: vdso: Fix compilation with clang older than 8"
Partially revert "ARM: 8905/1: Emit __gnu_mcount_nc when using Clang 10.0.0 or newer"
Marco Elver <elver@google.com>:
kasan: remove mentions of unsupported Clang versions
Nick Desaulniers <ndesaulniers@google.com>:
compiler-gcc: improve version error
compiler.h: avoid escaped section names
export.h: fix section name for CONFIG_TRIM_UNUSED_KSYMS for Clang
Lukas Bulwahn <lukas.bulwahn@gmail.com>:
kbuild: doc: describe proper script invocation
Subsystem: scripts
Wang Qing <wangqing@vivo.com>:
scripts/spelling.txt: increase error-prone spell checking
Naoki Hayama <naoki.hayama@lineo.co.jp>:
scripts/spelling.txt: add "arbitrary" typo
Borislav Petkov <bp@suse.de>:
scripts/decodecode: add the capability to supply the program counter
Subsystem: ntfs
Rustam Kovhaev <rkovhaev@gmail.com>:
ntfs: add check for mft record size in superblock
Subsystem: ocfs2
Randy Dunlap <rdunlap@infradead.org>:
ocfs2: delete repeated words in comments
Gang He <ghe@suse.com>:
ocfs2: fix potential soft lockup during fstrim
Subsystem: vfs
Randy Dunlap <rdunlap@infradead.org>:
fs/xattr.c: fix kernel-doc warnings for setxattr & removexattr
Luo Jiaxing <luojiaxing@huawei.com>:
fs_parse: mark fs_param_bad_value() as static
Subsystem: mm/slab
Mateusz Nosek <mateusznosek0@gmail.com>:
mm/slab.c: clean code by removing redundant if condition
tangjianqiang <wyqt1985@gmail.com>:
include/linux/slab.h: fix a typo error in comment
Subsystem: mm/slub
Abel Wu <wuyun.wu@huawei.com>:
mm/slub.c: branch optimization in free slowpath
mm/slub: fix missing ALLOC_SLOWPATH stat when bulk alloc
mm/slub: make add_full() condition more explicit
Subsystem: mm/kmemleak
Davidlohr Bueso <dave@stgolabs.net>:
mm/kmemleak: rely on rcu for task stack scanning
Hui Su <sh_def@163.com>:
mm,kmemleak-test.c: move kmemleak-test.c to samples dir
Subsystem: mm/dax
Dan Williams <dan.j.williams@intel.com>:
Patch series "device-dax: Support sub-dividing soft-reserved ranges", v5:
x86/numa: cleanup configuration dependent command-line options
x86/numa: add 'nohmat' option
efi/fake_mem: arrange for a resource entry per efi_fake_mem instance
ACPI: HMAT: refactor hmat_register_target_device to hmem_register_device
resource: report parent to walk_iomem_res_desc() callback
mm/memory_hotplug: introduce default phys_to_target_node() implementation
ACPI: HMAT: attach a device for each soft-reserved range
device-dax: drop the dax_region.pfn_flags attribute
device-dax: move instance creation parameters to 'struct dev_dax_data'
device-dax: make pgmap optional for instance creation
device-dax/kmem: introduce dax_kmem_range()
device-dax/kmem: move resource name tracking to drvdata
device-dax/kmem: replace release_resource() with release_mem_region()
device-dax: add an allocation interface for device-dax instances
device-dax: introduce 'struct dev_dax' typed-driver operations
device-dax: introduce 'seed' devices
drivers/base: make device_find_child_by_name() compatible with sysfs inputs
device-dax: add resize support
mm/memremap_pages: convert to 'struct range'
mm/memremap_pages: support multiple ranges per invocation
device-dax: add dis-contiguous resource support
device-dax: introduce 'mapping' devices
Joao Martins <joao.m.martins@oracle.com>:
device-dax: make align a per-device property
Dan Williams <dan.j.williams@intel.com>:
device-dax: add an 'align' attribute
Joao Martins <joao.m.martins@oracle.com>:
dax/hmem: introduce dax_hmem.region_idle parameter
device-dax: add a range mapping allocation attribute
Subsystem: mm/debug
"Matthew Wilcox (Oracle)" <willy@infradead.org>:
mm/debug.c: do not dereference i_ino blindly
John Hubbard <jhubbard@nvidia.com>:
mm, dump_page: rename head_mapcount() --> head_compound_mapcount()
Subsystem: mm/pagecache
"Matthew Wilcox (Oracle)" <willy@infradead.org>:
Patch series "Return head pages from find_*_entry", v2:
mm: factor find_get_incore_page out of mincore_page
mm: use find_get_incore_page in memcontrol
mm: optimise madvise WILLNEED
proc: optimise smaps for shmem entries
i915: use find_lock_page instead of find_lock_entry
mm: convert find_get_entry to return the head page
mm/shmem: return head page from find_lock_entry
mm: add find_lock_head
mm/filemap: fix filemap_map_pages for THP
Subsystem: mm/fadvise
Yafang Shao <laoar.shao@gmail.com>:
mm, fadvise: improve the expensive remote LRU cache draining after FADV_DONTNEED
Subsystem: mm/gup
Barry Song <song.bao.hua@hisilicon.com>:
mm/gup_benchmark: update the documentation in Kconfig
mm/gup_benchmark: use pin_user_pages for FOLL_LONGTERM flag
mm/gup: don't permit users to call get_user_pages with FOLL_LONGTERM
John Hubbard <jhubbard@nvidia.com>:
mm/gup: protect unpin_user_pages() against npages==-ERRNO
Subsystem: mm/swap
Gao Xiang <hsiangkao@redhat.com>:
swap: rename SWP_FS to SWAP_FS_OPS to avoid ambiguity
Yu Zhao <yuzhao@google.com>:
mm: remove activate_page() from unuse_pte()
mm: remove superfluous __ClearPageActive()
Miaohe Lin <linmiaohe@huawei.com>:
mm/swap.c: fix confusing comment in release_pages()
mm/swap_slots.c: remove always zero and unused return value of enable_swap_slots_cache()
mm/page_io.c: remove useless out label in __swap_writepage()
mm/swap.c: fix incomplete comment in lru_cache_add_inactive_or_unevictable()
mm/swapfile.c: remove unnecessary goto out in _swap_info_get()
mm/swapfile.c: fix potential memory leak in sys_swapon
Subsystem: mm/memremap
Ira Weiny <ira.weiny@intel.com>:
mm/memremap.c: convert devmap static branch to {inc,dec}
Subsystem: mm/memcg
"Gustavo A. R. Silva" <gustavoars@kernel.org>:
mm: memcontrol: use flex_array_size() helper in memcpy()
mm: memcontrol: use the preferred form for passing the size of a structure type
Roman Gushchin <guro@fb.com>:
mm: memcg/slab: fix racy access to page->mem_cgroup in mem_cgroup_from_obj()
Miaohe Lin <linmiaohe@huawei.com>:
mm: memcontrol: correct the comment of mem_cgroup_iter()
Waiman Long <longman@redhat.com>:
Patch series "mm/memcg: Miscellaneous cleanups and streamlining", v2:
mm/memcg: clean up obsolete enum charge_type
mm/memcg: simplify mem_cgroup_get_max()
mm/memcg: unify swap and memsw page counters
Muchun Song <songmuchun@bytedance.com>:
mm: memcontrol: add the missing numa_stat interface for cgroup v2
Miaohe Lin <linmiaohe@huawei.com>:
mm/page_counter: correct the obsolete func name in the comment of page_counter_try_charge()
mm: memcontrol: reword obsolete comment of mem_cgroup_unmark_under_oom()
Bharata B Rao <bharata@linux.ibm.com>:
mm: memcg/slab: uncharge during kmem_cache_free_bulk()
Ralph Campbell <rcampbell@nvidia.com>:
mm/memcg: fix device private memcg accounting
Subsystem: mm/selftests
John Hubbard <jhubbard@nvidia.com>:
Patch series "selftests/vm: fix some minor aggravating factors in the Makefile":
selftests/vm: fix false build success on the second and later attempts
selftests/vm: fix incorrect gcc invocation in some cases
Subsystem: mm/pagemap
Matthew Wilcox <willy@infradead.org>:
mm: account PMD tables like PTE tables
Yanfei Xu <yanfei.xu@windriver.com>:
mm/memory.c: fix typo in __do_fault() comment
mm/memory.c: replace vmf->vma with variable vma
Wei Yang <richard.weiyang@linux.alibaba.com>:
mm/mmap: rename __vma_unlink_common() to __vma_unlink()
mm/mmap: leverage vma_rb_erase_ignore() to implement vma_rb_erase()
Chinwen Chang <chinwen.chang@mediatek.com>:
Patch series "Try to release mmap_lock temporarily in smaps_rollup", v4:
mmap locking API: add mmap_lock_is_contended()
mm: smaps*: extend smap_gather_stats to support specified beginning
mm: proc: smaps_rollup: do not stall write attempts on mmap_lock
"Matthew Wilcox (Oracle)" <willy@infradead.org>:
Patch series "Fix PageDoubleMap":
mm: move PageDoubleMap bit
mm: simplify PageDoubleMap with PF_SECOND policy
Wei Yang <richard.weiyang@linux.alibaba.com>:
mm/mmap: leave adjust_next as virtual address instead of page frame number
Randy Dunlap <rdunlap@infradead.org>:
mm/memory.c: fix spello of "function"
Wei Yang <richard.weiyang@linux.alibaba.com>:
mm/mmap: not necessary to check mapping separately
mm/mmap: check on file instead of the rb_root_cached of its address_space
Miaohe Lin <linmiaohe@huawei.com>:
mm: use helper function mapping_allow_writable()
mm/mmap.c: use helper function allow_write_access() in __remove_shared_vm_struct()
Liao Pingfang <liao.pingfang@zte.com.cn>:
mm/mmap.c: replace do_brk with do_brk_flags in comment of insert_vm_struct()
Peter Xu <peterx@redhat.com>:
mm: remove src/dst mm parameter in copy_page_range()
Subsystem: mm/mincore
yuleixzhang <yulei.kernel@gmail.com>:
include/linux/huge_mm.h: remove mincore_huge_pmd declaration
Subsystem: mm/hmm
Ralph Campbell <rcampbell@nvidia.com>:
tools/testing/selftests/vm/hmm-tests.c: use the new SKIP() macro
lib/test_hmm.c: remove unused dmirror_zero_page
Subsystem: mm/dma
Andy Shevchenko <andriy.shevchenko@linux.intel.com>:
mm/dmapool.c: replace open-coded list_for_each_entry_safe()
mm/dmapool.c: replace hard coded function name with __func__
Subsystem: mm/memory-failure
Xianting Tian <tian.xianting@h3c.com>:
mm/memory-failure: do pgoff calculation before for_each_process()
Alex Shi <alex.shi@linux.alibaba.com>:
mm/memory-failure.c: remove unused macro `writeback'
Subsystem: mm/vmalloc
Hui Su <sh_def@163.com>:
mm/vmalloc.c: update the comment in __vmalloc_area_node()
mm/vmalloc.c: fix the comment of find_vm_area
Subsystem: mm/documentation
Alexander Gordeev <agordeev@linux.ibm.com>:
docs/vm: fix 'mm_count' vs 'mm_users' counter confusion
Subsystem: mm/kasan
Patricia Alfonso <trishalfonso@google.com>:
Patch series "KASAN-KUnit Integration", v14:
kasan/kunit: add KUnit Struct to Current Task
KUnit: KASAN Integration
KASAN: port KASAN Tests to KUnit
KASAN: Testing Documentation
David Gow <davidgow@google.com>:
mm: kasan: do not panic if both panic_on_warn and kasan_multishot set
Subsystem: mm/pagealloc
David Hildenbrand <david@redhat.com>:
Patch series "mm / virtio-mem: support ZONE_MOVABLE", v5:
mm/page_alloc: tweak comments in has_unmovable_pages()
mm/page_isolation: exit early when pageblock is isolated in set_migratetype_isolate()
mm/page_isolation: drop WARN_ON_ONCE() in set_migratetype_isolate()
mm/page_isolation: cleanup set_migratetype_isolate()
virtio-mem: don't special-case ZONE_MOVABLE
mm: document semantics of ZONE_MOVABLE
Li Xinhai <lixinhai.lxh@gmail.com>:
mm, isolation: avoid checking unmovable pages across pageblock boundary
Mateusz Nosek <mateusznosek0@gmail.com>:
mm/page_alloc.c: clean code by removing unnecessary initialization
mm/page_alloc.c: micro-optimization remove unnecessary branch
mm/page_alloc.c: fix early params garbage value accesses
mm/page_alloc.c: clean code by merging two functions
Yanfei Xu <yanfei.xu@windriver.com>:
mm/page_alloc.c: __perform_reclaim should return 'unsigned long'
Mateusz Nosek <mateusznosek0@gmail.com>:
mmzone: clean code by removing unused macro parameter
Ralph Campbell <rcampbell@nvidia.com>:
mm: move call to compound_head() in release_pages()
"Matthew Wilcox (Oracle)" <willy@infradead.org>:
mm/page_alloc.c: fix freeing non-compound pages
Michal Hocko <mhocko@suse.com>:
include/linux/gfp.h: clarify usage of GFP_ATOMIC in !preemptible contexts
Subsystem: mm/hugetlb
Baoquan He <bhe@redhat.com>:
Patch series "mm/hugetlb: Small cleanup and improvement", v2:
mm/hugetlb.c: make is_hugetlb_entry_hwpoisoned return bool
mm/hugetlb.c: remove the unnecessary non_swap_entry()
doc/vm: fix typo in the hugetlb admin documentation
Wei Yang <richard.weiyang@linux.alibaba.com>:
Patch series "mm/hugetlb: code refine and simplification", v4:
mm/hugetlb: not necessary to coalesce regions recursively
mm/hugetlb: remove VM_BUG_ON(!nrg) in get_file_region_entry_from_cache()
mm/hugetlb: use list_splice to merge two list at once
mm/hugetlb: count file_region to be added when regions_needed != NULL
mm/hugetlb: a page from buddy is not on any list
mm/hugetlb: narrow the hugetlb_lock protection area during preparing huge page
mm/hugetlb: take the free hpage during the iteration directly
Mike Kravetz <mike.kravetz@oracle.com>:
hugetlb: add lockdep check for i_mmap_rwsem held in huge_pmd_share
Subsystem: mm/vmscan
Chunxin Zang <zangchunxin@bytedance.com>:
mm/vmscan: fix infinite loop in drop_slab_node
Hui Su <sh_def@163.com>:
mm/vmscan: fix comments for isolate_lru_page()
Subsystem: mm/z3fold
Hui Su <sh_def@163.com>:
mm/z3fold.c: use xx_zalloc instead xx_alloc and memset
Subsystem: mm/zbud
Xiang Chen <chenxiang66@hisilicon.com>:
mm/zbud: remove redundant initialization
Subsystem: mm/compaction
Mateusz Nosek <mateusznosek0@gmail.com>:
mm/compaction.c: micro-optimization remove unnecessary branch
include/linux/compaction.h: clean code by removing unused enum value
John Hubbard <jhubbard@nvidia.com>:
selftests/vm: 8x compaction_test speedup
Subsystem: mm/mempolicy
Wei Yang <richard.weiyang@linux.alibaba.com>:
mm/mempolicy: remove or narrow the lock on current
mm: remove unused alloc_page_vma_node()
Subsystem: mm/mempool
Miaohe Lin <linmiaohe@huawei.com>:
mm/mempool: add 'else' to split mutually exclusive case
Subsystem: mm/memblock
Mike Rapoport <rppt@linux.ibm.com>:
Patch series "memblock: seasonal cleaning^w cleanup", v3:
KVM: PPC: Book3S HV: simplify kvm_cma_reserve()
dma-contiguous: simplify cma_early_percent_memory()
arm, xtensa: simplify initialization of high memory pages
arm64: numa: simplify dummy_numa_init()
h8300, nds32, openrisc: simplify detection of memory extents
riscv: drop unneeded node initialization
mircoblaze: drop unneeded NUMA and sparsemem initializations
memblock: make for_each_memblock_type() iterator private
memblock: make memblock_debug and related functionality private
memblock: reduce number of parameters in for_each_mem_range()
arch, mm: replace for_each_memblock() with for_each_mem_pfn_range()
arch, drivers: replace for_each_membock() with for_each_mem_range()
x86/setup: simplify initrd relocation and reservation
x86/setup: simplify reserve_crashkernel()
memblock: remove unused memblock_mem_size()
memblock: implement for_each_reserved_mem_region() using __next_mem_region()
memblock: use separate iterators for memory and reserved regions
Subsystem: mm/oom-kill
Suren Baghdasaryan <surenb@google.com>:
mm, oom_adj: don't loop through tasks in __set_oom_adj when not necessary
Subsystem: mm/migration
Ralph Campbell <rcampbell@nvidia.com>:
mm/migrate: remove cpages-- in migrate_vma_finalize()
mm/migrate: remove obsolete comment about device public
.clang-format | 7
Documentation/admin-guide/cgroup-v2.rst | 69 +
Documentation/admin-guide/mm/hugetlbpage.rst | 2
Documentation/dev-tools/kasan.rst | 74 +
Documentation/dev-tools/kmemleak.rst | 2
Documentation/kbuild/makefiles.rst | 20
Documentation/vm/active_mm.rst | 2
Documentation/x86/x86_64/boot-options.rst | 4
MAINTAINERS | 2
Makefile | 9
arch/arm/Kconfig | 2
arch/arm/include/asm/tlb.h | 1
arch/arm/kernel/setup.c | 18
arch/arm/mm/init.c | 59 -
arch/arm/mm/mmu.c | 39
arch/arm/mm/pmsa-v7.c | 23
arch/arm/mm/pmsa-v8.c | 17
arch/arm/xen/mm.c | 7
arch/arm64/Kconfig | 2
arch/arm64/kernel/machine_kexec_file.c | 6
arch/arm64/kernel/setup.c | 4
arch/arm64/kernel/vdso/Makefile | 7
arch/arm64/mm/init.c | 11
arch/arm64/mm/kasan_init.c | 10
arch/arm64/mm/mmu.c | 11
arch/arm64/mm/numa.c | 15
arch/c6x/kernel/setup.c | 9
arch/h8300/kernel/setup.c | 8
arch/microblaze/mm/init.c | 23
arch/mips/cavium-octeon/dma-octeon.c | 14
arch/mips/kernel/setup.c | 31
arch/mips/netlogic/xlp/setup.c | 2
arch/nds32/kernel/setup.c | 8
arch/openrisc/kernel/setup.c | 9
arch/openrisc/mm/init.c | 8
arch/powerpc/kernel/fadump.c | 61 -
arch/powerpc/kexec/file_load_64.c | 16
arch/powerpc/kvm/book3s_hv_builtin.c | 12
arch/powerpc/kvm/book3s_hv_uvmem.c | 14
arch/powerpc/mm/book3s64/hash_utils.c | 16
arch/powerpc/mm/book3s64/radix_pgtable.c | 10
arch/powerpc/mm/kasan/kasan_init_32.c | 8
arch/powerpc/mm/mem.c | 31
arch/powerpc/mm/numa.c | 7
arch/powerpc/mm/pgtable_32.c | 8
arch/riscv/mm/init.c | 36
arch/riscv/mm/kasan_init.c | 10
arch/s390/kernel/setup.c | 27
arch/s390/mm/page-states.c | 6
arch/s390/mm/vmem.c | 7
arch/sh/mm/init.c | 9
arch/sparc/mm/init_64.c | 12
arch/x86/include/asm/numa.h | 8
arch/x86/kernel/e820.c | 16
arch/x86/kernel/setup.c | 56 -
arch/x86/mm/numa.c | 13
arch/x86/mm/numa_emulation.c | 3
arch/x86/xen/enlighten_pv.c | 2
arch/xtensa/mm/init.c | 55 -
drivers/acpi/numa/hmat.c | 76 -
drivers/acpi/numa/srat.c | 9
drivers/base/core.c | 2
drivers/bus/mvebu-mbus.c | 12
drivers/dax/Kconfig | 6
drivers/dax/Makefile | 3
drivers/dax/bus.c | 1237 +++++++++++++++++++++++----
drivers/dax/bus.h | 34
drivers/dax/dax-private.h | 74 +
drivers/dax/device.c | 164 +--
drivers/dax/hmem.c | 56 -
drivers/dax/hmem/Makefile | 8
drivers/dax/hmem/device.c | 100 ++
drivers/dax/hmem/hmem.c | 93 +-
drivers/dax/kmem.c | 236 ++---
drivers/dax/pmem/compat.c | 2
drivers/dax/pmem/core.c | 36
drivers/firmware/efi/x86_fake_mem.c | 12
drivers/gpu/drm/i915/gem/i915_gem_shmem.c | 4
drivers/gpu/drm/nouveau/nouveau_dmem.c | 15
drivers/irqchip/irq-gic-v3-its.c | 2
drivers/nvdimm/badrange.c | 26
drivers/nvdimm/claim.c | 13
drivers/nvdimm/nd.h | 3
drivers/nvdimm/pfn_devs.c | 13
drivers/nvdimm/pmem.c | 27
drivers/nvdimm/region.c | 21
drivers/pci/p2pdma.c | 12
drivers/virtio/virtio_mem.c | 47 -
drivers/xen/unpopulated-alloc.c | 45
fs/fs_parser.c | 2
fs/ntfs/inode.c | 6
fs/ocfs2/alloc.c | 6
fs/ocfs2/localalloc.c | 2
fs/proc/base.c | 3
fs/proc/task_mmu.c | 104 +-
fs/xattr.c | 22
include/acpi/acpi_numa.h | 14
include/kunit/test.h | 5
include/linux/acpi.h | 2
include/linux/compaction.h | 3
include/linux/compiler-clang.h | 8
include/linux/compiler-gcc.h | 2
include/linux/compiler.h | 2
include/linux/dax.h | 8
include/linux/export.h | 2
include/linux/fs.h | 4
include/linux/gfp.h | 6
include/linux/huge_mm.h | 3
include/linux/kasan.h | 6
include/linux/memblock.h | 90 +
include/linux/memcontrol.h | 13
include/linux/memory_hotplug.h | 23
include/linux/memremap.h | 15
include/linux/mm.h | 36
include/linux/mmap_lock.h | 5
include/linux/mmzone.h | 37
include/linux/numa.h | 11
include/linux/oom.h | 1
include/linux/page-flags.h | 42
include/linux/pagemap.h | 43
include/linux/range.h | 6
include/linux/sched.h | 4
include/linux/sched/coredump.h | 1
include/linux/slab.h | 2
include/linux/swap.h | 10
include/linux/swap_slots.h | 2
kernel/dma/contiguous.c | 11
kernel/fork.c | 25
kernel/resource.c | 11
lib/Kconfig.debug | 9
lib/Kconfig.kasan | 31
lib/Makefile | 5
lib/kunit/test.c | 13
lib/test_free_pages.c | 42
lib/test_hmm.c | 65 -
lib/test_kasan.c | 732 ++++++---------
lib/test_kasan_module.c | 111 ++
mm/Kconfig | 4
mm/Makefile | 1
mm/compaction.c | 5
mm/debug.c | 18
mm/dmapool.c | 46 -
mm/fadvise.c | 9
mm/filemap.c | 78 -
mm/gup.c | 44
mm/gup_benchmark.c | 23
mm/huge_memory.c | 4
mm/hugetlb.c | 100 +-
mm/internal.h | 3
mm/kasan/report.c | 34
mm/kmemleak-test.c | 99 --
mm/kmemleak.c | 8
mm/madvise.c | 21
mm/memblock.c | 102 --
mm/memcontrol.c | 262 +++--
mm/memory-failure.c | 5
mm/memory.c | 147 +--
mm/memory_hotplug.c | 10
mm/mempolicy.c | 8
mm/mempool.c | 18
mm/memremap.c | 344 ++++---
mm/migrate.c | 3
mm/mincore.c | 28
mm/mmap.c | 45
mm/oom_kill.c | 2
mm/page_alloc.c | 82 -
mm/page_counter.c | 2
mm/page_io.c | 14
mm/page_isolation.c | 41
mm/shmem.c | 19
mm/slab.c | 4
mm/slab.h | 50 -
mm/slub.c | 33
mm/sparse.c | 10
mm/swap.c | 14
mm/swap_slots.c | 3
mm/swap_state.c | 38
mm/swapfile.c | 12
mm/truncate.c | 58 -
mm/vmalloc.c | 6
mm/vmscan.c | 5
mm/z3fold.c | 3
mm/zbud.c | 1
samples/Makefile | 1
samples/kmemleak/Makefile | 3
samples/kmemleak/kmemleak-test.c | 99 ++
scripts/decodecode | 29
scripts/spelling.txt | 4
tools/testing/nvdimm/dax-dev.c | 28
tools/testing/nvdimm/test/iomap.c | 2
tools/testing/selftests/vm/Makefile | 17
tools/testing/selftests/vm/compaction_test.c | 11
tools/testing/selftests/vm/gup_benchmark.c | 14
tools/testing/selftests/vm/hmm-tests.c | 4
194 files changed, 4273 insertions(+), 2777 deletions(-)
^ permalink raw reply [flat|nested] 232+ messages in thread
* incoming
@ 2020-10-16 2:40 Andrew Morton
2020-10-16 3:03 ` incoming Andrew Morton
0 siblings, 1 reply; 232+ messages in thread
From: Andrew Morton @ 2020-10-16 2:40 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm
- most of the rest of mm/
- various other subsystems
156 patches, based on 578a7155c5a1894a789d4ece181abf9d25dc6b0d.
Subsystems affected by this patch series:
mm/dax
mm/debug
mm/thp
mm/readahead
mm/page-poison
mm/util
mm/memory-hotplug
mm/zram
mm/cleanups
misc
core-kernel
get_maintainer
MAINTAINERS
lib
bitops
checkpatch
binfmt
ramfs
autofs
nilfs
rapidio
panic
relay
kgdb
ubsan
romfs
fault-injection
Subsystem: mm/dax
Dan Williams <dan.j.williams@intel.com>:
device-dax/kmem: fix resource release
Subsystem: mm/debug
"Aneesh Kumar K.V" <aneesh.kumar@linux.ibm.com>:
Patch series "mm/debug_vm_pgtable fixes", v4:
powerpc/mm: add DEBUG_VM WARN for pmd_clear
powerpc/mm: move setting pte specific flags to pfn_pte
mm/debug_vm_pgtable/ppc64: avoid setting top bits in radom value
mm/debug_vm_pgtables/hugevmap: use the arch helper to identify huge vmap support.
mm/debug_vm_pgtable/savedwrite: enable savedwrite test with CONFIG_NUMA_BALANCING
mm/debug_vm_pgtable/THP: mark the pte entry huge before using set_pmd/pud_at
mm/debug_vm_pgtable/set_pte/pmd/pud: don't use set_*_at to update an existing pte entry
mm/debug_vm_pgtable/locks: move non page table modifying test together
mm/debug_vm_pgtable/locks: take correct page table lock
mm/debug_vm_pgtable/thp: use page table depost/withdraw with THP
mm/debug_vm_pgtable/pmd_clear: don't use pmd/pud_clear on pte entries
mm/debug_vm_pgtable/hugetlb: disable hugetlb test on ppc64
mm/debug_vm_pgtable: avoid none pte in pte_clear_test
mm/debug_vm_pgtable: avoid doing memory allocation with pgtable_t mapped.
Subsystem: mm/thp
"Matthew Wilcox (Oracle)" <willy@infradead.org>:
Patch series "Fix read-only THP for non-tmpfs filesystems":
XArray: add xa_get_order
XArray: add xas_split
mm/filemap: fix storing to a THP shadow entry
Patch series "Remove assumptions of THP size":
mm/filemap: fix page cache removal for arbitrary sized THPs
mm/memory: remove page fault assumption of compound page size
mm/page_owner: change split_page_owner to take a count
"Kirill A. Shutemov" <kirill@shutemov.name>:
mm/huge_memory: fix total_mapcount assumption of page size
mm/huge_memory: fix split assumption of page size
"Matthew Wilcox (Oracle)" <willy@infradead.org>:
mm/huge_memory: fix page_trans_huge_mapcount assumption of THP size
mm/huge_memory: fix can_split_huge_page assumption of THP size
mm/rmap: fix assumptions of THP size
mm/truncate: fix truncation for pages of arbitrary size
mm/page-writeback: support tail pages in wait_for_stable_page
mm/vmscan: allow arbitrary sized pages to be paged out
fs: add a filesystem flag for THPs
fs: do not update nr_thps for mappings which support THPs
Huang Ying <ying.huang@intel.com>:
mm: fix a race during THP splitting
Subsystem: mm/readahead
"Matthew Wilcox (Oracle)" <willy@infradead.org>:
Patch series "Readahead patches for 5.9/5.10":
mm/readahead: add DEFINE_READAHEAD
mm/readahead: make page_cache_ra_unbounded take a readahead_control
mm/readahead: make do_page_cache_ra take a readahead_control
David Howells <dhowells@redhat.com>:
mm/readahead: make ondemand_readahead take a readahead_control
mm/readahead: pass readahead_control to force_page_cache_ra
"Matthew Wilcox (Oracle)" <willy@infradead.org>:
mm/readahead: add page_cache_sync_ra and page_cache_async_ra
David Howells <dhowells@redhat.com>:
mm/filemap: fold ra_submit into do_sync_mmap_readahead
mm/readahead: pass a file_ra_state into force_page_cache_ra
Subsystem: mm/page-poison
Naoya Horiguchi <naoya.horiguchi@nec.com>:
Patch series "HWPOISON: soft offline rework", v7:
mm,hwpoison: cleanup unused PageHuge() check
mm, hwpoison: remove recalculating hpage
mm,hwpoison-inject: don't pin for hwpoison_filter
Oscar Salvador <osalvador@suse.de>:
mm,hwpoison: unexport get_hwpoison_page and make it static
mm,hwpoison: refactor madvise_inject_error
mm,hwpoison: kill put_hwpoison_page
mm,hwpoison: unify THP handling for hard and soft offline
mm,hwpoison: rework soft offline for free pages
mm,hwpoison: rework soft offline for in-use pages
mm,hwpoison: refactor soft_offline_huge_page and __soft_offline_page
mm,hwpoison: return 0 if the page is already poisoned in soft-offline
Naoya Horiguchi <naoya.horiguchi@nec.com>:
mm,hwpoison: introduce MF_MSG_UNSPLIT_THP
mm,hwpoison: double-check page count in __get_any_page()
Oscar Salvador <osalvador@suse.de>:
mm,hwpoison: try to narrow window race for free pages
Mateusz Nosek <mateusznosek0@gmail.com>:
mm/page_poison.c: replace bool variable with static key
Miaohe Lin <linmiaohe@huawei.com>:
mm/vmstat.c: use helper macro abs()
Subsystem: mm/util
Bartosz Golaszewski <bgolaszewski@baylibre.com>:
mm/util.c: update the kerneldoc for kstrdup_const()
Jann Horn <jannh@google.com>:
mm/mmu_notifier: fix mmget() assert in __mmu_interval_notifier_insert
Subsystem: mm/memory-hotplug
David Hildenbrand <david@redhat.com>:
Patch series "mm/memory_hotplug: online_pages()/offline_pages() cleanups", v2:
mm/memory_hotplug: inline __offline_pages() into offline_pages()
mm/memory_hotplug: enforce section granularity when onlining/offlining
mm/memory_hotplug: simplify page offlining
mm/page_alloc: simplify __offline_isolated_pages()
mm/memory_hotplug: drop nr_isolate_pageblock in offline_pages()
mm/page_isolation: simplify return value of start_isolate_page_range()
mm/memory_hotplug: simplify page onlining
mm/page_alloc: drop stale pageblock comment in memmap_init_zone*()
mm: pass migratetype into memmap_init_zone() and move_pfn_range_to_zone()
mm/memory_hotplug: mark pageblocks MIGRATE_ISOLATE while onlining memory
Patch series "selective merging of system ram resources", v4:
kernel/resource: make release_mem_region_adjustable() never fail
kernel/resource: move and rename IORESOURCE_MEM_DRIVER_MANAGED
mm/memory_hotplug: guard more declarations by CONFIG_MEMORY_HOTPLUG
mm/memory_hotplug: prepare passing flags to add_memory() and friends
mm/memory_hotplug: MEMHP_MERGE_RESOURCE to specify merging of System RAM resources
virtio-mem: try to merge system ram resources
xen/balloon: try to merge system ram resources
hv_balloon: try to merge system ram resources
kernel/resource: make iomem_resource implicit in release_mem_region_adjustable()
Laurent Dufour <ldufour@linux.ibm.com>:
mm: don't panic when links can't be created in sysfs
David Hildenbrand <david@redhat.com>:
Patch series "mm: place pages to the freelist tail when onlining and undoing isolation", v2:
mm/page_alloc: convert "report" flag of __free_one_page() to a proper flag
mm/page_alloc: place pages to tail in __putback_isolated_page()
mm/page_alloc: move pages to tail in move_to_free_list()
mm/page_alloc: place pages to tail in __free_pages_core()
mm/memory_hotplug: update comment regarding zone shuffling
Subsystem: mm/zram
Douglas Anderson <dianders@chromium.org>:
zram: failing to decompress is WARN_ON worthy
Subsystem: mm/cleanups
YueHaibing <yuehaibing@huawei.com>:
mm/slab.h: remove duplicate include
Wei Yang <richard.weiyang@linux.alibaba.com>:
mm/page_reporting.c: drop stale list head check in page_reporting_cycle
Ira Weiny <ira.weiny@intel.com>:
mm/highmem.c: clean up endif comments
Yu Zhao <yuzhao@google.com>:
mm: use self-explanatory macros rather than "2"
Miaohe Lin <linmiaohe@huawei.com>:
mm: fix some broken comments
Chen Tao <chentao3@hotmail.com>:
mm: fix some comments formatting
Xiaofei Tan <tanxiaofei@huawei.com>:
mm/workingset.c: fix some doc warnings
Miaohe Lin <linmiaohe@huawei.com>:
mm: use helper function put_write_access()
Mike Rapoport <rppt@linux.ibm.com>:
include/linux/mmzone.h: remove unused early_pfn_valid()
"Matthew Wilcox (Oracle)" <willy@infradead.org>:
mm: rename page_order() to buddy_order()
Subsystem: misc
Randy Dunlap <rdunlap@infradead.org>:
fs: configfs: delete repeated words in comments
Andy Shevchenko <andriy.shevchenko@linux.intel.com>:
kernel.h: split out min()/max() et al. helpers
Subsystem: core-kernel
Liao Pingfang <liao.pingfang@zte.com.cn>:
kernel/sys.c: replace do_brk with do_brk_flags in comment of prctl_set_mm_map()
Randy Dunlap <rdunlap@infradead.org>:
kernel/: fix repeated words in comments
kernel: acct.c: fix some kernel-doc nits
Subsystem: get_maintainer
Joe Perches <joe@perches.com>:
get_maintainer: add test for file in VCS
Subsystem: MAINTAINERS
Joe Perches <joe@perches.com>:
get_maintainer: exclude MAINTAINERS file(s) from --git-fallback
Jarkko Sakkinen <jarkko.sakkinen@linux.intel.com>:
MAINTAINERS: jarkko.sakkinen@linux.intel.com -> jarkko@kernel.org
Subsystem: lib
Randy Dunlap <rdunlap@infradead.org>:
lib: bitmap: delete duplicated words
lib: libcrc32c: delete duplicated words
lib: decompress_bunzip2: delete duplicated words
lib: dynamic_queue_limits: delete duplicated words + fix typo
lib: earlycpio: delete duplicated words
lib: radix-tree: delete duplicated words
lib: syscall: delete duplicated words
lib: test_sysctl: delete duplicated words
lib/mpi/mpi-bit.c: fix spello of "functions"
Stephen Boyd <swboyd@chromium.org>:
lib/idr.c: document calling context for IDA APIs mustn't use locks
lib/idr.c: document that ida_simple_{get,remove}() are deprecated
Christophe JAILLET <christophe.jaillet@wanadoo.fr>:
lib/scatterlist.c: avoid a double memset
Miaohe Lin <linmiaohe@huawei.com>:
lib/percpu_counter.c: use helper macro abs()
Andy Shevchenko <andriy.shevchenko@linux.intel.com>:
include/linux/list.h: add a macro to test if entry is pointing to the head
Dan Carpenter <dan.carpenter@oracle.com>:
lib/test_hmm.c: fix an error code in dmirror_allocate_chunk()
Tobias Jordan <kernel@cdqe.de>:
lib/crc32.c: fix trivial typo in preprocessor condition
Subsystem: bitops
Wei Yang <richard.weiyang@linux.alibaba.com>:
bitops: simplify get_count_order_long()
bitops: use the same mechanism for get_count_order[_long]
Subsystem: checkpatch
Jerome Forissier <jerome@forissier.org>:
checkpatch: add --kconfig-prefix
Joe Perches <joe@perches.com>:
checkpatch: move repeated word test
checkpatch: add test for comma use that should be semicolon
Rikard Falkeborn <rikard.falkeborn@gmail.com>:
const_structs.checkpatch: add phy_ops
Nicolas Boichat <drinkcat@chromium.org>:
checkpatch: warn if trace_printk and friends are called
Rikard Falkeborn <rikard.falkeborn@gmail.com>:
const_structs.checkpatch: add pinctrl_ops and pinmux_ops
Joe Perches <joe@perches.com>:
checkpatch: warn on self-assignments
checkpatch: allow not using -f with files that are in git
Dwaipayan Ray <dwaipayanray1@gmail.com>:
checkpatch: extend author Signed-off-by check for split From: header
Joe Perches <joe@perches.com>:
checkpatch: emit a warning on embedded filenames
Dwaipayan Ray <dwaipayanray1@gmail.com>:
checkpatch: fix multi-statement macro checks for while blocks.
Łukasz Stelmach <l.stelmach@samsung.com>:
checkpatch: fix false positive on empty block comment lines
Dwaipayan Ray <dwaipayanray1@gmail.com>:
checkpatch: add new warnings to author signoff checks.
Subsystem: binfmt
Chris Kennelly <ckennelly@google.com>:
Patch series "Selecting Load Addresses According to p_align", v3:
fs/binfmt_elf: use PT_LOAD p_align values for suitable start address
tools/testing/selftests: add self-test for verifying load alignment
Jann Horn <jannh@google.com>:
Patch series "Fix ELF / FDPIC ELF core dumping, and use mmap_lock properly in there", v5:
binfmt_elf_fdpic: stop using dump_emit() on user pointers on !MMU
coredump: let dump_emit() bail out on short writes
coredump: refactor page range dumping into common helper
coredump: rework elf/elf_fdpic vma_dump_size() into common helper
binfmt_elf, binfmt_elf_fdpic: use a VMA list snapshot
mm/gup: take mmap_lock in get_dump_page()
mm: remove the now-unnecessary mmget_still_valid() hack
Subsystem: ramfs
Matthew Wilcox (Oracle) <willy@infradead.org>:
ramfs: fix nommu mmap with gaps in the page cache
Subsystem: autofs
Matthew Wilcox <willy@infradead.org>:
autofs: harden ioctl table
Subsystem: nilfs
Wang Hai <wanghai38@huawei.com>:
nilfs2: fix some kernel-doc warnings for nilfs2
Subsystem: rapidio
Souptick Joarder <jrdr.linux@gmail.com>:
rapidio: fix error handling path
Jing Xiangfeng <jingxiangfeng@huawei.com>:
rapidio: fix the missed put_device() for rio_mport_add_riodev
Subsystem: panic
Alexey Kardashevskiy <aik@ozlabs.ru>:
panic: dump registers on panic_on_warn
Subsystem: relay
Sudip Mukherjee <sudipm.mukherjee@gmail.com>:
kernel/relay.c: drop unneeded initialization
Subsystem: kgdb
Ritesh Harjani <riteshh@linux.ibm.com>:
scripts/gdb/proc: add struct mount & struct super_block addr in lx-mounts command
scripts/gdb/tasks: add headers and improve spacing format
Subsystem: ubsan
Elena Petrova <lenaptr@google.com>:
sched.h: drop in_ubsan field when UBSAN is in trap mode
George Popescu <georgepope@android.com>:
ubsan: introduce CONFIG_UBSAN_LOCAL_BOUNDS for Clang
Subsystem: romfs
Libing Zhou <libing.zhou@nokia-sbell.com>:
ROMFS: support inode blocks calculation
Subsystem: fault-injection
Albert van der Linde <alinde@google.com>:
Patch series "add fault injection to user memory access", v3:
lib, include/linux: add usercopy failure capability
lib, uaccess: add failure injection to usercopy functions
.mailmap | 1
Documentation/admin-guide/kernel-parameters.txt | 1
Documentation/core-api/xarray.rst | 14
Documentation/fault-injection/fault-injection.rst | 7
MAINTAINERS | 6
arch/ia64/mm/init.c | 4
arch/powerpc/include/asm/book3s/64/pgtable.h | 29 +
arch/powerpc/include/asm/nohash/pgtable.h | 5
arch/powerpc/mm/pgtable.c | 5
arch/powerpc/platforms/powernv/memtrace.c | 2
arch/powerpc/platforms/pseries/hotplug-memory.c | 2
drivers/acpi/acpi_memhotplug.c | 3
drivers/base/memory.c | 3
drivers/base/node.c | 33 +-
drivers/block/zram/zram_drv.c | 2
drivers/dax/kmem.c | 50 ++-
drivers/hv/hv_balloon.c | 4
drivers/infiniband/core/uverbs_main.c | 3
drivers/rapidio/devices/rio_mport_cdev.c | 18 -
drivers/s390/char/sclp_cmd.c | 2
drivers/vfio/pci/vfio_pci.c | 38 +-
drivers/virtio/virtio_mem.c | 5
drivers/xen/balloon.c | 4
fs/autofs/dev-ioctl.c | 8
fs/binfmt_elf.c | 267 +++-------------
fs/binfmt_elf_fdpic.c | 176 ++--------
fs/configfs/dir.c | 2
fs/configfs/file.c | 2
fs/coredump.c | 238 +++++++++++++-
fs/ext4/verity.c | 4
fs/f2fs/verity.c | 4
fs/inode.c | 2
fs/nilfs2/bmap.c | 2
fs/nilfs2/cpfile.c | 6
fs/nilfs2/page.c | 1
fs/nilfs2/sufile.c | 4
fs/proc/task_mmu.c | 18 -
fs/ramfs/file-nommu.c | 2
fs/romfs/super.c | 1
fs/userfaultfd.c | 28 -
include/linux/bitops.h | 13
include/linux/blkdev.h | 1
include/linux/bvec.h | 6
include/linux/coredump.h | 13
include/linux/fault-inject-usercopy.h | 22 +
include/linux/fs.h | 28 -
include/linux/idr.h | 13
include/linux/ioport.h | 15
include/linux/jiffies.h | 3
include/linux/kernel.h | 150 ---------
include/linux/list.h | 29 +
include/linux/memory_hotplug.h | 42 +-
include/linux/minmax.h | 153 +++++++++
include/linux/mm.h | 5
include/linux/mmzone.h | 17 -
include/linux/node.h | 16
include/linux/nodemask.h | 2
include/linux/page-flags.h | 6
include/linux/page_owner.h | 6
include/linux/pagemap.h | 111 ++++++
include/linux/sched.h | 2
include/linux/sched/mm.h | 25 -
include/linux/uaccess.h | 12
include/linux/vmstat.h | 2
include/linux/xarray.h | 22 +
include/ras/ras_event.h | 3
kernel/acct.c | 10
kernel/cgroup/cpuset.c | 2
kernel/dma/direct.c | 2
kernel/fork.c | 4
kernel/futex.c | 2
kernel/irq/timings.c | 2
kernel/jump_label.c | 2
kernel/kcsan/encoding.h | 2
kernel/kexec_core.c | 2
kernel/kexec_file.c | 2
kernel/kthread.c | 2
kernel/livepatch/state.c | 2
kernel/panic.c | 12
kernel/pid_namespace.c | 2
kernel/power/snapshot.c | 2
kernel/range.c | 3
kernel/relay.c | 2
kernel/resource.c | 114 +++++--
kernel/smp.c | 2
kernel/sys.c | 2
kernel/user_namespace.c | 2
lib/Kconfig.debug | 7
lib/Kconfig.ubsan | 14
lib/Makefile | 1
lib/bitmap.c | 2
lib/crc32.c | 2
lib/decompress_bunzip2.c | 2
lib/dynamic_queue_limits.c | 4
lib/earlycpio.c | 2
lib/fault-inject-usercopy.c | 39 ++
lib/find_bit.c | 1
lib/hexdump.c | 1
lib/idr.c | 9
lib/iov_iter.c | 5
lib/libcrc32c.c | 2
lib/math/rational.c | 2
lib/math/reciprocal_div.c | 1
lib/mpi/mpi-bit.c | 2
lib/percpu_counter.c | 2
lib/radix-tree.c | 2
lib/scatterlist.c | 2
lib/strncpy_from_user.c | 3
lib/syscall.c | 2
lib/test_hmm.c | 2
lib/test_sysctl.c | 2
lib/test_xarray.c | 65 ++++
lib/usercopy.c | 5
lib/xarray.c | 208 ++++++++++++
mm/Kconfig | 2
mm/compaction.c | 6
mm/debug_vm_pgtable.c | 267 ++++++++--------
mm/filemap.c | 58 ++-
mm/gup.c | 73 ++--
mm/highmem.c | 4
mm/huge_memory.c | 47 +-
mm/hwpoison-inject.c | 18 -
mm/internal.h | 47 +-
mm/khugepaged.c | 2
mm/madvise.c | 52 ---
mm/memory-failure.c | 357 ++++++++++------------
mm/memory.c | 7
mm/memory_hotplug.c | 223 +++++--------
mm/memremap.c | 3
mm/migrate.c | 11
mm/mmap.c | 7
mm/mmu_notifier.c | 2
mm/page-writeback.c | 1
mm/page_alloc.c | 289 +++++++++++------
mm/page_isolation.c | 16
mm/page_owner.c | 10
mm/page_poison.c | 20 -
mm/page_reporting.c | 4
mm/readahead.c | 174 ++++------
mm/rmap.c | 10
mm/shmem.c | 2
mm/shuffle.c | 2
mm/slab.c | 2
mm/slab.h | 1
mm/slub.c | 2
mm/sparse.c | 2
mm/swap_state.c | 2
mm/truncate.c | 6
mm/util.c | 3
mm/vmscan.c | 5
mm/vmstat.c | 8
mm/workingset.c | 2
scripts/Makefile.ubsan | 10
scripts/checkpatch.pl | 238 ++++++++++----
scripts/const_structs.checkpatch | 3
scripts/gdb/linux/proc.py | 15
scripts/gdb/linux/tasks.py | 9
scripts/get_maintainer.pl | 9
tools/testing/selftests/exec/.gitignore | 1
tools/testing/selftests/exec/Makefile | 9
tools/testing/selftests/exec/load_address.c | 68 ++++
161 files changed, 2532 insertions(+), 1864 deletions(-)
^ permalink raw reply [flat|nested] 232+ messages in thread
* Re: incoming
2020-10-16 2:40 incoming Andrew Morton
@ 2020-10-16 3:03 ` Andrew Morton
0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2020-10-16 3:03 UTC (permalink / raw)
To: Linus Torvalds, mm-commits, linux-mm
And... I forgot to set in-reply-to :(
Shall resend, omitting linux-mm.
^ permalink raw reply [flat|nested] 232+ messages in thread
* incoming
@ 2020-10-17 23:13 Andrew Morton
0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2020-10-17 23:13 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm
40 patches, based on 9d9af1007bc08971953ae915d88dc9bb21344b53.
Subsystems affected by this patch series:
ia64
mm/memcg
mm/migration
mm/pagemap
mm/gup
mm/madvise
mm/vmalloc
misc
Subsystem: ia64
Krzysztof Kozlowski <krzk@kernel.org>:
ia64: fix build error with !COREDUMP
Subsystem: mm/memcg
Roman Gushchin <guro@fb.com>:
mm, memcg: rework remote charging API to support nesting
Patch series "mm: kmem: kernel memory accounting in an interrupt context":
mm: kmem: move memcg_kmem_bypass() calls to get_mem/obj_cgroup_from_current()
mm: kmem: remove redundant checks from get_obj_cgroup_from_current()
mm: kmem: prepare remote memcg charging infra for interrupt contexts
mm: kmem: enable kernel memcg accounting from interrupt contexts
Subsystem: mm/migration
Joonsoo Kim <iamjoonsoo.kim@lge.com>:
mm/memory-failure: remove a wrapper for alloc_migration_target()
mm/memory_hotplug: remove a wrapper for alloc_migration_target()
Miaohe Lin <linmiaohe@huawei.com>:
mm/migrate: avoid possible unnecessary process right check in kernel_move_pages()
Subsystem: mm/pagemap
"Liam R. Howlett" <Liam.Howlett@Oracle.com>:
mm/mmap: add inline vma_next() for readability of mmap code
mm/mmap: add inline munmap_vma_range() for code readability
Subsystem: mm/gup
Jann Horn <jannh@google.com>:
mm/gup_benchmark: take the mmap lock around GUP
binfmt_elf: take the mmap lock around find_extend_vma()
mm/gup: assert that the mmap lock is held in __get_user_pages()
John Hubbard <jhubbard@nvidia.com>:
Patch series "selftests/vm: gup_test, hmm-tests, assorted improvements", v2:
mm/gup_benchmark: rename to mm/gup_test
selftests/vm: use a common gup_test.h
selftests/vm: rename run_vmtests --> run_vmtests.sh
selftests/vm: minor cleanup: Makefile and gup_test.c
selftests/vm: only some gup_test items are really benchmarks
selftests/vm: gup_test: introduce the dump_pages() sub-test
selftests/vm: run_vmtests.sh: update and clean up gup_test invocation
selftests/vm: hmm-tests: remove the libhugetlbfs dependency
selftests/vm: 10x speedup for hmm-tests
Subsystem: mm/madvise
Minchan Kim <minchan@kernel.org>:
Patch series "introduce memory hinting API for external process", v9:
mm/madvise: pass mm to do_madvise
pid: move pidfd_get_pid() to pid.c
mm/madvise: introduce process_madvise() syscall: an external memory hinting API
Subsystem: mm/vmalloc
"Matthew Wilcox (Oracle)" <willy@infradead.org>:
Patch series "remove alloc_vm_area", v4:
mm: update the documentation for vfree
Christoph Hellwig <hch@lst.de>:
mm: add a VM_MAP_PUT_PAGES flag for vmap
mm: add a vmap_pfn function
mm: allow a NULL fn callback in apply_to_page_range
zsmalloc: switch from alloc_vm_area to get_vm_area
drm/i915: use vmap in shmem_pin_map
drm/i915: stop using kmap in i915_gem_object_map
drm/i915: use vmap in i915_gem_object_map
xen/xenbus: use apply_to_page_range directly in xenbus_map_ring_pv
x86/xen: open code alloc_vm_area in arch_gnttab_valloc
mm: remove alloc_vm_area
Patch series "two small vmalloc cleanups":
mm: cleanup the gfp_mask handling in __vmalloc_area_node
mm: remove the filename in the top of file comment in vmalloc.c
Subsystem: misc
Tian Tao <tiantao6@hisilicon.com>:
mm: remove duplicate include statement in mmu.c
Documentation/core-api/pin_user_pages.rst | 8
arch/alpha/kernel/syscalls/syscall.tbl | 1
arch/arm/mm/mmu.c | 1
arch/arm/tools/syscall.tbl | 1
arch/arm64/include/asm/unistd.h | 2
arch/arm64/include/asm/unistd32.h | 2
arch/ia64/kernel/Makefile | 2
arch/ia64/kernel/syscalls/syscall.tbl | 1
arch/m68k/kernel/syscalls/syscall.tbl | 1
arch/microblaze/kernel/syscalls/syscall.tbl | 1
arch/mips/kernel/syscalls/syscall_n32.tbl | 1
arch/mips/kernel/syscalls/syscall_n64.tbl | 1
arch/mips/kernel/syscalls/syscall_o32.tbl | 1
arch/parisc/kernel/syscalls/syscall.tbl | 1
arch/powerpc/kernel/syscalls/syscall.tbl | 1
arch/s390/configs/debug_defconfig | 2
arch/s390/configs/defconfig | 2
arch/s390/kernel/syscalls/syscall.tbl | 1
arch/sh/kernel/syscalls/syscall.tbl | 1
arch/sparc/kernel/syscalls/syscall.tbl | 1
arch/x86/entry/syscalls/syscall_32.tbl | 1
arch/x86/entry/syscalls/syscall_64.tbl | 1
arch/x86/xen/grant-table.c | 27 +-
arch/xtensa/kernel/syscalls/syscall.tbl | 1
drivers/gpu/drm/i915/Kconfig | 1
drivers/gpu/drm/i915/gem/i915_gem_pages.c | 136 ++++------
drivers/gpu/drm/i915/gt/shmem_utils.c | 78 +-----
drivers/xen/xenbus/xenbus_client.c | 30 +-
fs/binfmt_elf.c | 3
fs/buffer.c | 6
fs/io_uring.c | 2
fs/notify/fanotify/fanotify.c | 5
fs/notify/inotify/inotify_fsnotify.c | 5
include/linux/memcontrol.h | 12
include/linux/mm.h | 2
include/linux/pid.h | 1
include/linux/sched/mm.h | 43 +--
include/linux/syscalls.h | 2
include/linux/vmalloc.h | 7
include/uapi/asm-generic/unistd.h | 4
kernel/exit.c | 19 -
kernel/pid.c | 19 +
kernel/sys_ni.c | 1
mm/Kconfig | 24 +
mm/Makefile | 2
mm/gup.c | 2
mm/gup_benchmark.c | 225 ------------------
mm/gup_test.c | 295 +++++++++++++++++++++--
mm/gup_test.h | 40 ++-
mm/madvise.c | 125 ++++++++--
mm/memcontrol.c | 83 ++++--
mm/memory-failure.c | 18 -
mm/memory.c | 16 -
mm/memory_hotplug.c | 46 +--
mm/migrate.c | 71 +++--
mm/mmap.c | 74 ++++-
mm/nommu.c | 7
mm/percpu.c | 3
mm/slab.h | 3
mm/vmalloc.c | 147 +++++------
mm/zsmalloc.c | 10
tools/testing/selftests/vm/.gitignore | 3
tools/testing/selftests/vm/Makefile | 40 ++-
tools/testing/selftests/vm/check_config.sh | 31 ++
tools/testing/selftests/vm/config | 2
tools/testing/selftests/vm/gup_benchmark.c | 143 -----------
tools/testing/selftests/vm/gup_test.c | 260 ++++++++++++++++++--
tools/testing/selftests/vm/hmm-tests.c | 12
tools/testing/selftests/vm/run_vmtests | 334 --------------------------
tools/testing/selftests/vm/run_vmtests.sh | 350 +++++++++++++++++++++++++++-
70 files changed, 1580 insertions(+), 1224 deletions(-)
^ permalink raw reply [flat|nested] 232+ messages in thread
* incoming
@ 2020-11-02 1:06 Andrew Morton
0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2020-11-02 1:06 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm
15 patches, based on 3cea11cd5e3b00d91caf0b4730194039b45c5891.
Subsystems affected by this patch series:
mm/memremap
mm/memcg
mm/slab-generic
mm/kasan
mm/mempolicy
signals
lib
mm/pagecache
kthread
mm/oom-kill
mm/pagemap
epoll
core-kernel
Subsystem: mm/memremap
Ralph Campbell <rcampbell@nvidia.com>:
mm/mremap_pages: fix static key devmap_managed_key updates
Subsystem: mm/memcg
Mike Kravetz <mike.kravetz@oracle.com>:
hugetlb_cgroup: fix reservation accounting
zhongjiang-ali <zhongjiang-ali@linux.alibaba.com>:
mm: memcontrol: correct the NR_ANON_THPS counter of hierarchical memcg
Roman Gushchin <guro@fb.com>:
mm: memcg: link page counters to root if use_hierarchy is false
Subsystem: mm/slab-generic
Subsystem: mm/kasan
Andrey Konovalov <andreyknvl@google.com>:
kasan: adopt KUNIT tests to SW_TAGS mode
Subsystem: mm/mempolicy
Shijie Luo <luoshijie1@huawei.com>:
mm: mempolicy: fix potential pte_unmap_unlock pte error
Subsystem: signals
Oleg Nesterov <oleg@redhat.com>:
ptrace: fix task_join_group_stop() for the case when current is traced
Subsystem: lib
Vasily Gorbik <gor@linux.ibm.com>:
lib/crc32test: remove extra local_irq_disable/enable
Subsystem: mm/pagecache
Jason Yan <yanaijie@huawei.com>:
mm/truncate.c: make __invalidate_mapping_pages() static
Subsystem: kthread
Zqiang <qiang.zhang@windriver.com>:
kthread_worker: prevent queuing delayed work from timer_fn when it is being canceled
Subsystem: mm/oom-kill
Charles Haithcock <chaithco@redhat.com>:
mm, oom: keep oom_adj under or at upper limit when printing
Subsystem: mm/pagemap
Jason Gunthorpe <jgg@nvidia.com>:
mm: always have io_remap_pfn_range() set pgprot_decrypted()
Subsystem: epoll
Soheil Hassas Yeganeh <soheil@google.com>:
epoll: check ep_events_available() upon timeout
epoll: add a selftest for epoll timeout race
Subsystem: core-kernel
Lukas Bulwahn <lukas.bulwahn@gmail.com>:
kernel/hung_task.c: make type annotations consistent
fs/eventpoll.c | 16 +
fs/proc/base.c | 2
include/linux/mm.h | 9
include/linux/pgtable.h | 4
kernel/hung_task.c | 3
kernel/kthread.c | 3
kernel/signal.c | 19 -
lib/crc32test.c | 4
lib/test_kasan.c | 149 +++++++---
mm/hugetlb.c | 20 -
mm/memcontrol.c | 25 +
mm/mempolicy.c | 6
mm/memremap.c | 39 +-
mm/truncate.c | 2
tools/testing/selftests/filesystems/epoll/epoll_wakeup_test.c | 95 ++++++
15 files changed, 290 insertions(+), 106 deletions(-)
^ permalink raw reply [flat|nested] 232+ messages in thread
* incoming
@ 2020-11-14 6:51 Andrew Morton
0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2020-11-14 6:51 UTC (permalink / raw)
To: Linus Torvalds; +Cc: linux-mm, mm-commits
14 patches, based on 9e6a39eae450b81c8b2c8cbbfbdf8218e9b40c81.
Subsystems affected by this patch series:
mm/migration
mm/vmscan
mailmap
mm/slub
mm/gup
kbuild
reboot
kernel/watchdog
mm/memcg
mm/hugetlbfs
panic
ocfs2
Subsystem: mm/migration
Zi Yan <ziy@nvidia.com>:
mm/compaction: count pages and stop correctly during page isolation
mm/compaction: stop isolation if too many pages are isolated and we have pages to migrate
Subsystem: mm/vmscan
Nicholas Piggin <npiggin@gmail.com>:
mm/vmscan: fix NR_ISOLATED_FILE corruption on 64-bit
Subsystem: mailmap
Dmitry Baryshkov <dbaryshkov@gmail.com>:
mailmap: fix entry for Dmitry Baryshkov/Eremin-Solenikov
Subsystem: mm/slub
Laurent Dufour <ldufour@linux.ibm.com>:
mm/slub: fix panic in slab_alloc_node()
Subsystem: mm/gup
Jason Gunthorpe <jgg@nvidia.com>:
mm/gup: use unpin_user_pages() in __gup_longterm_locked()
Subsystem: kbuild
Arvind Sankar <nivedita@alum.mit.edu>:
compiler.h: fix barrier_data() on clang
Subsystem: reboot
Matteo Croce <mcroce@microsoft.com>:
Patch series "fix parsing of reboot= cmdline", v3:
Revert "kernel/reboot.c: convert simple_strtoul to kstrtoint"
reboot: fix overflow parsing reboot cpu number
Subsystem: kernel/watchdog
Santosh Sivaraj <santosh@fossix.org>:
kernel/watchdog: fix watchdog_allowed_mask not used warning
Subsystem: mm/memcg
Muchun Song <songmuchun@bytedance.com>:
mm: memcontrol: fix missing wakeup polling thread
Subsystem: mm/hugetlbfs
Mike Kravetz <mike.kravetz@oracle.com>:
hugetlbfs: fix anon huge page migration race
Subsystem: panic
Christophe Leroy <christophe.leroy@csgroup.eu>:
panic: don't dump stack twice on warn
Subsystem: ocfs2
Wengang Wang <wen.gang.wang@oracle.com>:
ocfs2: initialize ip_next_orphan
.mailmap | 5 +-
fs/ocfs2/super.c | 1
include/asm-generic/barrier.h | 1
include/linux/compiler-clang.h | 6 --
include/linux/compiler-gcc.h | 19 --------
include/linux/compiler.h | 18 +++++++-
include/linux/memcontrol.h | 11 ++++-
kernel/panic.c | 3 -
kernel/reboot.c | 28 ++++++------
kernel/watchdog.c | 4 -
mm/compaction.c | 12 +++--
mm/gup.c | 14 ++++--
mm/hugetlb.c | 90 ++---------------------------------------
mm/memory-failure.c | 36 +++++++---------
mm/migrate.c | 46 +++++++++++---------
mm/rmap.c | 5 --
mm/slub.c | 2
mm/vmscan.c | 5 +-
18 files changed, 119 insertions(+), 187 deletions(-)
^ permalink raw reply [flat|nested] 232+ messages in thread
* incoming
@ 2020-11-22 6:16 Andrew Morton
0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2020-11-22 6:16 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm
8 patches, based on a349e4c659609fd20e4beea89e5c4a4038e33a95.
Subsystems affected by this patch series:
mm/madvise
kbuild
mm/pagemap
mm/readahead
mm/memcg
mm/userfaultfd
vfs-akpm
mm/madvise
Subsystem: mm/madvise
Eric Dumazet <edumazet@google.com>:
mm/madvise: fix memory leak from process_madvise
Subsystem: kbuild
Nick Desaulniers <ndesaulniers@google.com>:
compiler-clang: remove version check for BPF Tracing
Subsystem: mm/pagemap
Dan Williams <dan.j.williams@intel.com>:
mm: fix phys_to_target_node() and memory_add_physaddr_to_nid() exports
Subsystem: mm/readahead
"Matthew Wilcox (Oracle)" <willy@infradead.org>:
mm: fix readahead_page_batch for retry entries
Subsystem: mm/memcg
Muchun Song <songmuchun@bytedance.com>:
mm: memcg/slab: fix root memcg vmstats
Subsystem: mm/userfaultfd
Gerald Schaefer <gerald.schaefer@linux.ibm.com>:
mm/userfaultfd: do not access vma->vm_mm after calling handle_userfault()
Subsystem: vfs-akpm
Yicong Yang <yangyicong@hisilicon.com>:
libfs: fix error cast of negative value in simple_attr_write()
Subsystem: mm/madvise
"Matthew Wilcox (Oracle)" <willy@infradead.org>:
mm: fix madvise WILLNEED performance problem
arch/ia64/include/asm/sparsemem.h | 6 ++++++
arch/powerpc/include/asm/mmzone.h | 5 +++++
arch/powerpc/include/asm/sparsemem.h | 5 ++---
arch/powerpc/mm/mem.c | 1 +
arch/x86/include/asm/sparsemem.h | 10 ++++++++++
arch/x86/mm/numa.c | 2 ++
drivers/dax/Kconfig | 1 -
fs/libfs.c | 6 ++++--
include/linux/compiler-clang.h | 2 ++
include/linux/memory_hotplug.h | 14 --------------
include/linux/numa.h | 30 +++++++++++++++++++++++++++++-
include/linux/pagemap.h | 2 ++
mm/huge_memory.c | 9 ++++-----
mm/madvise.c | 4 +---
mm/memcontrol.c | 9 +++++++--
mm/memory_hotplug.c | 18 ------------------
16 files changed, 75 insertions(+), 49 deletions(-)
^ permalink raw reply [flat|nested] 232+ messages in thread
* incoming
@ 2020-12-06 6:14 Andrew Morton
0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2020-12-06 6:14 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm
12 patches, based on 33256ce194110874d4bc90078b577c59f9076c59.
Subsystems affected by this patch series:
lib
coredump
mm/memcg
mm/zsmalloc
mm/swap
mailmap
mm/selftests
mm/pagecache
mm/hugetlb
mm/pagemap
Subsystem: lib
Randy Dunlap <rdunlap@infradead.org>:
zlib: export S390 symbols for zlib modules
Subsystem: coredump
Menglong Dong <dong.menglong@zte.com.cn>:
coredump: fix core_pattern parse error
Subsystem: mm/memcg
Roman Gushchin <guro@fb.com>:
mm: memcg/slab: fix obj_cgroup_charge() return value handling
Yang Shi <shy828301@gmail.com>:
mm: list_lru: set shrinker map bit when child nr_items is not zero
Subsystem: mm/zsmalloc
Minchan Kim <minchan@kernel.org>:
mm/zsmalloc.c: drop ZSMALLOC_PGTABLE_MAPPING
Subsystem: mm/swap
Qian Cai <qcai@redhat.com>:
mm/swapfile: do not sleep with a spin lock held
Subsystem: mailmap
Uwe Kleine-König <u.kleine-koenig@pengutronix.de>:
mailmap: add two more addresses of Uwe Kleine-König
Subsystem: mm/selftests
Xingxing Su <suxingxing@loongson.cn>:
tools/testing/selftests/vm: fix build error
Axel Rasmussen <axelrasmussen@google.com>:
userfaultfd: selftests: fix SIGSEGV if huge mmap fails
Subsystem: mm/pagecache
Alex Shi <alex.shi@linux.alibaba.com>:
mm/filemap: add static for function __add_to_page_cache_locked
Subsystem: mm/hugetlb
Mike Kravetz <mike.kravetz@oracle.com>:
hugetlb_cgroup: fix offline of hugetlb cgroup with reservations
Subsystem: mm/pagemap
Liu Zixian <liuzixian4@huawei.com>:
mm/mmap.c: fix mmap return value when vma is merged after call_mmap()
.mailmap | 2 +
arch/arm/configs/omap2plus_defconfig | 1
fs/coredump.c | 3 +
include/linux/zsmalloc.h | 1
lib/zlib_dfltcc/dfltcc_inflate.c | 3 +
mm/Kconfig | 13 -------
mm/filemap.c | 2 -
mm/hugetlb_cgroup.c | 8 +---
mm/list_lru.c | 10 ++---
mm/mmap.c | 26 ++++++--------
mm/slab.h | 40 +++++++++++++---------
mm/swapfile.c | 4 +-
mm/zsmalloc.c | 54 -------------------------------
tools/testing/selftests/vm/Makefile | 4 ++
tools/testing/selftests/vm/userfaultfd.c | 25 +++++++++-----
15 files changed, 75 insertions(+), 121 deletions(-)
^ permalink raw reply [flat|nested] 232+ messages in thread
* incoming
@ 2020-12-11 21:35 Andrew Morton
0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2020-12-11 21:35 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm
8 patches, based on 33dc9614dc208291d0c4bcdeb5d30d481dcd2c4c.
Subsystems affected by this patch series:
mm/pagecache
proc
selftests
kbuild
mm/kasan
mm/hugetlb
Subsystem: mm/pagecache
Andrew Morton <akpm@linux-foundation.org>:
revert "mm/filemap: add static for function __add_to_page_cache_locked"
Subsystem: proc
Miles Chen <miles.chen@mediatek.com>:
proc: use untagged_addr() for pagemap_read addresses
Subsystem: selftests
Arnd Bergmann <arnd@arndb.de>:
selftest/fpu: avoid clang warning
Subsystem: kbuild
Arnd Bergmann <arnd@arndb.de>:
kbuild: avoid static_assert for genksyms
initramfs: fix clang build failure
elfcore: fix building with clang
Subsystem: mm/kasan
Kuan-Ying Lee <Kuan-Ying.Lee@mediatek.com>:
kasan: fix object remaining in offline per-cpu quarantine
Subsystem: mm/hugetlb
Gerald Schaefer <gerald.schaefer@linux.ibm.com>:
mm/hugetlb: clear compound_nr before freeing gigantic pages
fs/proc/task_mmu.c | 8 ++++++--
include/linux/build_bug.h | 5 +++++
include/linux/elfcore.h | 22 ++++++++++++++++++++++
init/initramfs.c | 2 +-
kernel/Makefile | 1 -
kernel/elfcore.c | 26 --------------------------
lib/Makefile | 3 ++-
mm/filemap.c | 2 +-
mm/hugetlb.c | 1 +
mm/kasan/quarantine.c | 39 +++++++++++++++++++++++++++++++++++++++
10 files changed, 77 insertions(+), 32 deletions(-)
^ permalink raw reply [flat|nested] 232+ messages in thread
* incoming
@ 2020-12-15 3:02 Andrew Morton
2020-12-15 3:25 ` incoming Linus Torvalds
0 siblings, 1 reply; 232+ messages in thread
From: Andrew Morton @ 2020-12-15 3:02 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm
- a few random little subsystems
- almost all of the MM patches which are staged ahead of linux-next
material. I'll trickle to post-linux-next work in as the dependents
get merged up.
200 patches, based on 2c85ebc57b3e1817b6ce1a6b703928e113a90442.
Subsystems affected by this patch series:
kthread
kbuild
ide
ntfs
ocfs2
arch
mm/slab-generic
mm/slab
mm/slub
mm/dax
mm/debug
mm/pagecache
mm/gup
mm/swap
mm/shmem
mm/memcg
mm/pagemap
mm/mremap
mm/hmm
mm/vmalloc
mm/documentation
mm/kasan
mm/pagealloc
mm/memory-failure
mm/hugetlb
mm/vmscan
mm/z3fold
mm/compaction
mm/oom-kill
mm/migration
mm/cma
mm/page-poison
mm/userfaultfd
mm/zswap
mm/zsmalloc
mm/uaccess
mm/zram
mm/cleanups
Subsystem: kthread
Rob Clark <robdclark@chromium.org>:
kthread: add kthread_work tracepoints
Petr Mladek <pmladek@suse.com>:
kthread_worker: document CPU hotplug handling
Subsystem: kbuild
Petr Vorel <petr.vorel@gmail.com>:
uapi: move constants from <linux/kernel.h> to <linux/const.h>
Subsystem: ide
Sebastian Andrzej Siewior <bigeasy@linutronix.de>:
ide/falcon: remove in_interrupt() usage
ide: remove BUG_ON(in_interrupt() || irqs_disabled()) from ide_unregister()
Subsystem: ntfs
Alex Shi <alex.shi@linux.alibaba.com>:
fs/ntfs: remove unused varibles
fs/ntfs: remove unused variable attr_len
Subsystem: ocfs2
Tom Rix <trix@redhat.com>:
fs/ocfs2/cluster/tcp.c: remove unneeded break
Mauricio Faria de Oliveira <mfo@canonical.com>:
ocfs2: ratelimit the 'max lookup times reached' notice
Subsystem: arch
Colin Ian King <colin.king@canonical.com>:
arch/Kconfig: fix spelling mistakes
Subsystem: mm/slab-generic
Hui Su <sh_def@163.com>:
mm/slab_common.c: use list_for_each_entry in dump_unreclaimable_slab()
Bartosz Golaszewski <bgolaszewski@baylibre.com>:
Patch series "slab: provide and use krealloc_array()", v3:
mm: slab: clarify krealloc()'s behavior with __GFP_ZERO
mm: slab: provide krealloc_array()
ALSA: pcm: use krealloc_array()
vhost: vringh: use krealloc_array()
pinctrl: use krealloc_array()
edac: ghes: use krealloc_array()
drm: atomic: use krealloc_array()
hwtracing: intel: use krealloc_array()
dma-buf: use krealloc_array()
Vlastimil Babka <vbabka@suse.cz>:
mm, slab, slub: clear the slab_cache field when freeing page
Subsystem: mm/slab
Alexander Popov <alex.popov@linux.com>:
mm/slab: rerform init_on_free earlier
Subsystem: mm/slub
Vlastimil Babka <vbabka@suse.cz>:
mm, slub: use kmem_cache_debug_flags() in deactivate_slab()
Bharata B Rao <bharata@linux.ibm.com>:
mm/slub: let number of online CPUs determine the slub page order
Subsystem: mm/dax
Dan Williams <dan.j.williams@intel.com>:
device-dax/kmem: use struct_size()
Subsystem: mm/debug
Zhenhua Huang <zhenhuah@codeaurora.org>:
mm: fix page_owner initializing issue for arm32
Liam Mark <lmark@codeaurora.org>:
mm/page_owner: record timestamp and pid
Subsystem: mm/pagecache
Kent Overstreet <kent.overstreet@gmail.com>:
Patch series "generic_file_buffered_read() improvements", v2:
mm/filemap/c: break generic_file_buffered_read up into multiple functions
mm/filemap.c: generic_file_buffered_read() now uses find_get_pages_contig
Alex Shi <alex.shi@linux.alibaba.com>:
mm/truncate: add parameter explanation for invalidate_mapping_pagevec
Hailong Liu <carver4lio@163.com>:
mm/filemap.c: remove else after a return
Subsystem: mm/gup
John Hubbard <jhubbard@nvidia.com>:
Patch series "selftests/vm: gup_test, hmm-tests, assorted improvements", v3:
mm/gup_benchmark: rename to mm/gup_test
selftests/vm: use a common gup_test.h
selftests/vm: rename run_vmtests --> run_vmtests.sh
selftests/vm: minor cleanup: Makefile and gup_test.c
selftests/vm: only some gup_test items are really benchmarks
selftests/vm: gup_test: introduce the dump_pages() sub-test
selftests/vm: run_vmtests.sh: update and clean up gup_test invocation
selftests/vm: hmm-tests: remove the libhugetlbfs dependency
selftests/vm: 2x speedup for run_vmtests.sh
Barry Song <song.bao.hua@hisilicon.com>:
mm/gup_test.c: mark gup_test_init as __init function
mm/gup_test: GUP_TEST depends on DEBUG_FS
Jason Gunthorpe <jgg@nvidia.com>:
Patch series "Add a seqcount between gup_fast and copy_page_range()", v4:
mm/gup: reorganize internal_get_user_pages_fast()
mm/gup: prevent gup_fast from racing with COW during fork
mm/gup: remove the vma allocation from gup_longterm_locked()
mm/gup: combine put_compound_head() and unpin_user_page()
Subsystem: mm/swap
Ralph Campbell <rcampbell@nvidia.com>:
mm: handle zone device pages in release_pages()
Miaohe Lin <linmiaohe@huawei.com>:
mm/swapfile.c: use helper function swap_count() in add_swap_count_continuation()
mm/swap_state: skip meaningless swap cache readahead when ra_info.win == 0
mm/swapfile.c: remove unnecessary out label in __swap_duplicate()
mm/swapfile.c: use memset to fill the swap_map with SWAP_HAS_CACHE
Jeff Layton <jlayton@kernel.org>:
mm: remove pagevec_lookup_range_nr_tag()
Subsystem: mm/shmem
Hui Su <sh_def@163.com>:
mm/shmem.c: make shmem_mapping() inline
Randy Dunlap <rdunlap@infradead.org>:
tmpfs: fix Documentation nits
Subsystem: mm/memcg
Johannes Weiner <hannes@cmpxchg.org>:
mm: memcontrol: add file_thp, shmem_thp to memory.stat
Muchun Song <songmuchun@bytedance.com>:
mm: memcontrol: remove unused mod_memcg_obj_state()
Miaohe Lin <linmiaohe@huawei.com>:
mm: memcontrol: eliminate redundant check in __mem_cgroup_insert_exceeded()
Muchun Song <songmuchun@bytedance.com>:
mm: memcg/slab: fix return of child memcg objcg for root memcg
mm: memcg/slab: fix use after free in obj_cgroup_charge
Shakeel Butt <shakeelb@google.com>:
mm/rmap: always do TTU_IGNORE_ACCESS
Alex Shi <alex.shi@linux.alibaba.com>:
mm/memcg: update page struct member in comments
Roman Gushchin <guro@fb.com>:
mm: memcg: fix obsolete code comments
Patch series "mm: memcg: deprecate cgroup v1 non-hierarchical mode", v1:
mm: memcg: deprecate the non-hierarchical mode
docs: cgroup-v1: reflect the deprecation of the non-hierarchical mode
cgroup: remove obsoleted broken_hierarchy and warned_broken_hierarchy
Hui Su <sh_def@163.com>:
mm/page_counter: use page_counter_read in page_counter_set_max
Lukas Bulwahn <lukas.bulwahn@gmail.com>:
mm: memcg: remove obsolete memcg_has_children()
Muchun Song <songmuchun@bytedance.com>:
mm: memcg/slab: rename *_lruvec_slab_state to *_lruvec_kmem_state
Kaixu Xia <kaixuxia@tencent.com>:
mm: memcontrol: sssign boolean values to a bool variable
Alex Shi <alex.shi@linux.alibaba.com>:
mm/memcg: remove incorrect comment
Shakeel Butt <shakeelb@google.com>:
Patch series "memcg: add pagetable comsumption to memory.stat", v2:
mm: move lruvec stats update functions to vmstat.h
mm: memcontrol: account pagetables per node
Subsystem: mm/pagemap
Dan Williams <dan.j.williams@intel.com>:
xen/unpopulated-alloc: consolidate pgmap manipulation
Kalesh Singh <kaleshsingh@google.com>:
Patch series "Speed up mremap on large regions", v4:
kselftests: vm: add mremap tests
mm: speedup mremap on 1GB or larger regions
arm64: mremap speedup - enable HAVE_MOVE_PUD
x86: mremap speedup - Enable HAVE_MOVE_PUD
John Hubbard <jhubbard@nvidia.com>:
mm: cleanup: remove unused tsk arg from __access_remote_vm
Alex Shi <alex.shi@linux.alibaba.com>:
mm/mapping_dirty_helpers: enhance the kernel-doc markups
mm/page_vma_mapped.c: add colon to fix kernel-doc markups error for check_pte
Axel Rasmussen <axelrasmussen@google.com>:
mm: mmap_lock: add tracepoints around lock acquisition
"Matthew Wilcox (Oracle)" <willy@infradead.org>:
sparc: fix handling of page table constructor failure
mm: move free_unref_page to mm/internal.h
Subsystem: mm/mremap
Dmitry Safonov <dima@arista.com>:
Patch series "mremap: move_vma() fixes":
mm/mremap: account memory on do_munmap() failure
mm/mremap: for MREMAP_DONTUNMAP check security_vm_enough_memory_mm()
mremap: don't allow MREMAP_DONTUNMAP on special_mappings and aio
vm_ops: rename .split() callback to .may_split()
mremap: check if it's possible to split original vma
mm: forbid splitting special mappings
Subsystem: mm/hmm
Daniel Vetter <daniel.vetter@ffwll.ch>:
mm: track mmu notifiers in fs_reclaim_acquire/release
mm: extract might_alloc() debug check
locking/selftests: add testcases for fs_reclaim
Subsystem: mm/vmalloc
Andrew Morton <akpm@linux-foundation.org>:
mm/vmalloc.c:__vmalloc_area_node(): avoid 32-bit overflow
"Uladzislau Rezki (Sony)" <urezki@gmail.com>:
mm/vmalloc: use free_vm_area() if an allocation fails
mm/vmalloc: rework the drain logic
Alex Shi <alex.shi@linux.alibaba.com>:
mm/vmalloc: add 'align' parameter explanation for pvm_determine_end_from_reverse
Baolin Wang <baolin.wang@linux.alibaba.com>:
mm/vmalloc.c: remove unnecessary return statement
Waiman Long <longman@redhat.com>:
mm/vmalloc: Fix unlock order in s_stop()
Subsystem: mm/documentation
Alex Shi <alex.shi@linux.alibaba.com>:
docs/vm: remove unused 3 items explanation for /proc/vmstat
Subsystem: mm/kasan
Vincenzo Frascino <vincenzo.frascino@arm.com>:
mm/vmalloc.c: fix kasan shadow poisoning size
Walter Wu <walter-zh.wu@mediatek.com>:
Patch series "kasan: add workqueue stack for generic KASAN", v5:
workqueue: kasan: record workqueue stack
kasan: print workqueue stack
lib/test_kasan.c: add workqueue test case
kasan: update documentation for generic kasan
Marco Elver <elver@google.com>:
lkdtm: disable KASAN for rodata.o
Subsystem: mm/pagealloc
Mike Rapoport <rppt@linux.ibm.com>:
Patch series "arch, mm: deprecate DISCONTIGMEM", v2:
alpha: switch from DISCONTIGMEM to SPARSEMEM
ia64: remove custom __early_pfn_to_nid()
ia64: remove 'ifdef CONFIG_ZONE_DMA32' statements
ia64: discontig: paging_init(): remove local max_pfn calculation
ia64: split virtual map initialization out of paging_init()
ia64: forbid using VIRTUAL_MEM_MAP with FLATMEM
ia64: make SPARSEMEM default and disable DISCONTIGMEM
arm: remove CONFIG_ARCH_HAS_HOLES_MEMORYMODEL
arm, arm64: move free_unused_memmap() to generic mm
arc: use FLATMEM with freeing of unused memory map instead of DISCONTIGMEM
m68k/mm: make node data and node setup depend on CONFIG_DISCONTIGMEM
m68k/mm: enable use of generic memory_model.h for !DISCONTIGMEM
m68k: deprecate DISCONTIGMEM
Patch series "arch, mm: improve robustness of direct map manipulation", v7:
mm: introduce debug_pagealloc_{map,unmap}_pages() helpers
PM: hibernate: make direct map manipulations more explicit
arch, mm: restore dependency of __kernel_map_pages() on DEBUG_PAGEALLOC
arch, mm: make kernel_page_present() always available
Vlastimil Babka <vbabka@suse.cz>:
Patch series "disable pcplists during memory offline", v3:
mm, page_alloc: clean up pageset high and batch update
mm, page_alloc: calculate pageset high and batch once per zone
mm, page_alloc: remove setup_pageset()
mm, page_alloc: simplify pageset_update()
mm, page_alloc: cache pageset high and batch in struct zone
mm, page_alloc: move draining pcplists to page isolation users
mm, page_alloc: disable pcplists during memory offline
Miaohe Lin <linmiaohe@huawei.com>:
include/linux/page-flags.h: remove unused __[Set|Clear]PagePrivate
"Matthew Wilcox (Oracle)" <willy@infradead.org>:
mm/page-flags: fix comment
mm/page_alloc: add __free_pages() documentation
Zou Wei <zou_wei@huawei.com>:
mm/page_alloc: mark some symbols with static keyword
David Hildenbrand <david@redhat.com>:
mm/page_alloc: clear all pages in post_alloc_hook() with init_on_alloc=1
Lin Feng <linf@wangsu.com>:
init/main: fix broken buffer_init when DEFERRED_STRUCT_PAGE_INIT set
Lorenzo Stoakes <lstoakes@gmail.com>:
mm: page_alloc: refactor setup_per_zone_lowmem_reserve()
Muchun Song <songmuchun@bytedance.com>:
mm/page_alloc: speed up the iteration of max_order
Subsystem: mm/memory-failure
Oscar Salvador <osalvador@suse.de>:
Patch series "HWpoison: further fixes and cleanups", v5:
mm,hwpoison: drain pcplists before bailing out for non-buddy zero-refcount page
mm,hwpoison: take free pages off the buddy freelists
mm,hwpoison: drop unneeded pcplist draining
Patch series "HWPoison: Refactor get page interface", v2:
mm,hwpoison: refactor get_any_page
mm,hwpoison: disable pcplists before grabbing a refcount
mm,hwpoison: remove drain_all_pages from shake_page
mm,memory_failure: always pin the page in madvise_inject_error
mm,hwpoison: return -EBUSY when migration fails
Subsystem: mm/hugetlb
Hui Su <sh_def@163.com>:
mm/hugetlb.c: just use put_page_testzero() instead of page_count()
Ralph Campbell <rcampbell@nvidia.com>:
include/linux/huge_mm.h: remove extern keyword
Alex Shi <alex.shi@linux.alibaba.com>:
khugepaged: add parameter explanations for kernel-doc markup
Liu Xiang <liu.xiang@zlingsmart.com>:
mm: hugetlb: fix type of delta parameter and related local variables in gather_surplus_pages()
Oscar Salvador <osalvador@suse.de>:
mm,hugetlb: remove unneeded initialization
Dan Carpenter <dan.carpenter@oracle.com>:
hugetlb: fix an error code in hugetlb_reserve_pages()
Subsystem: mm/vmscan
Johannes Weiner <hannes@cmpxchg.org>:
mm: don't wake kswapd prematurely when watermark boosting is disabled
Lukas Bulwahn <lukas.bulwahn@gmail.com>:
mm/vmscan: drop unneeded assignment in kswapd()
"logic.yu" <hymmsx.yu@gmail.com>:
mm/vmscan.c: remove the filename in the top of file comment
Muchun Song <songmuchun@bytedance.com>:
mm/page_isolation: do not isolate the max order page
Subsystem: mm/z3fold
Vitaly Wool <vitaly.wool@konsulko.com>:
Patch series "z3fold: stability / rt fixes":
z3fold: simplify freeing slots
z3fold: stricter locking and more careful reclaim
z3fold: remove preempt disabled sections for RT
Subsystem: mm/compaction
Yanfei Xu <yanfei.xu@windriver.com>:
mm/compaction: rename 'start_pfn' to 'iteration_start_pfn' in compact_zone()
Hui Su <sh_def@163.com>:
mm/compaction: move compaction_suitable's comment to right place
mm/compaction: make defer_compaction and compaction_deferred static
Subsystem: mm/oom-kill
Hui Su <sh_def@163.com>:
mm/oom_kill: change comment and rename is_dump_unreclaim_slabs()
Subsystem: mm/migration
Long Li <lonuxli.64@gmail.com>:
mm/migrate.c: fix comment spelling
Ralph Campbell <rcampbell@nvidia.com>:
mm/migrate.c: optimize migrate_vma_pages() mmu notifier
"Matthew Wilcox (Oracle)" <willy@infradead.org>:
mm: support THPs in zero_user_segments
Yang Shi <shy828301@gmail.com>:
Patch series "mm: misc migrate cleanup and improvement", v3:
mm: truncate_complete_page() does not exist any more
mm: migrate: simplify the logic for handling permanent failure
mm: migrate: skip shared exec THP for NUMA balancing
mm: migrate: clean up migrate_prep{_local}
mm: migrate: return -ENOSYS if THP migration is unsupported
Stephen Zhang <starzhangzsd@gmail.com>:
mm: migrate: remove unused parameter in migrate_vma_insert_page()
Subsystem: mm/cma
Lecopzer Chen <lecopzer.chen@mediatek.com>:
mm/cma.c: remove redundant cma_mutex lock
Charan Teja Reddy <charante@codeaurora.org>:
mm: cma: improve pr_debug log in cma_release()
Subsystem: mm/page-poison
Vlastimil Babka <vbabka@suse.cz>:
Patch series "cleanup page poisoning", v3:
mm, page_alloc: do not rely on the order of page_poison and init_on_alloc/free parameters
mm, page_poison: use static key more efficiently
kernel/power: allow hibernation with page_poison sanity checking
mm, page_poison: remove CONFIG_PAGE_POISONING_NO_SANITY
mm, page_poison: remove CONFIG_PAGE_POISONING_ZERO
Subsystem: mm/userfaultfd
Lokesh Gidra <lokeshgidra@google.com>:
Patch series "Control over userfaultfd kernel-fault handling", v6:
userfaultfd: add UFFD_USER_MODE_ONLY
userfaultfd: add user-mode only option to unprivileged_userfaultfd sysctl knob
Axel Rasmussen <axelrasmussen@google.com>:
userfaultfd: selftests: make __{s,u}64 format specifiers portable
Peter Xu <peterx@redhat.com>:
Patch series "userfaultfd: selftests: Small fixes":
userfaultfd/selftests: always dump something in modes
userfaultfd/selftests: fix retval check for userfaultfd_open()
userfaultfd/selftests: hint the test runner on required privilege
Subsystem: mm/zswap
Joe Perches <joe@perches.com>:
mm/zswap: make struct kernel_param_ops definitions const
YueHaibing <yuehaibing@huawei.com>:
mm/zswap: fix passing zero to 'PTR_ERR' warning
Barry Song <song.bao.hua@hisilicon.com>:
mm/zswap: move to use crypto_acomp API for hardware acceleration
Subsystem: mm/zsmalloc
Miaohe Lin <linmiaohe@huawei.com>:
mm/zsmalloc.c: rework the list_add code in insert_zspage()
Subsystem: mm/uaccess
Colin Ian King <colin.king@canonical.com>:
mm/process_vm_access: remove redundant initialization of iov_r
Subsystem: mm/zram
Minchan Kim <minchan@kernel.org>:
zram: support page writeback
zram: add stat to gather incompressible pages since zram set up
Rui Salvaterra <rsalvaterra@gmail.com>:
zram: break the strict dependency from lzo
Subsystem: mm/cleanups
Mauro Carvalho Chehab <mchehab+huawei@kernel.org>:
mm: fix kernel-doc markups
Joe Perches <joe@perches.com>:
Patch series "mm: Convert sysfs sprintf family to sysfs_emit", v2:
mm: use sysfs_emit for struct kobject * uses
mm: huge_memory: convert remaining use of sprintf to sysfs_emit and neatening
mm:backing-dev: use sysfs_emit in macro defining functions
mm: shmem: convert shmem_enabled_show to use sysfs_emit_at
mm: slub: convert sysfs sprintf family to sysfs_emit/sysfs_emit_at
"Gustavo A. R. Silva" <gustavoars@kernel.org>:
mm: fix fall-through warnings for Clang
Alexey Dobriyan <adobriyan@gmail.com>:
mm: cleanup kstrto*() usage
/mmap_lock.h | 107 ++
a/Documentation/admin-guide/blockdev/zram.rst | 6
a/Documentation/admin-guide/cgroup-v1/memcg_test.rst | 8
a/Documentation/admin-guide/cgroup-v1/memory.rst | 42
a/Documentation/admin-guide/cgroup-v2.rst | 11
a/Documentation/admin-guide/mm/transhuge.rst | 15
a/Documentation/admin-guide/sysctl/vm.rst | 15
a/Documentation/core-api/memory-allocation.rst | 4
a/Documentation/core-api/pin_user_pages.rst | 8
a/Documentation/dev-tools/kasan.rst | 5
a/Documentation/filesystems/tmpfs.rst | 8
a/Documentation/vm/memory-model.rst | 3
a/Documentation/vm/page_owner.rst | 12
a/arch/Kconfig | 21
a/arch/alpha/Kconfig | 8
a/arch/alpha/include/asm/mmzone.h | 14
a/arch/alpha/include/asm/page.h | 7
a/arch/alpha/include/asm/pgtable.h | 12
a/arch/alpha/include/asm/sparsemem.h | 18
a/arch/alpha/kernel/setup.c | 1
a/arch/arc/Kconfig | 3
a/arch/arc/include/asm/page.h | 20
a/arch/arc/mm/init.c | 29
a/arch/arm/Kconfig | 12
a/arch/arm/kernel/vdso.c | 9
a/arch/arm/mach-bcm/Kconfig | 1
a/arch/arm/mach-davinci/Kconfig | 1
a/arch/arm/mach-exynos/Kconfig | 1
a/arch/arm/mach-highbank/Kconfig | 1
a/arch/arm/mach-omap2/Kconfig | 1
a/arch/arm/mach-s5pv210/Kconfig | 1
a/arch/arm/mach-tango/Kconfig | 1
a/arch/arm/mm/init.c | 78 -
a/arch/arm64/Kconfig | 9
a/arch/arm64/include/asm/cacheflush.h | 1
a/arch/arm64/include/asm/pgtable.h | 1
a/arch/arm64/kernel/vdso.c | 41
a/arch/arm64/mm/init.c | 68 -
a/arch/arm64/mm/pageattr.c | 12
a/arch/ia64/Kconfig | 11
a/arch/ia64/include/asm/meminit.h | 2
a/arch/ia64/mm/contig.c | 88 --
a/arch/ia64/mm/discontig.c | 44 -
a/arch/ia64/mm/init.c | 14
a/arch/ia64/mm/numa.c | 30
a/arch/m68k/Kconfig.cpu | 31
a/arch/m68k/include/asm/page.h | 2
a/arch/m68k/include/asm/page_mm.h | 7
a/arch/m68k/include/asm/virtconvert.h | 7
a/arch/m68k/mm/init.c | 10
a/arch/mips/vdso/genvdso.c | 4
a/arch/nds32/mm/mm-nds32.c | 6
a/arch/powerpc/Kconfig | 5
a/arch/riscv/Kconfig | 4
a/arch/riscv/include/asm/pgtable.h | 2
a/arch/riscv/include/asm/set_memory.h | 1
a/arch/riscv/mm/pageattr.c | 31
a/arch/s390/Kconfig | 4
a/arch/s390/configs/debug_defconfig | 2
a/arch/s390/configs/defconfig | 2
a/arch/s390/kernel/vdso.c | 11
a/arch/sparc/Kconfig | 4
a/arch/sparc/mm/init_64.c | 2
a/arch/x86/Kconfig | 5
a/arch/x86/entry/vdso/vma.c | 17
a/arch/x86/include/asm/set_memory.h | 1
a/arch/x86/kernel/cpu/resctrl/pseudo_lock.c | 2
a/arch/x86/kernel/tboot.c | 1
a/arch/x86/mm/pat/set_memory.c | 6
a/drivers/base/node.c | 2
a/drivers/block/zram/Kconfig | 42
a/drivers/block/zram/zcomp.c | 2
a/drivers/block/zram/zram_drv.c | 29
a/drivers/block/zram/zram_drv.h | 1
a/drivers/dax/device.c | 4
a/drivers/dax/kmem.c | 2
a/drivers/dma-buf/sync_file.c | 3
a/drivers/edac/ghes_edac.c | 4
a/drivers/firmware/efi/efi.c | 1
a/drivers/gpu/drm/drm_atomic.c | 3
a/drivers/hwtracing/intel_th/msu.c | 2
a/drivers/ide/falconide.c | 2
a/drivers/ide/ide-probe.c | 3
a/drivers/misc/lkdtm/Makefile | 1
a/drivers/pinctrl/pinctrl-utils.c | 2
a/drivers/vhost/vringh.c | 3
a/drivers/virtio/virtio_balloon.c | 6
a/drivers/xen/unpopulated-alloc.c | 14
a/fs/aio.c | 5
a/fs/ntfs/file.c | 5
a/fs/ntfs/inode.c | 2
a/fs/ntfs/logfile.c | 3
a/fs/ocfs2/cluster/tcp.c | 1
a/fs/ocfs2/namei.c | 4
a/fs/proc/kcore.c | 2
a/fs/proc/meminfo.c | 2
a/fs/userfaultfd.c | 20
a/include/linux/cgroup-defs.h | 15
a/include/linux/compaction.h | 12
a/include/linux/fs.h | 2
a/include/linux/gfp.h | 2
a/include/linux/highmem.h | 19
a/include/linux/huge_mm.h | 93 --
a/include/linux/memcontrol.h | 148 ---
a/include/linux/migrate.h | 4
a/include/linux/mm.h | 118 +-
a/include/linux/mm_types.h | 8
a/include/linux/mmap_lock.h | 94 ++
a/include/linux/mmzone.h | 50 -
a/include/linux/page-flags.h | 6
a/include/linux/page_ext.h | 8
a/include/linux/pagevec.h | 3
a/include/linux/poison.h | 4
a/include/linux/rmap.h | 1
a/include/linux/sched/mm.h | 16
a/include/linux/set_memory.h | 5
a/include/linux/shmem_fs.h | 6
a/include/linux/slab.h | 18
a/include/linux/vmalloc.h | 8
a/include/linux/vmstat.h | 104 ++
a/include/trace/events/sched.h | 84 +
a/include/uapi/linux/const.h | 5
a/include/uapi/linux/ethtool.h | 2
a/include/uapi/linux/kernel.h | 9
a/include/uapi/linux/lightnvm.h | 2
a/include/uapi/linux/mroute6.h | 2
a/include/uapi/linux/netfilter/x_tables.h | 2
a/include/uapi/linux/netlink.h | 2
a/include/uapi/linux/sysctl.h | 2
a/include/uapi/linux/userfaultfd.h | 9
a/init/main.c | 6
a/ipc/shm.c | 8
a/kernel/cgroup/cgroup.c | 12
a/kernel/fork.c | 3
a/kernel/kthread.c | 29
a/kernel/power/hibernate.c | 2
a/kernel/power/power.h | 2
a/kernel/power/snapshot.c | 52 +
a/kernel/ptrace.c | 2
a/kernel/workqueue.c | 3
a/lib/locking-selftest.c | 47 +
a/lib/test_kasan_module.c | 29
a/mm/Kconfig | 25
a/mm/Kconfig.debug | 28
a/mm/Makefile | 4
a/mm/backing-dev.c | 8
a/mm/cma.c | 6
a/mm/compaction.c | 29
a/mm/filemap.c | 823 ++++++++++---------
a/mm/gup.c | 329 ++-----
a/mm/gup_benchmark.c | 210 ----
a/mm/gup_test.c | 299 ++++++
a/mm/gup_test.h | 40
a/mm/highmem.c | 52 +
a/mm/huge_memory.c | 86 +
a/mm/hugetlb.c | 28
a/mm/init-mm.c | 1
a/mm/internal.h | 5
a/mm/kasan/generic.c | 3
a/mm/kasan/report.c | 4
a/mm/khugepaged.c | 58 -
a/mm/ksm.c | 50 -
a/mm/madvise.c | 14
a/mm/mapping_dirty_helpers.c | 6
a/mm/memblock.c | 80 +
a/mm/memcontrol.c | 170 +--
a/mm/memory-failure.c | 322 +++----
a/mm/memory.c | 24
a/mm/memory_hotplug.c | 44 -
a/mm/mempolicy.c | 8
a/mm/migrate.c | 183 ++--
a/mm/mm_init.c | 1
a/mm/mmap.c | 22
a/mm/mmap_lock.c | 230 +++++
a/mm/mmu_notifier.c | 7
a/mm/mmzone.c | 14
a/mm/mremap.c | 282 ++++--
a/mm/nommu.c | 8
a/mm/oom_kill.c | 14
a/mm/page_alloc.c | 517 ++++++-----
a/mm/page_counter.c | 4
a/mm/page_ext.c | 10
a/mm/page_isolation.c | 18
a/mm/page_owner.c | 17
a/mm/page_poison.c | 56 -
a/mm/page_vma_mapped.c | 9
a/mm/process_vm_access.c | 2
a/mm/rmap.c | 9
a/mm/shmem.c | 39
a/mm/slab.c | 10
a/mm/slab.h | 9
a/mm/slab_common.c | 10
a/mm/slob.c | 6
a/mm/slub.c | 156 +--
a/mm/swap.c | 12
a/mm/swap_state.c | 7
a/mm/swapfile.c | 14
a/mm/truncate.c | 18
a/mm/vmalloc.c | 105 +-
a/mm/vmscan.c | 21
a/mm/vmstat.c | 6
a/mm/workingset.c | 8
a/mm/z3fold.c | 215 ++--
a/mm/zsmalloc.c | 11
a/mm/zswap.c | 193 +++-
a/sound/core/pcm_lib.c | 4
a/tools/include/linux/poison.h | 6
a/tools/testing/selftests/vm/.gitignore | 4
a/tools/testing/selftests/vm/Makefile | 41
a/tools/testing/selftests/vm/check_config.sh | 31
a/tools/testing/selftests/vm/config | 2
a/tools/testing/selftests/vm/gup_benchmark.c | 143 ---
a/tools/testing/selftests/vm/gup_test.c | 258 +++++
a/tools/testing/selftests/vm/hmm-tests.c | 10
a/tools/testing/selftests/vm/mremap_test.c | 344 +++++++
a/tools/testing/selftests/vm/run_vmtests | 51 -
a/tools/testing/selftests/vm/userfaultfd.c | 94 --
217 files changed, 4817 insertions(+), 3369 deletions(-)
^ permalink raw reply [flat|nested] 232+ messages in thread
* Re: incoming
2020-12-15 3:02 incoming Andrew Morton
@ 2020-12-15 3:25 ` Linus Torvalds
2020-12-15 3:30 ` incoming Linus Torvalds
0 siblings, 1 reply; 232+ messages in thread
From: Linus Torvalds @ 2020-12-15 3:25 UTC (permalink / raw)
To: Andrew Morton, Konstantin Ryabitsev; +Cc: mm-commits, Linux-MM
On Mon, Dec 14, 2020 at 7:02 PM Andrew Morton <akpm@linux-foundation.org> wrote:
>
> 200 patches, based on 2c85ebc57b3e1817b6ce1a6b703928e113a90442.
I haven't actually processed the patches yet, but I have a question
for Konstantin wrt b4.
All the patches except for _one_ get a nice little green check-mark
next to them when I use 'git am' on this series.
The one that did not was [patch 192/200].
I have no idea why - and it doesn't matter a lot to me, it just stood
out as being different. I'm assuming Andrew has started doing patch
attestation, and that patch failed. But if so, maybe Konstantin wants
to know what went wrong.
Konstantin?
Linus
^ permalink raw reply [flat|nested] 232+ messages in thread
* Re: incoming
2020-12-15 3:25 ` incoming Linus Torvalds
@ 2020-12-15 3:30 ` Linus Torvalds
2020-12-15 14:04 ` incoming Konstantin Ryabitsev
0 siblings, 1 reply; 232+ messages in thread
From: Linus Torvalds @ 2020-12-15 3:30 UTC (permalink / raw)
To: Andrew Morton, Konstantin Ryabitsev; +Cc: mm-commits, Linux-MM
On Mon, Dec 14, 2020 at 7:25 PM Linus Torvalds
<torvalds@linux-foundation.org> wrote:
>
> All the patches except for _one_ get a nice little green check-mark
> next to them when I use 'git am' on this series.
>
> The one that did not was [patch 192/200].
>
> I have no idea why
Hmm. It looks like that patch is the only one in the series with the
">From" marker in the commit message, from the silly "clarify that
this isn't the first line in a new message in mbox format".
And "b4 am" has turned the single ">" into two, making the stupid
marker worse, and actually corrupting the end result.
Coincidence? Or cause?
Linus
^ permalink raw reply [flat|nested] 232+ messages in thread
* Re: incoming
2020-12-15 3:30 ` incoming Linus Torvalds
@ 2020-12-15 14:04 ` Konstantin Ryabitsev
0 siblings, 0 replies; 232+ messages in thread
From: Konstantin Ryabitsev @ 2020-12-15 14:04 UTC (permalink / raw)
To: Linus Torvalds; +Cc: Andrew Morton, mm-commits, Linux-MM
On Mon, Dec 14, 2020 at 07:30:54PM -0800, Linus Torvalds wrote:
> > All the patches except for _one_ get a nice little green check-mark
> > next to them when I use 'git am' on this series.
> >
> > The one that did not was [patch 192/200].
> >
> > I have no idea why
>
> Hmm. It looks like that patch is the only one in the series with the
> ">From" marker in the commit message, from the silly "clarify that
> this isn't the first line in a new message in mbox format".
>
> And "b4 am" has turned the single ">" into two, making the stupid
> marker worse, and actually corrupting the end result.
It's a bug in b4 that I overlooked. Public-inbox emits mboxrd-formatted
.mbox files, while Python's mailbox.mbox consumes mboxo only. The main
distinction between the two is precisely that mboxrd will convert
">From " into ">>From " in an attempt to avoid corruption during
escape/unescape (it didn't end up fixing the problem 100% and mostly
introduced incompatibilities like this one).
I have a fix in master/stable-0.6.y and I'll release a 0.6.2 before the
end of the week.
Thanks for the report.
-K
^ permalink raw reply [flat|nested] 232+ messages in thread
* incoming
@ 2020-12-15 20:32 Andrew Morton
2020-12-15 21:00 ` incoming Linus Torvalds
2020-12-15 22:48 ` incoming Linus Torvalds
0 siblings, 2 replies; 232+ messages in thread
From: Andrew Morton @ 2020-12-15 20:32 UTC (permalink / raw)
To: Linus Torvalds; +Cc: linux-mm, mm-commits
- more MM work: a memcg scalability improvememt
19 patches, based on 148842c98a24e508aecb929718818fbf4c2a6ff3.
Subsystems affected by this patch series:
Alex Shi <alex.shi@linux.alibaba.com>:
Patch series "per memcg lru lock", v21:
mm/thp: move lru_add_page_tail() to huge_memory.c
mm/thp: use head for head page in lru_add_page_tail()
mm/thp: simplify lru_add_page_tail()
mm/thp: narrow lru locking
mm/vmscan: remove unnecessary lruvec adding
mm/rmap: stop store reordering issue on page->mapping
Hugh Dickins <hughd@google.com>:
mm: page_idle_get_page() does not need lru_lock
Alex Shi <alex.shi@linux.alibaba.com>:
mm/memcg: add debug checking in lock_page_memcg
mm/swap.c: fold vm event PGROTATED into pagevec_move_tail_fn
mm/lru: move lock into lru_note_cost
mm/vmscan: remove lruvec reget in move_pages_to_lru
mm/mlock: remove lru_lock on TestClearPageMlocked
mm/mlock: remove __munlock_isolate_lru_page()
mm/lru: introduce TestClearPageLRU()
mm/compaction: do page isolation first in compaction
mm/swap.c: serialize memcg changes in pagevec_lru_move_fn
mm/lru: replace pgdat lru_lock with lruvec lock
Alexander Duyck <alexander.h.duyck@linux.intel.com>:
mm/lru: introduce relock_page_lruvec()
Hugh Dickins <hughd@google.com>:
mm/lru: revise the comments of lru_lock
Documentation/admin-guide/cgroup-v1/memcg_test.rst | 15 -
Documentation/admin-guide/cgroup-v1/memory.rst | 23 -
Documentation/trace/events-kmem.rst | 2
Documentation/vm/unevictable-lru.rst | 22 -
include/linux/memcontrol.h | 110 +++++++
include/linux/mm_types.h | 2
include/linux/mmzone.h | 6
include/linux/page-flags.h | 1
include/linux/swap.h | 4
mm/compaction.c | 98 ++++---
mm/filemap.c | 4
mm/huge_memory.c | 109 ++++---
mm/memcontrol.c | 84 +++++-
mm/mlock.c | 93 ++----
mm/mmzone.c | 1
mm/page_alloc.c | 1
mm/page_idle.c | 4
mm/rmap.c | 12
mm/swap.c | 292 ++++++++-------------
mm/vmscan.c | 239 ++++++++---------
mm/workingset.c | 2
21 files changed, 644 insertions(+), 480 deletions(-)
^ permalink raw reply [flat|nested] 232+ messages in thread
* Re: incoming
2020-12-15 20:32 incoming Andrew Morton
@ 2020-12-15 21:00 ` Linus Torvalds
2020-12-15 22:48 ` incoming Linus Torvalds
1 sibling, 0 replies; 232+ messages in thread
From: Linus Torvalds @ 2020-12-15 21:00 UTC (permalink / raw)
To: Andrew Morton; +Cc: Linux-MM, mm-commits
On Tue, Dec 15, 2020 at 12:32 PM Andrew Morton
<akpm@linux-foundation.org> wrote:
>
> - more MM work: a memcg scalability improvememt
>
> 19 patches, based on 148842c98a24e508aecb929718818fbf4c2a6ff3.
I'm not seeing patch 10/19 at all.
And patch 19/19 is corrupted and has an attachment with a '^P'
character in it. I could fix it up, but with the missing patch in the
middle I'm not going to even try. 'b4' is also very unhappy about that
patch 19/19.
I don't know what went wrong, but I'll ignore this send - please
re-send the series at your leisure, ok?
Linus
^ permalink raw reply [flat|nested] 232+ messages in thread
* Re: incoming
2020-12-15 20:32 incoming Andrew Morton
2020-12-15 21:00 ` incoming Linus Torvalds
@ 2020-12-15 22:48 ` Linus Torvalds
2020-12-15 22:49 ` incoming Linus Torvalds
1 sibling, 1 reply; 232+ messages in thread
From: Linus Torvalds @ 2020-12-15 22:48 UTC (permalink / raw)
To: Andrew Morton; +Cc: Linux-MM, mm-commits
On Tue, Dec 15, 2020 at 12:32 PM Andrew Morton
<akpm@linux-foundation.org> wrote:
>
> - more MM work: a memcg scalability improvememt
>
> 19 patches, based on 148842c98a24e508aecb929718818fbf4c2a6ff3.
With your re-send, I get all patches, but they don't actually apply cleanly.
Is that base correct?
I get
error: patch failed: mm/huge_memory.c:2750
error: mm/huge_memory.c: patch does not apply
Patch failed at 0004 mm/thp: narrow lru locking
for that patch "[patch 04/19] mm/thp: narrow lru locking", and that's
definitely true: the patch fragment has
@@ -2750,7 +2751,7 @@ int split_huge_page_to_list(struct page
__dec_lruvec_page_state(head, NR_FILE_THPS);
}
- __split_huge_page(page, list, end, flags);
+ __split_huge_page(page, list, end);
ret = 0;
} else {
if (IS_ENABLED(CONFIG_DEBUG_VM) && mapcount) {
but that __dec_lruvec_page_state() conversion was done by your
previous commit series.
So I have the feeling that what you actually mean by "base" isn't
actually really the base for that series at all..
I will try to apply it on top of my merge of your previous series instead.
Linus
^ permalink raw reply [flat|nested] 232+ messages in thread
* Re: incoming
2020-12-15 22:48 ` incoming Linus Torvalds
@ 2020-12-15 22:49 ` Linus Torvalds
2020-12-15 22:55 ` incoming Andrew Morton
0 siblings, 1 reply; 232+ messages in thread
From: Linus Torvalds @ 2020-12-15 22:49 UTC (permalink / raw)
To: Andrew Morton; +Cc: Linux-MM, mm-commits
On Tue, Dec 15, 2020 at 2:48 PM Linus Torvalds
<torvalds@linux-foundation.org> wrote:
>
> I will try to apply it on top of my merge of your previous series instead.
Yes, then it applies cleanly. So apparently we just have different
concepts of what really constitutes a "base" for applying your series.
Linus
^ permalink raw reply [flat|nested] 232+ messages in thread
* Re: incoming
2020-12-15 22:49 ` incoming Linus Torvalds
@ 2020-12-15 22:55 ` Andrew Morton
0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2020-12-15 22:55 UTC (permalink / raw)
To: Linus Torvalds; +Cc: Linux-MM, mm-commits
On Tue, 15 Dec 2020 14:49:24 -0800 Linus Torvalds <torvalds@linux-foundation.org> wrote:
> On Tue, Dec 15, 2020 at 2:48 PM Linus Torvalds
> <torvalds@linux-foundation.org> wrote:
> >
> > I will try to apply it on top of my merge of your previous series instead.
>
> Yes, then it applies cleanly. So apparently we just have different
> concepts of what really constitutes a "base" for applying your series.
>
oop, sorry, yes, the "based on" thing was wrong because I had two
series in flight simultaneously. I've never tried that before..
^ permalink raw reply [flat|nested] 232+ messages in thread
* incoming
@ 2020-12-16 4:41 Andrew Morton
0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2020-12-16 4:41 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm
- lots of little subsystems
- a few post-linux-next MM material. Most of this awaits more merging
of other trees.
95 patches, based on 489e9fea66f31086f85d9a18e61e4791d94a56a4.
Subsystems affected by this patch series:
mm/swap
mm/memory-hotplug
alpha
procfs
misc
core-kernel
bitmap
lib
lz4
bitops
checkpatch
nilfs
kdump
rapidio
gcov
bfs
relay
resource
ubsan
reboot
fault-injection
lzo
apparmor
mm/pagemap
mm/cleanups
mm/gup
Subsystem: mm/swap
Zhaoyang Huang <huangzhaoyang@gmail.com>:
mm: fix a race on nr_swap_pages
Subsystem: mm/memory-hotplug
Laurent Dufour <ldufour@linux.ibm.com>:
mm/memory_hotplug: quieting offline operation
Subsystem: alpha
Thomas Gleixner <tglx@linutronix.de>:
alpha: replace bogus in_interrupt()
Subsystem: procfs
Randy Dunlap <rdunlap@infradead.org>:
procfs: delete duplicated words + other fixes
Anand K Mistry <amistry@google.com>:
proc: provide details on indirect branch speculation
Alexey Dobriyan <adobriyan@gmail.com>:
proc: fix lookup in /proc/net subdirectories after setns(2)
Hui Su <sh_def@163.com>:
fs/proc: make pde_get() return nothing
Subsystem: misc
Christophe Leroy <christophe.leroy@csgroup.eu>:
asm-generic: force inlining of get_order() to work around gcc10 poor decision
Andy Shevchenko <andriy.shevchenko@linux.intel.com>:
kernel.h: split out mathematical helpers
Subsystem: core-kernel
Hui Su <sh_def@163.com>:
kernel/acct.c: use #elif instead of #end and #elif
Subsystem: bitmap
Andy Shevchenko <andriy.shevchenko@linux.intel.com>:
include/linux/bitmap.h: convert bitmap_empty() / bitmap_full() to return boolean
"Ma, Jianpeng" <jianpeng.ma@intel.com>:
bitmap: remove unused function declaration
Subsystem: lib
Geert Uytterhoeven <geert@linux-m68k.org>:
lib/test_free_pages.c: add basic progress indicators
"Gustavo A. R. Silva" <gustavoars@kernel.org>:
Patch series "] lib/stackdepot.c: Replace one-element array with flexible-array member":
lib/stackdepot.c: replace one-element array with flexible-array member
lib/stackdepot.c: use flex_array_size() helper in memcpy()
lib/stackdepot.c: use array_size() helper in jhash2()
Sebastian Andrzej Siewior <bigeasy@linutronix.de>:
lib/test_lockup.c: minimum fix to get it compiled on PREEMPT_RT
Andy Shevchenko <andriy.shevchenko@linux.intel.com>:
lib/list_kunit: follow new file name convention for KUnit tests
lib/linear_ranges_kunit: follow new file name convention for KUnit tests
lib/bits_kunit: follow new file name convention for KUnit tests
lib/cmdline: fix get_option() for strings starting with hyphen
lib/cmdline: allow NULL to be an output for get_option()
lib/cmdline_kunit: add a new test suite for cmdline API
Jakub Jelinek <jakub@redhat.com>:
ilog2: improve ilog2 for constant arguments
Nick Desaulniers <ndesaulniers@google.com>:
lib/string: remove unnecessary #undefs
Daniel Axtens <dja@axtens.net>:
Patch series "Fortify strscpy()", v7:
lib: string.h: detect intra-object overflow in fortified string functions
lkdtm: tests for FORTIFY_SOURCE
Francis Laniel <laniel_francis@privacyrequired.com>:
string.h: add FORTIFY coverage for strscpy()
drivers/misc/lkdtm: add new file in LKDTM to test fortified strscpy
drivers/misc/lkdtm/lkdtm.h: correct wrong filenames in comment
Alexey Dobriyan <adobriyan@gmail.com>:
lib: cleanup kstrto*() usage
Subsystem: lz4
Gao Xiang <hsiangkao@redhat.com>:
lib/lz4: explicitly support in-place decompression
Subsystem: bitops
Syed Nayyar Waris <syednwaris@gmail.com>:
Patch series "Introduce the for_each_set_clump macro", v12:
bitops: introduce the for_each_set_clump macro
lib/test_bitmap.c: add for_each_set_clump test cases
gpio: thunderx: utilize for_each_set_clump macro
gpio: xilinx: utilize generic bitmap_get_value and _set_value
Subsystem: checkpatch
Dwaipayan Ray <dwaipayanray1@gmail.com>:
checkpatch: add new exception to repeated word check
Aditya Srivastava <yashsri421@gmail.com>:
checkpatch: fix false positives in REPEATED_WORD warning
Łukasz Stelmach <l.stelmach@samsung.com>:
checkpatch: ignore generated CamelCase defines and enum values
Joe Perches <joe@perches.com>:
checkpatch: prefer static const declarations
checkpatch: allow --fix removal of unnecessary break statements
Dwaipayan Ray <dwaipayanray1@gmail.com>:
checkpatch: extend attributes check to handle more patterns
Tom Rix <trix@redhat.com>:
checkpatch: add a fixer for missing newline at eof
Joe Perches <joe@perches.com>:
checkpatch: update __attribute__((section("name"))) quote removal
Aditya Srivastava <yashsri421@gmail.com>:
checkpatch: add fix option for GERRIT_CHANGE_ID
Joe Perches <joe@perches.com>:
checkpatch: add __alias and __weak to suggested __attribute__ conversions
Dwaipayan Ray <dwaipayanray1@gmail.com>:
checkpatch: improve email parsing
checkpatch: fix spelling errors and remove repeated word
Aditya Srivastava <yashsri421@gmail.com>:
checkpatch: avoid COMMIT_LOG_LONG_LINE warning for signature tags
Dwaipayan Ray <dwaipayanray1@gmail.com>:
checkpatch: fix unescaped left brace
Aditya Srivastava <yashsri421@gmail.com>:
checkpatch: add fix option for ASSIGNMENT_CONTINUATIONS
checkpatch: add fix option for LOGICAL_CONTINUATIONS
checkpatch: add fix and improve warning msg for non-standard signature
Dwaipayan Ray <dwaipayanray1@gmail.com>:
checkpatch: add warning for unnecessary use of %h[xudi] and %hh[xudi]
checkpatch: add warning for lines starting with a '#' in commit log
checkpatch: fix TYPO_SPELLING check for words with apostrophe
Joe Perches <joe@perches.com>:
checkpatch: add printk_once and printk_ratelimit to prefer pr_<level> warning
Subsystem: nilfs
Alex Shi <alex.shi@linux.alibaba.com>:
fs/nilfs2: remove some unused macros to tame gcc
Subsystem: kdump
Alexander Egorenkov <egorenar@linux.ibm.com>:
kdump: append uts_namespace.name offset to VMCOREINFO
Subsystem: rapidio
Sebastian Andrzej Siewior <bigeasy@linutronix.de>:
rapidio: remove unused rio_get_asm() and rio_get_device()
Subsystem: gcov
Nick Desaulniers <ndesaulniers@google.com>:
gcov: remove support for GCC < 4.9
Alex Shi <alex.shi@linux.alibaba.com>:
gcov: fix kernel-doc markup issue
Subsystem: bfs
Randy Dunlap <rdunlap@infradead.org>:
bfs: don't use WARNING: string when it's just info.
Subsystem: relay
Jani Nikula <jani.nikula@intel.com>:
Patch series "relay: cleanup and const callbacks", v2:
relay: remove unused buf_mapped and buf_unmapped callbacks
relay: require non-NULL callbacks in relay_open()
relay: make create_buf_file and remove_buf_file callbacks mandatory
relay: allow the use of const callback structs
drm/i915: make relay callbacks const
ath10k: make relay callbacks const
ath11k: make relay callbacks const
ath9k: make relay callbacks const
blktrace: make relay callbacks const
Subsystem: resource
Mauro Carvalho Chehab <mchehab+huawei@kernel.org>:
kernel/resource.c: fix kernel-doc markups
Subsystem: ubsan
Kees Cook <keescook@chromium.org>:
Patch series "Clean up UBSAN Makefile", v2:
ubsan: remove redundant -Wno-maybe-uninitialized
ubsan: move cc-option tests into Kconfig
ubsan: disable object-size sanitizer under GCC
ubsan: disable UBSAN_TRAP for all*config
ubsan: enable for all*config builds
ubsan: remove UBSAN_MISC in favor of individual options
ubsan: expand tests and reporting
Dmitry Vyukov <dvyukov@google.com>:
kcov: don't instrument with UBSAN
Zou Wei <zou_wei@huawei.com>:
lib/ubsan.c: mark type_check_kinds with static keyword
Subsystem: reboot
Matteo Croce <mcroce@microsoft.com>:
reboot: refactor and comment the cpu selection code
reboot: allow to specify reboot mode via sysfs
reboot: remove cf9_safe from allowed types and rename cf9_force
Patch series "reboot: sysfs improvements":
reboot: allow to override reboot type if quirks are found
reboot: hide from sysfs not applicable settings
Subsystem: fault-injection
Barnabás Pőcze <pobrn@protonmail.com>:
fault-injection: handle EI_ETYPE_TRUE
Subsystem: lzo
Jason Yan <yanaijie@huawei.com>:
lib/lzo/lzo1x_compress.c: make lzogeneric1x_1_compress() static
Subsystem: apparmor
Andy Shevchenko <andriy.shevchenko@linux.intel.com>:
apparmor: remove duplicate macro list_entry_is_head()
Subsystem: mm/pagemap
Christoph Hellwig <hch@lst.de>:
Patch series "simplify follow_pte a bit":
mm: unexport follow_pte_pmd
mm: simplify follow_pte{,pmd}
Subsystem: mm/cleanups
Haitao Shi <shihaitao1@huawei.com>:
mm: fix some spelling mistakes in comments
Subsystem: mm/gup
Jann Horn <jannh@google.com>:
mmap locking API: don't check locking if the mm isn't live yet
mm/gup: assert that the mmap lock is held in __get_user_pages()
Documentation/ABI/testing/sysfs-kernel-reboot | 32
Documentation/admin-guide/kdump/vmcoreinfo.rst | 6
Documentation/dev-tools/ubsan.rst | 1
Documentation/filesystems/proc.rst | 2
MAINTAINERS | 5
arch/alpha/kernel/process.c | 2
arch/powerpc/kernel/vmlinux.lds.S | 4
arch/s390/pci/pci_mmio.c | 4
drivers/gpio/gpio-thunderx.c | 11
drivers/gpio/gpio-xilinx.c | 61 -
drivers/gpu/drm/i915/gt/uc/intel_guc_log.c | 2
drivers/misc/lkdtm/Makefile | 1
drivers/misc/lkdtm/bugs.c | 50 +
drivers/misc/lkdtm/core.c | 3
drivers/misc/lkdtm/fortify.c | 82 ++
drivers/misc/lkdtm/lkdtm.h | 19
drivers/net/wireless/ath/ath10k/spectral.c | 2
drivers/net/wireless/ath/ath11k/spectral.c | 2
drivers/net/wireless/ath/ath9k/common-spectral.c | 2
drivers/rapidio/rio.c | 81 --
fs/bfs/inode.c | 2
fs/dax.c | 9
fs/exec.c | 8
fs/nfs/callback_proc.c | 5
fs/nilfs2/segment.c | 5
fs/proc/array.c | 28
fs/proc/base.c | 2
fs/proc/generic.c | 24
fs/proc/internal.h | 10
fs/proc/proc_net.c | 20
include/asm-generic/bitops/find.h | 19
include/asm-generic/getorder.h | 2
include/linux/bitmap.h | 67 +-
include/linux/bitops.h | 24
include/linux/dcache.h | 1
include/linux/iommu-helper.h | 4
include/linux/kernel.h | 173 -----
include/linux/log2.h | 3
include/linux/math.h | 177 +++++
include/linux/mm.h | 6
include/linux/mm_types.h | 10
include/linux/mmap_lock.h | 16
include/linux/proc_fs.h | 8
include/linux/rcu_node_tree.h | 2
include/linux/relay.h | 29
include/linux/rio_drv.h | 3
include/linux/string.h | 75 +-
include/linux/units.h | 2
kernel/Makefile | 3
kernel/acct.c | 7
kernel/crash_core.c | 1
kernel/fail_function.c | 6
kernel/gcov/gcc_4_7.c | 10
kernel/reboot.c | 308 ++++++++-
kernel/relay.c | 111 ---
kernel/resource.c | 24
kernel/trace/blktrace.c | 2
lib/Kconfig.debug | 11
lib/Kconfig.ubsan | 154 +++-
lib/Makefile | 7
lib/bits_kunit.c | 75 ++
lib/cmdline.c | 20
lib/cmdline_kunit.c | 100 +++
lib/errname.c | 1
lib/error-inject.c | 2
lib/errseq.c | 1
lib/find_bit.c | 17
lib/linear_ranges_kunit.c | 228 +++++++
lib/list-test.c | 748 -----------------------
lib/list_kunit.c | 748 +++++++++++++++++++++++
lib/lz4/lz4_decompress.c | 6
lib/lz4/lz4defs.h | 1
lib/lzo/lzo1x_compress.c | 2
lib/math/div64.c | 4
lib/math/int_pow.c | 2
lib/math/int_sqrt.c | 3
lib/math/reciprocal_div.c | 9
lib/stackdepot.c | 11
lib/string.c | 4
lib/test_bitmap.c | 143 ++++
lib/test_bits.c | 75 --
lib/test_firmware.c | 9
lib/test_free_pages.c | 5
lib/test_kmod.c | 26
lib/test_linear_ranges.c | 228 -------
lib/test_lockup.c | 16
lib/test_ubsan.c | 74 ++
lib/ubsan.c | 2
mm/filemap.c | 2
mm/gup.c | 2
mm/huge_memory.c | 2
mm/khugepaged.c | 2
mm/memblock.c | 2
mm/memory.c | 36 -
mm/memory_hotplug.c | 2
mm/migrate.c | 2
mm/page_ext.c | 2
mm/swapfile.c | 11
scripts/Makefile.ubsan | 49 -
scripts/checkpatch.pl | 495 +++++++++++----
security/apparmor/apparmorfs.c | 3
tools/testing/selftests/lkdtm/tests.txt | 1
102 files changed, 3022 insertions(+), 1899 deletions(-)
^ permalink raw reply [flat|nested] 232+ messages in thread
* incoming
@ 2020-12-18 22:00 Andrew Morton
0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2020-12-18 22:00 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm
78 patches, based on a409ed156a90093a03fe6a93721ddf4c591eac87.
Subsystems affected by this patch series:
mm/memcg
epoll
mm/kasan
mm/cleanups
epoll
Subsystem: mm/memcg
Alex Shi <alex.shi@linux.alibaba.com>:
Patch series "bail out early for memcg disable":
mm/memcg: bail early from swap accounting if memcg disabled
mm/memcg: warning on !memcg after readahead page charged
Wei Yang <richard.weiyang@gmail.com>:
mm/memcg: remove unused definitions
Shakeel Butt <shakeelb@google.com>:
mm, kvm: account kvm_vcpu_mmap to kmemcg
Hui Su <sh_def@163.com>:
mm/memcontrol:rewrite mem_cgroup_page_lruvec()
Subsystem: epoll
Soheil Hassas Yeganeh <soheil@google.com>:
Patch series "simplify ep_poll":
epoll: check for events when removing a timed out thread from the wait queue
epoll: simplify signal handling
epoll: pull fatal signal checks into ep_send_events()
epoll: move eavail next to the list_empty_careful check
epoll: simplify and optimize busy loop logic
epoll: pull all code between fetch_events and send_event into the loop
epoll: replace gotos with a proper loop
epoll: eliminate unnecessary lock for zero timeout
Subsystem: mm/kasan
Andrey Konovalov <andreyknvl@google.com>:
Patch series "kasan: add hardware tag-based mode for arm64", v11:
kasan: drop unnecessary GPL text from comment headers
kasan: KASAN_VMALLOC depends on KASAN_GENERIC
kasan: group vmalloc code
kasan: shadow declarations only for software modes
kasan: rename (un)poison_shadow to (un)poison_range
kasan: rename KASAN_SHADOW_* to KASAN_GRANULE_*
kasan: only build init.c for software modes
kasan: split out shadow.c from common.c
kasan: define KASAN_MEMORY_PER_SHADOW_PAGE
kasan: rename report and tags files
kasan: don't duplicate config dependencies
kasan: hide invalid free check implementation
kasan: decode stack frame only with KASAN_STACK_ENABLE
kasan, arm64: only init shadow for software modes
kasan, arm64: only use kasan_depth for software modes
kasan, arm64: move initialization message
kasan, arm64: rename kasan_init_tags and mark as __init
kasan: rename addr_has_shadow to addr_has_metadata
kasan: rename print_shadow_for_address to print_memory_metadata
kasan: rename SHADOW layout macros to META
kasan: separate metadata_fetch_row for each mode
kasan: introduce CONFIG_KASAN_HW_TAGS
Vincenzo Frascino <vincenzo.frascino@arm.com>:
arm64: enable armv8.5-a asm-arch option
arm64: mte: add in-kernel MTE helpers
arm64: mte: reset the page tag in page->flags
arm64: mte: add in-kernel tag fault handler
arm64: kasan: allow enabling in-kernel MTE
arm64: mte: convert gcr_user into an exclude mask
arm64: mte: switch GCR_EL1 in kernel entry and exit
kasan, mm: untag page address in free_reserved_area
Andrey Konovalov <andreyknvl@google.com>:
arm64: kasan: align allocations for HW_TAGS
arm64: kasan: add arch layer for memory tagging helpers
kasan: define KASAN_GRANULE_SIZE for HW_TAGS
kasan, x86, s390: update undef CONFIG_KASAN
kasan, arm64: expand CONFIG_KASAN checks
kasan, arm64: implement HW_TAGS runtime
kasan, arm64: print report from tag fault handler
kasan, mm: reset tags when accessing metadata
kasan, arm64: enable CONFIG_KASAN_HW_TAGS
kasan: add documentation for hardware tag-based mode
Vincenzo Frascino <vincenzo.frascino@arm.com>:
kselftest/arm64: check GCR_EL1 after context switch
Andrey Konovalov <andreyknvl@google.com>:
Patch series "kasan: boot parameters for hardware tag-based mode", v4:
kasan: simplify quarantine_put call site
kasan: rename get_alloc/free_info
kasan: introduce set_alloc_info
kasan, arm64: unpoison stack only with CONFIG_KASAN_STACK
kasan: allow VMAP_STACK for HW_TAGS mode
kasan: remove __kasan_unpoison_stack
kasan: inline kasan_reset_tag for tag-based modes
kasan: inline random_tag for HW_TAGS
kasan: open-code kasan_unpoison_slab
kasan: inline (un)poison_range and check_invalid_free
kasan: add and integrate kasan boot parameters
kasan, mm: check kasan_enabled in annotations
kasan, mm: rename kasan_poison_kfree
kasan: don't round_up too much
kasan: simplify assign_tag and set_tag calls
kasan: clarify comment in __kasan_kfree_large
kasan: sanitize objects when metadata doesn't fit
kasan, mm: allow cache merging with no metadata
kasan: update documentation
Subsystem: mm/cleanups
Colin Ian King <colin.king@canonical.com>:
mm/Kconfig: fix spelling mistake "whats" -> "what's"
Subsystem: epoll
Willem de Bruijn <willemb@google.com>:
Patch series "add epoll_pwait2 syscall", v4:
epoll: convert internal api to timespec64
epoll: add syscall epoll_pwait2
epoll: wire up syscall epoll_pwait2
selftests/filesystems: expand epoll with epoll_pwait2
Documentation/dev-tools/kasan.rst | 274 +-
arch/Kconfig | 8
arch/alpha/kernel/syscalls/syscall.tbl | 1
arch/arm/tools/syscall.tbl | 1
arch/arm64/Kconfig | 9
arch/arm64/Makefile | 7
arch/arm64/include/asm/assembler.h | 2
arch/arm64/include/asm/cache.h | 3
arch/arm64/include/asm/esr.h | 1
arch/arm64/include/asm/kasan.h | 17
arch/arm64/include/asm/memory.h | 15
arch/arm64/include/asm/mte-def.h | 16
arch/arm64/include/asm/mte-kasan.h | 67
arch/arm64/include/asm/mte.h | 22
arch/arm64/include/asm/processor.h | 2
arch/arm64/include/asm/string.h | 5
arch/arm64/include/asm/uaccess.h | 23
arch/arm64/include/asm/unistd.h | 2
arch/arm64/include/asm/unistd32.h | 2
arch/arm64/kernel/asm-offsets.c | 3
arch/arm64/kernel/cpufeature.c | 3
arch/arm64/kernel/entry.S | 41
arch/arm64/kernel/head.S | 2
arch/arm64/kernel/hibernate.c | 5
arch/arm64/kernel/image-vars.h | 2
arch/arm64/kernel/kaslr.c | 3
arch/arm64/kernel/module.c | 6
arch/arm64/kernel/mte.c | 124 +
arch/arm64/kernel/setup.c | 2
arch/arm64/kernel/sleep.S | 2
arch/arm64/kernel/smp.c | 2
arch/arm64/lib/mte.S | 16
arch/arm64/mm/copypage.c | 9
arch/arm64/mm/fault.c | 59
arch/arm64/mm/kasan_init.c | 41
arch/arm64/mm/mteswap.c | 9
arch/arm64/mm/proc.S | 23
arch/arm64/mm/ptdump.c | 6
arch/ia64/kernel/syscalls/syscall.tbl | 1
arch/m68k/kernel/syscalls/syscall.tbl | 1
arch/microblaze/kernel/syscalls/syscall.tbl | 1
arch/mips/kernel/syscalls/syscall_n32.tbl | 1
arch/mips/kernel/syscalls/syscall_n64.tbl | 1
arch/mips/kernel/syscalls/syscall_o32.tbl | 1
arch/parisc/kernel/syscalls/syscall.tbl | 1
arch/powerpc/kernel/syscalls/syscall.tbl | 1
arch/s390/boot/string.c | 1
arch/s390/kernel/syscalls/syscall.tbl | 1
arch/sh/kernel/syscalls/syscall.tbl | 1
arch/sparc/kernel/syscalls/syscall.tbl | 1
arch/x86/boot/compressed/misc.h | 1
arch/x86/entry/syscalls/syscall_32.tbl | 1
arch/x86/entry/syscalls/syscall_64.tbl | 1
arch/x86/kernel/acpi/wakeup_64.S | 2
arch/x86/kvm/x86.c | 2
arch/xtensa/kernel/syscalls/syscall.tbl | 1
fs/eventpoll.c | 359 ++-
include/linux/compat.h | 6
include/linux/kasan-checks.h | 2
include/linux/kasan.h | 423 ++--
include/linux/memcontrol.h | 137 -
include/linux/mm.h | 24
include/linux/mmdebug.h | 13
include/linux/moduleloader.h | 3
include/linux/page-flags-layout.h | 2
include/linux/sched.h | 2
include/linux/string.h | 2
include/linux/syscalls.h | 5
include/uapi/asm-generic/unistd.h | 4
init/init_task.c | 2
kernel/fork.c | 4
kernel/sys_ni.c | 2
lib/Kconfig.kasan | 71
lib/test_kasan.c | 2
lib/test_kasan_module.c | 2
mm/Kconfig | 2
mm/kasan/Makefile | 33
mm/kasan/common.c | 1006 ++--------
mm/kasan/generic.c | 72
mm/kasan/generic_report.c | 13
mm/kasan/hw_tags.c | 294 ++
mm/kasan/init.c | 25
mm/kasan/kasan.h | 204 +-
mm/kasan/quarantine.c | 35
mm/kasan/report.c | 363 +--
mm/kasan/report_generic.c | 169 +
mm/kasan/report_hw_tags.c | 44
mm/kasan/report_sw_tags.c | 22
mm/kasan/shadow.c | 541 +++++
mm/kasan/sw_tags.c | 34
mm/kasan/tags.c | 7
mm/kasan/tags_report.c | 7
mm/memcontrol.c | 53
mm/mempool.c | 4
mm/page_alloc.c | 9
mm/page_poison.c | 2
mm/ptdump.c | 13
mm/slab_common.c | 5
mm/slub.c | 29
scripts/Makefile.lib | 2
tools/testing/selftests/arm64/mte/Makefile | 2
tools/testing/selftests/arm64/mte/check_gcr_el1_cswitch.c | 155 +
tools/testing/selftests/filesystems/epoll/epoll_wakeup_test.c | 72
virt/kvm/coalesced_mmio.c | 2
virt/kvm/kvm_main.c | 2
105 files changed, 3268 insertions(+), 1873 deletions(-)
^ permalink raw reply [flat|nested] 232+ messages in thread
* incoming
@ 2020-12-22 19:58 Andrew Morton
2020-12-22 21:43 ` incoming Linus Torvalds
0 siblings, 1 reply; 232+ messages in thread
From: Andrew Morton @ 2020-12-22 19:58 UTC (permalink / raw)
To: Linus Torvalds; +Cc: linux-mm, mm-commits
60 patches, based on 8653b778e454a7708847aeafe689bce07aeeb94e.
Subsystems affected by this patch series:
mm/kasan
Subsystem: mm/kasan
Andrey Konovalov <andreyknvl@google.com>:
Patch series "kasan: add hardware tag-based mode for arm64", v11:
kasan: drop unnecessary GPL text from comment headers
kasan: KASAN_VMALLOC depends on KASAN_GENERIC
kasan: group vmalloc code
kasan: shadow declarations only for software modes
kasan: rename (un)poison_shadow to (un)poison_range
kasan: rename KASAN_SHADOW_* to KASAN_GRANULE_*
kasan: only build init.c for software modes
kasan: split out shadow.c from common.c
kasan: define KASAN_MEMORY_PER_SHADOW_PAGE
kasan: rename report and tags files
kasan: don't duplicate config dependencies
kasan: hide invalid free check implementation
kasan: decode stack frame only with KASAN_STACK_ENABLE
kasan, arm64: only init shadow for software modes
kasan, arm64: only use kasan_depth for software modes
kasan, arm64: move initialization message
kasan, arm64: rename kasan_init_tags and mark as __init
kasan: rename addr_has_shadow to addr_has_metadata
kasan: rename print_shadow_for_address to print_memory_metadata
kasan: rename SHADOW layout macros to META
kasan: separate metadata_fetch_row for each mode
kasan: introduce CONFIG_KASAN_HW_TAGS
Vincenzo Frascino <vincenzo.frascino@arm.com>:
arm64: enable armv8.5-a asm-arch option
arm64: mte: add in-kernel MTE helpers
arm64: mte: reset the page tag in page->flags
arm64: mte: add in-kernel tag fault handler
arm64: kasan: allow enabling in-kernel MTE
arm64: mte: convert gcr_user into an exclude mask
arm64: mte: switch GCR_EL1 in kernel entry and exit
kasan, mm: untag page address in free_reserved_area
Andrey Konovalov <andreyknvl@google.com>:
arm64: kasan: align allocations for HW_TAGS
arm64: kasan: add arch layer for memory tagging helpers
kasan: define KASAN_GRANULE_SIZE for HW_TAGS
kasan, x86, s390: update undef CONFIG_KASAN
kasan, arm64: expand CONFIG_KASAN checks
kasan, arm64: implement HW_TAGS runtime
kasan, arm64: print report from tag fault handler
kasan, mm: reset tags when accessing metadata
kasan, arm64: enable CONFIG_KASAN_HW_TAGS
kasan: add documentation for hardware tag-based mode
Vincenzo Frascino <vincenzo.frascino@arm.com>:
kselftest/arm64: check GCR_EL1 after context switch
Andrey Konovalov <andreyknvl@google.com>:
Patch series "kasan: boot parameters for hardware tag-based mode", v4:
kasan: simplify quarantine_put call site
kasan: rename get_alloc/free_info
kasan: introduce set_alloc_info
kasan, arm64: unpoison stack only with CONFIG_KASAN_STACK
kasan: allow VMAP_STACK for HW_TAGS mode
kasan: remove __kasan_unpoison_stack
kasan: inline kasan_reset_tag for tag-based modes
kasan: inline random_tag for HW_TAGS
kasan: open-code kasan_unpoison_slab
kasan: inline (un)poison_range and check_invalid_free
kasan: add and integrate kasan boot parameters
kasan, mm: check kasan_enabled in annotations
kasan, mm: rename kasan_poison_kfree
kasan: don't round_up too much
kasan: simplify assign_tag and set_tag calls
kasan: clarify comment in __kasan_kfree_large
kasan: sanitize objects when metadata doesn't fit
kasan, mm: allow cache merging with no metadata
kasan: update documentation
Documentation/dev-tools/kasan.rst | 274 ++-
arch/Kconfig | 8
arch/arm64/Kconfig | 9
arch/arm64/Makefile | 7
arch/arm64/include/asm/assembler.h | 2
arch/arm64/include/asm/cache.h | 3
arch/arm64/include/asm/esr.h | 1
arch/arm64/include/asm/kasan.h | 17
arch/arm64/include/asm/memory.h | 15
arch/arm64/include/asm/mte-def.h | 16
arch/arm64/include/asm/mte-kasan.h | 67
arch/arm64/include/asm/mte.h | 22
arch/arm64/include/asm/processor.h | 2
arch/arm64/include/asm/string.h | 5
arch/arm64/include/asm/uaccess.h | 23
arch/arm64/kernel/asm-offsets.c | 3
arch/arm64/kernel/cpufeature.c | 3
arch/arm64/kernel/entry.S | 41
arch/arm64/kernel/head.S | 2
arch/arm64/kernel/hibernate.c | 5
arch/arm64/kernel/image-vars.h | 2
arch/arm64/kernel/kaslr.c | 3
arch/arm64/kernel/module.c | 6
arch/arm64/kernel/mte.c | 124 +
arch/arm64/kernel/setup.c | 2
arch/arm64/kernel/sleep.S | 2
arch/arm64/kernel/smp.c | 2
arch/arm64/lib/mte.S | 16
arch/arm64/mm/copypage.c | 9
arch/arm64/mm/fault.c | 59
arch/arm64/mm/kasan_init.c | 41
arch/arm64/mm/mteswap.c | 9
arch/arm64/mm/proc.S | 23
arch/arm64/mm/ptdump.c | 6
arch/s390/boot/string.c | 1
arch/x86/boot/compressed/misc.h | 1
arch/x86/kernel/acpi/wakeup_64.S | 2
include/linux/kasan-checks.h | 2
include/linux/kasan.h | 423 ++++-
include/linux/mm.h | 24
include/linux/moduleloader.h | 3
include/linux/page-flags-layout.h | 2
include/linux/sched.h | 2
include/linux/string.h | 2
init/init_task.c | 2
kernel/fork.c | 4
lib/Kconfig.kasan | 71
lib/test_kasan.c | 2
lib/test_kasan_module.c | 2
mm/kasan/Makefile | 33
mm/kasan/common.c | 1006 +++-----------
mm/kasan/generic.c | 72 -
mm/kasan/generic_report.c | 13
mm/kasan/hw_tags.c | 276 +++
mm/kasan/init.c | 25
mm/kasan/kasan.h | 195 ++
mm/kasan/quarantine.c | 35
mm/kasan/report.c | 363 +----
mm/kasan/report_generic.c | 169 ++
mm/kasan/report_hw_tags.c | 44
mm/kasan/report_sw_tags.c | 22
mm/kasan/shadow.c | 528 +++++++
mm/kasan/sw_tags.c | 34
mm/kasan/tags.c | 7
mm/kasan/tags_report.c | 7
mm/mempool.c | 4
mm/page_alloc.c | 9
mm/page_poison.c | 2
mm/ptdump.c | 13
mm/slab_common.c | 5
mm/slub.c | 29
scripts/Makefile.lib | 2
tools/testing/selftests/arm64/mte/Makefile | 2
tools/testing/selftests/arm64/mte/check_gcr_el1_cswitch.c | 155 ++
74 files changed, 2869 insertions(+), 1553 deletions(-)
^ permalink raw reply [flat|nested] 232+ messages in thread
* Re: incoming
2020-12-22 19:58 incoming Andrew Morton
@ 2020-12-22 21:43 ` Linus Torvalds
0 siblings, 0 replies; 232+ messages in thread
From: Linus Torvalds @ 2020-12-22 21:43 UTC (permalink / raw)
To: Andrew Morton; +Cc: Linux-MM, mm-commits
On Tue, Dec 22, 2020 at 11:58 AM Andrew Morton
<akpm@linux-foundation.org> wrote:
>
> 60 patches, based on 8653b778e454a7708847aeafe689bce07aeeb94e.
I see that you enabled renaming in the patches. Lovely.
Can you also enable it in the diffstat?
> 74 files changed, 2869 insertions(+), 1553 deletions(-)
With -M in the diffstat, you should have seen
72 files changed, 2775 insertions(+), 1460 deletions(-)
and if you add "--summary", you'll also see the rename part ofthe file
create/delete summary:
rename mm/kasan/{tags_report.c => report_sw_tags.c} (78%)
which is often nice to see in addition to the line stats..
Linus
^ permalink raw reply [flat|nested] 232+ messages in thread
* incoming
@ 2020-12-29 23:13 Andrew Morton
0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2020-12-29 23:13 UTC (permalink / raw)
To: Linus Torvalds; +Cc: linux-mm, mm-commits
16 patches, based on dea8dcf2a9fa8cc540136a6cd885c3beece16ec3.
Subsystems affected by this patch series:
mm/selftests
mm/hugetlb
kbuild
checkpatch
mm/pagecache
mm/mremap
mm/kasan
misc
lib
mm/slub
Subsystem: mm/selftests
Harish <harish@linux.ibm.com>:
selftests/vm: fix building protection keys test
Subsystem: mm/hugetlb
Mike Kravetz <mike.kravetz@oracle.com>:
mm/hugetlb: fix deadlock in hugetlb_cow error path
Subsystem: kbuild
Masahiro Yamada <masahiroy@kernel.org>:
Revert "kbuild: avoid static_assert for genksyms"
Subsystem: checkpatch
Joe Perches <joe@perches.com>:
checkpatch: prefer strscpy to strlcpy
Subsystem: mm/pagecache
Souptick Joarder <jrdr.linux@gmail.com>:
mm: add prototype for __add_to_page_cache_locked()
Baoquan He <bhe@redhat.com>:
mm: memmap defer init doesn't work as expected
Subsystem: mm/mremap
Kalesh Singh <kaleshsingh@google.com>:
mm/mremap.c: fix extent calculation
Nicholas Piggin <npiggin@gmail.com>:
mm: generalise COW SMC TLB flushing race comment
Subsystem: mm/kasan
Walter Wu <walter-zh.wu@mediatek.com>:
kasan: fix null pointer dereference in kasan_record_aux_stack
Subsystem: misc
Randy Dunlap <rdunlap@infradead.org>:
local64.h: make <asm/local64.h> mandatory
Huang Shijie <sjhuang@iluvatar.ai>:
sizes.h: add SZ_8G/SZ_16G/SZ_32G macros
Josh Poimboeuf <jpoimboe@redhat.com>:
kdev_t: always inline major/minor helper functions
Subsystem: lib
Huang Shijie <sjhuang@iluvatar.ai>:
lib/genalloc: fix the overflow when size is too big
Ilya Leoshkevich <iii@linux.ibm.com>:
lib/zlib: fix inflating zlib streams on s390
Randy Dunlap <rdunlap@infradead.org>:
zlib: move EXPORT_SYMBOL() and MODULE_LICENSE() out of dfltcc_syms.c
Subsystem: mm/slub
Roman Gushchin <guro@fb.com>:
mm: slub: call account_slab_page() after slab page initialization
arch/alpha/include/asm/local64.h | 1 -
arch/arc/include/asm/Kbuild | 1 -
arch/arm/include/asm/Kbuild | 1 -
arch/arm64/include/asm/Kbuild | 1 -
arch/csky/include/asm/Kbuild | 1 -
arch/h8300/include/asm/Kbuild | 1 -
arch/hexagon/include/asm/Kbuild | 1 -
arch/ia64/include/asm/local64.h | 1 -
arch/ia64/mm/init.c | 4 ++--
arch/m68k/include/asm/Kbuild | 1 -
arch/microblaze/include/asm/Kbuild | 1 -
arch/mips/include/asm/Kbuild | 1 -
arch/nds32/include/asm/Kbuild | 1 -
arch/openrisc/include/asm/Kbuild | 1 -
arch/parisc/include/asm/Kbuild | 1 -
arch/powerpc/include/asm/Kbuild | 1 -
arch/riscv/include/asm/Kbuild | 1 -
arch/s390/include/asm/Kbuild | 1 -
arch/sh/include/asm/Kbuild | 1 -
arch/sparc/include/asm/Kbuild | 1 -
arch/x86/include/asm/local64.h | 1 -
arch/xtensa/include/asm/Kbuild | 1 -
include/asm-generic/Kbuild | 1 +
include/linux/build_bug.h | 5 -----
include/linux/kdev_t.h | 22 +++++++++++-----------
include/linux/mm.h | 12 ++++++++++--
include/linux/sizes.h | 3 +++
lib/genalloc.c | 25 +++++++++++++------------
lib/zlib_dfltcc/Makefile | 2 +-
lib/zlib_dfltcc/dfltcc.c | 6 +++++-
lib/zlib_dfltcc/dfltcc_deflate.c | 3 +++
lib/zlib_dfltcc/dfltcc_inflate.c | 4 ++--
lib/zlib_dfltcc/dfltcc_syms.c | 17 -----------------
mm/hugetlb.c | 22 +++++++++++++++++++++-
mm/kasan/generic.c | 2 ++
mm/memory.c | 8 +++++---
mm/memory_hotplug.c | 2 +-
mm/mremap.c | 4 +++-
mm/page_alloc.c | 8 +++++---
mm/slub.c | 5 ++---
scripts/checkpatch.pl | 6 ++++++
tools/testing/selftests/vm/Makefile | 10 +++++-----
42 files changed, 101 insertions(+), 91 deletions(-)
^ permalink raw reply [flat|nested] 232+ messages in thread
* incoming
@ 2021-01-12 23:48 Andrew Morton
2021-01-15 23:32 ` incoming Linus Torvalds
0 siblings, 1 reply; 232+ messages in thread
From: Andrew Morton @ 2021-01-12 23:48 UTC (permalink / raw)
To: Linus Torvalds; +Cc: linux-mm, mm-commits
10 patches, based on e609571b5ffa3528bf85292de1ceaddac342bc1c.
Subsystems affected by this patch series:
mm/slub
mm/pagealloc
mm/memcg
mm/kasan
mm/vmalloc
mm/migration
mm/hugetlb
MAINTAINERS
mm/memory-failure
mm/process_vm_access
Subsystem: mm/slub
Jann Horn <jannh@google.com>:
mm, slub: consider rest of partial list if acquire_slab() fails
Subsystem: mm/pagealloc
Hailong liu <liu.hailong6@zte.com.cn>:
mm/page_alloc: add a missing mm_page_alloc_zone_locked() tracepoint
Subsystem: mm/memcg
Hugh Dickins <hughd@google.com>:
mm/memcontrol: fix warning in mem_cgroup_page_lruvec()
Subsystem: mm/kasan
Hailong Liu <liu.hailong6@zte.com.cn>:
arm/kasan: fix the array size of kasan_early_shadow_pte[]
Subsystem: mm/vmalloc
Miaohe Lin <linmiaohe@huawei.com>:
mm/vmalloc.c: fix potential memory leak
Subsystem: mm/migration
Jan Stancek <jstancek@redhat.com>:
mm: migrate: initialize err in do_migrate_pages
Subsystem: mm/hugetlb
Miaohe Lin <linmiaohe@huawei.com>:
mm/hugetlb: fix potential missing huge page size info
Subsystem: MAINTAINERS
Vlastimil Babka <vbabka@suse.cz>:
MAINTAINERS: add Vlastimil as slab allocators maintainer
Subsystem: mm/memory-failure
Oscar Salvador <osalvador@suse.de>:
mm,hwpoison: fix printing of page flags
Subsystem: mm/process_vm_access
Andrew Morton <akpm@linux-foundation.org>:
mm/process_vm_access.c: include compat.h
MAINTAINERS | 1 +
include/linux/kasan.h | 6 +++++-
include/linux/memcontrol.h | 2 +-
mm/hugetlb.c | 2 +-
mm/kasan/init.c | 3 ++-
mm/memory-failure.c | 2 +-
mm/mempolicy.c | 2 +-
mm/page_alloc.c | 31 ++++++++++++++++---------------
mm/process_vm_access.c | 1 +
mm/slub.c | 2 +-
mm/vmalloc.c | 4 +++-
11 files changed, 33 insertions(+), 23 deletions(-)
^ permalink raw reply [flat|nested] 232+ messages in thread
* Re: incoming
2021-01-12 23:48 incoming Andrew Morton
@ 2021-01-15 23:32 ` Linus Torvalds
0 siblings, 0 replies; 232+ messages in thread
From: Linus Torvalds @ 2021-01-15 23:32 UTC (permalink / raw)
To: Andrew Morton; +Cc: Linux-MM, mm-commits
On Tue, Jan 12, 2021 at 3:48 PM Andrew Morton <akpm@linux-foundation.org> wrote:
>
> 10 patches, based on e609571b5ffa3528bf85292de1ceaddac342bc1c.
Whee. I had completely dropped the ball on this - I had built my usual
"akpm" branch with the patches, but then had completely forgotten
about it after doing my basic build tests.
I tend to leave it for a while to see if people send belated ACK/NAK's
for the patches, but that "for a while" is typically "overnight", not
several days.
So if you ever notice that I haven't merged your patch submission, and
you haven't seen me comment on them, feel free to ping me to remind
me.
Because it might just have gotten lost in the shuffle for some random
reason. Admittedly it's rare - I think this is the first time I just
randomly noticed three days later that I'd never done the actual merge
of the patch-series).
Linus
^ permalink raw reply [flat|nested] 232+ messages in thread
* incoming
@ 2021-01-24 5:00 Andrew Morton
0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2021-01-24 5:00 UTC (permalink / raw)
To: Linus Torvalds; +Cc: linux-mm, mm-commits
19 patches, based on e1ae4b0be15891faf46d390e9f3dc9bd71a8cae1.
Subsystems affected by this patch series:
mm/pagealloc
mm/memcg
mm/kasan
ubsan
mm/memory-failure
mm/highmem
proc
MAINTAINERS
Subsystem: mm/pagealloc
Mike Rapoport <rppt@linux.ibm.com>:
Patch series "mm: fix initialization of struct page for holes in memory layout", v3:
x86/setup: don't remove E820_TYPE_RAM for pfn 0
mm: fix initialization of struct page for holes in memory layout
Subsystem: mm/memcg
Roman Gushchin <guro@fb.com>:
mm: memcg/slab: optimize objcg stock draining
Shakeel Butt <shakeelb@google.com>:
mm: memcg: fix memcg file_dirty numa stat
mm: fix numa stats for thp migration
Johannes Weiner <hannes@cmpxchg.org>:
mm: memcontrol: prevent starvation when writing memory.high
Subsystem: mm/kasan
Lecopzer Chen <lecopzer@gmail.com>:
kasan: fix unaligned address is unhandled in kasan_remove_zero_shadow
kasan: fix incorrect arguments passing in kasan_add_zero_shadow
Andrey Konovalov <andreyknvl@google.com>:
kasan: fix HW_TAGS boot parameters
kasan, mm: fix conflicts with init_on_alloc/free
kasan, mm: fix resetting page_alloc tags for HW_TAGS
Subsystem: ubsan
Arnd Bergmann <arnd@arndb.de>:
ubsan: disable unsigned-overflow check for i386
Subsystem: mm/memory-failure
Dan Williams <dan.j.williams@intel.com>:
mm: fix page reference leak in soft_offline_page()
Subsystem: mm/highmem
Thomas Gleixner <tglx@linutronix.de>:
Patch series "mm/highmem: Fix fallout from generic kmap_local conversions":
sparc/mm/highmem: flush cache and TLB
mm/highmem: prepare for overriding set_pte_at()
mips/mm/highmem: use set_pte() for kmap_local()
powerpc/mm/highmem: use __set_pte_at() for kmap_local()
Subsystem: proc
Xiaoming Ni <nixiaoming@huawei.com>:
proc_sysctl: fix oops caused by incorrect command parameters
Subsystem: MAINTAINERS
Nathan Chancellor <natechancellor@gmail.com>:
MAINTAINERS: add a couple more files to the Clang/LLVM section
Documentation/dev-tools/kasan.rst | 27 ++---------
MAINTAINERS | 2
arch/mips/include/asm/highmem.h | 1
arch/powerpc/include/asm/highmem.h | 2
arch/sparc/include/asm/highmem.h | 9 ++-
arch/x86/kernel/setup.c | 20 +++-----
fs/proc/proc_sysctl.c | 7 ++-
lib/Kconfig.ubsan | 1
mm/highmem.c | 7 ++-
mm/kasan/hw_tags.c | 77 +++++++++++++--------------------
mm/kasan/init.c | 23 +++++----
mm/memcontrol.c | 11 +---
mm/memory-failure.c | 20 ++++++--
mm/migrate.c | 27 ++++++-----
mm/page_alloc.c | 86 ++++++++++++++++++++++---------------
mm/slub.c | 7 +--
16 files changed, 173 insertions(+), 154 deletions(-)
^ permalink raw reply [flat|nested] 232+ messages in thread
* incoming
@ 2021-02-05 2:31 Andrew Morton
0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2021-02-05 2:31 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm
18 patches, based on 5c279c4cf206e03995e04fd3404fa95ffd243a97.
Subsystems affected by this patch series:
mm/hugetlb
mm/compaction
mm/vmalloc
gcov
mm/shmem
mm/memblock
mailmap
mm/pagecache
mm/kasan
ubsan
mm/hugetlb
MAINTAINERS
Subsystem: mm/hugetlb
Muchun Song <songmuchun@bytedance.com>:
mm: hugetlbfs: fix cannot migrate the fallocated HugeTLB page
mm: hugetlb: fix a race between freeing and dissolving the page
mm: hugetlb: fix a race between isolating and freeing page
mm: hugetlb: remove VM_BUG_ON_PAGE from page_huge_active
mm: migrate: do not migrate HugeTLB page whose refcount is one
Subsystem: mm/compaction
Rokudo Yan <wu-yan@tcl.com>:
mm, compaction: move high_pfn to the for loop scope
Subsystem: mm/vmalloc
Rick Edgecombe <rick.p.edgecombe@intel.com>:
mm/vmalloc: separate put pages and flush VM flags
Subsystem: gcov
Johannes Berg <johannes.berg@intel.com>:
init/gcov: allow CONFIG_CONSTRUCTORS on UML to fix module gcov
Subsystem: mm/shmem
Hugh Dickins <hughd@google.com>:
mm: thp: fix MADV_REMOVE deadlock on shmem THP
Subsystem: mm/memblock
Roman Gushchin <guro@fb.com>:
memblock: do not start bottom-up allocations with kernel_end
Subsystem: mailmap
Viresh Kumar <viresh.kumar@linaro.org>:
mailmap: fix name/email for Viresh Kumar
Manivannan Sadhasivam <manivannan.sadhasivam@linaro.org>:
mailmap: add entries for Manivannan Sadhasivam
Subsystem: mm/pagecache
Waiman Long <longman@redhat.com>:
mm/filemap: add missing mem_cgroup_uncharge() to __add_to_page_cache_locked()
Subsystem: mm/kasan
Vincenzo Frascino <vincenzo.frascino@arm.com>:
Patch series "kasan: Fix metadata detection for KASAN_HW_TAGS", v5:
kasan: add explicit preconditions to kasan_report()
kasan: make addr_has_metadata() return true for valid addresses
Subsystem: ubsan
Nathan Chancellor <nathan@kernel.org>:
ubsan: implement __ubsan_handle_alignment_assumption
Subsystem: mm/hugetlb
Muchun Song <songmuchun@bytedance.com>:
mm: hugetlb: fix missing put_page in gather_surplus_pages()
Subsystem: MAINTAINERS
Nathan Chancellor <nathan@kernel.org>:
MAINTAINERS/.mailmap: use my @kernel.org address
.mailmap | 5 ++++
MAINTAINERS | 2 -
fs/hugetlbfs/inode.c | 3 +-
include/linux/hugetlb.h | 2 +
include/linux/kasan.h | 7 ++++++
include/linux/vmalloc.h | 9 +-------
init/Kconfig | 1
init/main.c | 8 ++++++-
kernel/gcov/Kconfig | 2 -
lib/ubsan.c | 31 ++++++++++++++++++++++++++++
lib/ubsan.h | 6 +++++
mm/compaction.c | 3 +-
mm/filemap.c | 4 +++
mm/huge_memory.c | 37 ++++++++++++++++++++-------------
mm/hugetlb.c | 53 ++++++++++++++++++++++++++++++++++++++++++------
mm/kasan/kasan.h | 2 -
mm/memblock.c | 49 +++++---------------------------------------
mm/migrate.c | 6 +++++
18 files changed, 153 insertions(+), 77 deletions(-)
^ permalink raw reply [flat|nested] 232+ messages in thread
* incoming
@ 2021-02-09 21:41 Andrew Morton
2021-02-10 19:30 ` incoming Linus Torvalds
0 siblings, 1 reply; 232+ messages in thread
From: Andrew Morton @ 2021-02-09 21:41 UTC (permalink / raw)
To: Linus Torvalds; +Cc: linux-mm, mm-commits
14 patches, based on e0756cfc7d7cd08c98a53b6009c091a3f6a50be6.
Subsystems affected by this patch series:
squashfs
mm/kasan
firmware
mm/mremap
mm/tmpfs
mm/selftests
MAINTAINERS
mm/memcg
mm/slub
nilfs2
Subsystem: squashfs
Phillip Lougher <phillip@squashfs.org.uk>:
Patch series "Squashfs: fix BIO migration regression and add sanity checks":
squashfs: avoid out of bounds writes in decompressors
squashfs: add more sanity checks in id lookup
squashfs: add more sanity checks in inode lookup
squashfs: add more sanity checks in xattr id lookup
Subsystem: mm/kasan
Andrey Konovalov <andreyknvl@google.com>:
kasan: fix stack traces dependency for HW_TAGS
Subsystem: firmware
Fangrui Song <maskray@google.com>:
firmware_loader: align .builtin_fw to 8
Subsystem: mm/mremap
Arnd Bergmann <arnd@arndb.de>:
mm/mremap: fix BUILD_BUG_ON() error in get_extent
Subsystem: mm/tmpfs
Seth Forshee <seth.forshee@canonical.com>:
tmpfs: disallow CONFIG_TMPFS_INODE64 on s390
tmpfs: disallow CONFIG_TMPFS_INODE64 on alpha
Subsystem: mm/selftests
Rong Chen <rong.a.chen@intel.com>:
selftests/vm: rename file run_vmtests to run_vmtests.sh
Subsystem: MAINTAINERS
Andrey Ryabinin <ryabinin.a.a@gmail.com>:
MAINTAINERS: update Andrey Ryabinin's email address
Subsystem: mm/memcg
Johannes Weiner <hannes@cmpxchg.org>:
Revert "mm: memcontrol: avoid workload stalls when lowering memory.high"
Subsystem: mm/slub
Vlastimil Babka <vbabka@suse.cz>:
mm, slub: better heuristic for number of cpus when calculating slab order
Subsystem: nilfs2
Joachim Henke <joachim.henke@t-systems.com>:
nilfs2: make splice write available again
.mailmap | 1
Documentation/dev-tools/kasan.rst | 3 -
MAINTAINERS | 2 -
fs/Kconfig | 4 +-
fs/nilfs2/file.c | 1
fs/squashfs/block.c | 8 ++++
fs/squashfs/export.c | 41 +++++++++++++++++++----
fs/squashfs/id.c | 40 ++++++++++++++++++-----
fs/squashfs/squashfs_fs_sb.h | 1
fs/squashfs/super.c | 6 +--
fs/squashfs/xattr.h | 10 +++++
fs/squashfs/xattr_id.c | 66 ++++++++++++++++++++++++++++++++------
include/asm-generic/vmlinux.lds.h | 2 -
mm/kasan/hw_tags.c | 8 +---
mm/memcontrol.c | 5 +-
mm/mremap.c | 5 +-
mm/slub.c | 18 +++++++++-
17 files changed, 172 insertions(+), 49 deletions(-)
^ permalink raw reply [flat|nested] 232+ messages in thread
* Re: incoming
2021-02-09 21:41 incoming Andrew Morton
@ 2021-02-10 19:30 ` Linus Torvalds
0 siblings, 0 replies; 232+ messages in thread
From: Linus Torvalds @ 2021-02-10 19:30 UTC (permalink / raw)
To: Andrew Morton; +Cc: Linux-MM, mm-commits
Hah. This series shows a small deficiency in your scripting wrt the diffstat:
On Tue, Feb 9, 2021 at 1:41 PM Andrew Morton <akpm@linux-foundation.org> wrote:
>
> .mailmap | 1
...
> mm/slub.c | 18 +++++++++-
> 17 files changed, 172 insertions(+), 49 deletions(-)
It actually has 18 files changed, but one of them is a pure rename (no
change to the content), and apparently your diffstat tool can't handle
that case.
It *should* have ended with
...
mm/slub.c | 18 +++++-
.../selftests/vm/{run_vmtests => run_vmtests.sh} | 0
18 files changed, 172 insertions(+), 49 deletions(-)
rename tools/testing/selftests/vm/{run_vmtests => run_vmtests.sh} (100%)
if you'd done a proper "git diff -M --stat --summary" of the series.
[ Ok, by default git would actually have said
18 files changed, 171 insertions(+), 48 deletions(-)
but it looks like you use the patience diff option, which gives that
extra insertion/deletion line because it generates the diff a bit
differently ]
Not a big deal,, but it made me briefly wonder "why doesn't my
diffstat match yours".
Linus
^ permalink raw reply [flat|nested] 232+ messages in thread
* incoming
@ 2021-02-13 4:52 Andrew Morton
0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2021-02-13 4:52 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm
6 patches, based on dcc0b49040c70ad827a7f3d58a21b01fdb14e749.
Subsystems affected by this patch series:
mm/pagemap
scripts
MAINTAINERS
h8300
Subsystem: mm/pagemap
Mike Rapoport <rppt@linux.ibm.com>:
m68k: make __pfn_to_phys() and __phys_to_pfn() available for !MMU
Subsystem: scripts
Rong Chen <rong.a.chen@intel.com>:
scripts/recordmcount.pl: support big endian for ARCH sh
Subsystem: MAINTAINERS
Andrey Konovalov <andreyknvl@google.com>:
MAINTAINERS: update KASAN file list
MAINTAINERS: update Andrey Konovalov's email address
MAINTAINERS: add Andrey Konovalov to KASAN reviewers
Subsystem: h8300
Randy Dunlap <rdunlap@infradead.org>:
h8300: fix PREEMPTION build, TI_PRE_COUNT undefined
MAINTAINERS | 8 +++++---
arch/h8300/kernel/asm-offsets.c | 3 +++
arch/m68k/include/asm/page.h | 2 +-
scripts/recordmcount.pl | 6 +++++-
4 files changed, 14 insertions(+), 5 deletions(-)
^ permalink raw reply [flat|nested] 232+ messages in thread
* incoming
@ 2021-02-24 19:58 Andrew Morton
2021-02-24 21:30 ` incoming Linus Torvalds
0 siblings, 1 reply; 232+ messages in thread
From: Andrew Morton @ 2021-02-24 19:58 UTC (permalink / raw)
To: Linus Torvalds; +Cc: linux-mm, mm-commits
A few small subsystems and some of MM.
173 patches, based on c03c21ba6f4e95e406a1a7b4c34ef334b977c194.
Subsystems affected by this patch series:
hexagon
scripts
ntfs
ocfs2
vfs
mm/slab-generic
mm/slab
mm/slub
mm/debug
mm/pagecache
mm/swap
mm/memcg
mm/pagemap
mm/mprotect
mm/mremap
mm/page-reporting
mm/vmalloc
mm/kasan
mm/pagealloc
mm/memory-failure
mm/hugetlb
mm/vmscan
mm/z3fold
mm/compaction
mm/mempolicy
mm/oom-kill
mm/hugetlbfs
mm/migration
Subsystem: hexagon
Randy Dunlap <rdunlap@infradead.org>:
hexagon: remove CONFIG_EXPERIMENTAL from defconfigs
Subsystem: scripts
tangchunyou <tangchunyou@yulong.com>:
scripts/spelling.txt: increase error-prone spell checking
zuoqilin <zuoqilin@yulong.com>:
scripts/spelling.txt: check for "exeeds"
dingsenjie <dingsenjie@yulong.com>:
scripts/spelling.txt: add "allocted" and "exeeds" typo
Colin Ian King <colin.king@canonical.com>:
scripts/spelling.txt: add more spellings to spelling.txt
Subsystem: ntfs
Randy Dunlap <rdunlap@infradead.org>:
ntfs: layout.h: delete duplicated words
Rustam Kovhaev <rkovhaev@gmail.com>:
ntfs: check for valid standard information attribute
Subsystem: ocfs2
Yi Li <yili@winhong.com>:
ocfs2: remove redundant conditional before iput
guozh <guozh88@chinatelecom.cn>:
ocfs2: clean up some definitions which are not used any more
Dan Carpenter <dan.carpenter@oracle.com>:
ocfs2: fix a use after free on error
Jiapeng Chong <jiapeng.chong@linux.alibaba.com>:
ocfs2: simplify the calculation of variables
Subsystem: vfs
Randy Dunlap <rdunlap@infradead.org>:
fs: delete repeated words in comments
Alexey Dobriyan <adobriyan@gmail.com>:
ramfs: support O_TMPFILE
Subsystem: mm/slab-generic
Jacob Wen <jian.w.wen@oracle.com>:
mm, tracing: record slab name for kmem_cache_free()
Nikolay Borisov <nborisov@suse.com>:
mm/sl?b.c: remove ctor argument from kmem_cache_flags
Subsystem: mm/slab
Zhiyuan Dai <daizhiyuan@phytium.com.cn>:
mm/slab: minor coding style tweaks
Subsystem: mm/slub
Johannes Berg <johannes.berg@intel.com>:
mm/slub: disable user tracing for kmemleak caches by default
Vlastimil Babka <vbabka@suse.cz>:
Patch series "mm, slab, slub: remove cpu and memory hotplug locks":
mm, slub: stop freeing kmem_cache_node structures on node offline
mm, slab, slub: stop taking memory hotplug lock
mm, slab, slub: stop taking cpu hotplug lock
mm, slub: splice cpu and page freelists in deactivate_slab()
mm, slub: remove slub_memcg_sysfs boot param and CONFIG_SLUB_MEMCG_SYSFS_ON
Zhiyuan Dai <daizhiyuan@phytium.com.cn>:
mm/slub: minor coding style tweaks
Subsystem: mm/debug
"Matthew Wilcox (Oracle)" <willy@infradead.org>:
mm/debug: improve memcg debugging
Anshuman Khandual <anshuman.khandual@arm.com>:
Patch series "mm/debug_vm_pgtable: Some minor updates", v3:
mm/debug_vm_pgtable/basic: add validation for dirtiness after write protect
mm/debug_vm_pgtable/basic: iterate over entire protection_map[]
Miaohe Lin <linmiaohe@huawei.com>:
mm/page_owner: use helper function zone_end_pfn() to get end_pfn
Subsystem: mm/pagecache
Baolin Wang <baolin.wang@linux.alibaba.com>:
mm/filemap: remove unused parameter and change to void type for replace_page_cache_page()
Pavel Begunkov <asml.silence@gmail.com>:
mm/filemap: don't revert iter on -EIOCBQUEUED
"Matthew Wilcox (Oracle)" <willy@infradead.org>:
Patch series "Refactor generic_file_buffered_read", v5:
mm/filemap: rename generic_file_buffered_read subfunctions
mm/filemap: remove dynamically allocated array from filemap_read
mm/filemap: convert filemap_get_pages to take a pagevec
mm/filemap: use head pages in generic_file_buffered_read
mm/filemap: pass a sleep state to put_and_wait_on_page_locked
mm/filemap: support readpage splitting a page
mm/filemap: inline __wait_on_page_locked_async into caller
mm/filemap: don't call ->readpage if IOCB_WAITQ is set
mm/filemap: change filemap_read_page calling conventions
mm/filemap: change filemap_create_page calling conventions
mm/filemap: convert filemap_update_page to return an errno
mm/filemap: move the iocb checks into filemap_update_page
mm/filemap: add filemap_range_uptodate
mm/filemap: split filemap_readahead out of filemap_get_pages
mm/filemap: restructure filemap_get_pages
mm/filemap: don't relock the page after calling readpage
Christoph Hellwig <hch@lst.de>:
mm/filemap: rename generic_file_buffered_read to filemap_read
mm/filemap: simplify generic_file_read_iter
Yang Guo <guoyang2@huawei.com>:
fs/buffer.c: add checking buffer head stat before clear
Baolin Wang <baolin.wang@linux.alibaba.com>:
mm: backing-dev: Remove duplicated macro definition
Subsystem: mm/swap
Yang Li <abaci-bugfix@linux.alibaba.com>:
mm/swap_slots.c: remove redundant NULL check
Stephen Zhang <stephenzhangzsd@gmail.com>:
mm/swapfile.c: fix debugging information problem
Georgi Djakov <georgi.djakov@linaro.org>:
mm/page_io: use pr_alert_ratelimited for swap read/write errors
Rikard Falkeborn <rikard.falkeborn@gmail.com>:
mm/swap_state: constify static struct attribute_group
Yu Zhao <yuzhao@google.com>:
mm/swap: don't SetPageWorkingset unconditionally during swapin
Subsystem: mm/memcg
Roman Gushchin <guro@fb.com>:
mm: memcg/slab: pre-allocate obj_cgroups for slab caches with SLAB_ACCOUNT
Muchun Song <songmuchun@bytedance.com>:
mm: memcontrol: optimize per-lruvec stats counter memory usage
Patch series "Convert all THP vmstat counters to pages", v6:
mm: memcontrol: fix NR_ANON_THPS accounting in charge moving
mm: memcontrol: convert NR_ANON_THPS account to pages
mm: memcontrol: convert NR_FILE_THPS account to pages
mm: memcontrol: convert NR_SHMEM_THPS account to pages
mm: memcontrol: convert NR_SHMEM_PMDMAPPED account to pages
mm: memcontrol: convert NR_FILE_PMDMAPPED account to pages
mm: memcontrol: make the slab calculation consistent
Alex Shi <alex.shi@linux.alibaba.com>:
mm/memcg: revise the using condition of lock_page_lruvec function series
mm/memcg: remove rcu locking for lock_page_lruvec function series
Shakeel Butt <shakeelb@google.com>:
mm: memcg: add swapcache stat for memcg v2
Roman Gushchin <guro@fb.com>:
mm: kmem: make __memcg_kmem_(un)charge static
Feng Tang <feng.tang@intel.com>:
mm: page_counter: re-layout structure to reduce false sharing
Yang Li <abaci-bugfix@linux.alibaba.com>:
mm/memcontrol: remove redundant NULL check
Muchun Song <songmuchun@bytedance.com>:
mm: memcontrol: replace the loop with a list_for_each_entry()
Shakeel Butt <shakeelb@google.com>:
mm/list_lru.c: remove kvfree_rcu_local()
Johannes Weiner <hannes@cmpxchg.org>:
fs: buffer: use raw page_memcg() on locked page
Muchun Song <songmuchun@bytedance.com>:
mm: memcontrol: fix swap undercounting in cgroup2
mm: memcontrol: fix get_active_memcg return value
mm: memcontrol: fix slub memory accounting
Subsystem: mm/pagemap
Adrian Huang <ahuang12@lenovo.com>:
mm/mmap.c: remove unnecessary local variable
Miaohe Lin <linmiaohe@huawei.com>:
mm/memory.c: fix potential pte_unmap_unlock pte error
mm/pgtable-generic.c: simplify the VM_BUG_ON condition in pmdp_huge_clear_flush()
mm/pgtable-generic.c: optimize the VM_BUG_ON condition in pmdp_huge_clear_flush()
mm/memory.c: fix potential pte_unmap_unlock pte error
Subsystem: mm/mprotect
Tianjia Zhang <tianjia.zhang@linux.alibaba.com>:
mm/mprotect.c: optimize error detection in do_mprotect_pkey()
Subsystem: mm/mremap
Li Xinhai <lixinhai.lxh@gmail.com>:
mm: rmap: explicitly reset vma->anon_vma in unlink_anon_vmas()
mm: mremap: unlink anon_vmas when mremap with MREMAP_DONTUNMAP success
Subsystem: mm/page-reporting
sh <sh_def@163.com>:
mm/page_reporting: use list_entry_is_head() in page_reporting_cycle()
Subsystem: mm/vmalloc
Yang Li <abaci-bugfix@linux.alibaba.com>:
vmalloc: remove redundant NULL check
Subsystem: mm/kasan
Andrey Konovalov <andreyknvl@google.com>:
Patch series "kasan: HW_TAGS tests support and fixes", v4:
kasan: prefix global functions with kasan_
kasan: clarify HW_TAGS impact on TBI
kasan: clean up comments in tests
kasan: add macros to simplify checking test constraints
kasan: add match-all tag tests
kasan, arm64: allow using KUnit tests with HW_TAGS mode
kasan: rename CONFIG_TEST_KASAN_MODULE
kasan: add compiler barriers to KUNIT_EXPECT_KASAN_FAIL
kasan: adapt kmalloc_uaf2 test to HW_TAGS mode
kasan: fix memory corruption in kasan_bitops_tags test
kasan: move _RET_IP_ to inline wrappers
kasan: fix bug detection via ksize for HW_TAGS mode
kasan: add proper page allocator tests
kasan: add a test for kmem_cache_alloc/free_bulk
kasan: don't run tests when KASAN is not enabled
Walter Wu <walter-zh.wu@mediatek.com>:
kasan: remove redundant config option
Subsystem: mm/pagealloc
Baoquan He <bhe@redhat.com>:
Patch series "mm: clean up names and parameters of memmap_init_xxxx functions", v5:
mm: fix prototype warning from kernel test robot
mm: rename memmap_init() and memmap_init_zone()
mm: simplify parater of function memmap_init_zone()
mm: simplify parameter of setup_usemap()
mm: remove unneeded local variable in free_area_init_core
David Hildenbrand <david@redhat.com>:
Patch series "mm: simplify free_highmem_page() and free_reserved_page()":
video: fbdev: acornfb: remove free_unused_pages()
mm: simplify free_highmem_page() and free_reserved_page()
"Matthew Wilcox (Oracle)" <willy@infradead.org>:
mm/gfp: add kernel-doc for gfp_t
Subsystem: mm/memory-failure
Aili Yao <yaoaili@kingsoft.com>:
mm,hwpoison: send SIGBUS to PF_MCE_EARLY processes on action required events
Subsystem: mm/hugetlb
Bibo Mao <maobibo@loongson.cn>:
mm/huge_memory.c: update tlb entry if pmd is changed
MIPS: do not call flush_tlb_all when setting pmd entry
Miaohe Lin <linmiaohe@huawei.com>:
mm/hugetlb: fix potential double free in hugetlb_register_node() error path
Li Xinhai <lixinhai.lxh@gmail.com>:
mm/hugetlb.c: fix unnecessary address expansion of pmd sharing
Miaohe Lin <linmiaohe@huawei.com>:
mm/hugetlb: avoid unnecessary hugetlb_acct_memory() call
mm/hugetlb: use helper huge_page_order and pages_per_huge_page
mm/hugetlb: fix use after free when subpool max_hpages accounting is not enabled
Jiapeng Zhong <abaci-bugfix@linux.alibaba.com>:
mm/hugetlb: simplify the calculation of variables
Joao Martins <joao.m.martins@oracle.com>:
Patch series "mm/hugetlb: follow_hugetlb_page() improvements", v2:
mm/hugetlb: grab head page refcount once for group of subpages
mm/hugetlb: refactor subpage recording
Miaohe Lin <linmiaohe@huawei.com>:
mm/hugetlb: fix some comment typos
Yanfei Xu <yanfei.xu@windriver.com>:
mm/hugetlb: remove redundant check in preparing and destroying gigantic page
Zhiyuan Dai <daizhiyuan@phytium.com.cn>:
mm/hugetlb.c: fix typos in comments
Miaohe Lin <linmiaohe@huawei.com>:
mm/huge_memory.c: remove unused return value of set_huge_zero_page()
"Aneesh Kumar K.V" <aneesh.kumar@linux.ibm.com>:
mm/pmem: avoid inserting hugepage PTE entry with fsdax if hugepage support is disabled
Miaohe Lin <linmiaohe@huawei.com>:
hugetlb_cgroup: use helper pages_per_huge_page() in hugetlb_cgroup
mm/hugetlb: use helper function range_in_vma() in page_table_shareable()
mm/hugetlb: remove unnecessary VM_BUG_ON_PAGE on putback_active_hugepage()
mm/hugetlb: use helper huge_page_size() to get hugepage size
Mike Kravetz <mike.kravetz@oracle.com>:
hugetlb: fix update_and_free_page contig page struct assumption
hugetlb: fix copy_huge_page_from_user contig page struct assumption
Chen Wandun <chenwandun@huawei.com>:
mm/hugetlb: suppress wrong warning info when alloc gigantic page
Subsystem: mm/vmscan
Alex Shi <alex.shi@linux.alibaba.com>:
mm/vmscan: __isolate_lru_page_prepare() cleanup
Miaohe Lin <linmiaohe@huawei.com>:
mm/workingset.c: avoid unnecessary max_nodes estimation in count_shadow_nodes()
Yu Zhao <yuzhao@google.com>:
Patch series "mm: lru related cleanups", v2:
mm/vmscan.c: use add_page_to_lru_list()
include/linux/mm_inline.h: shuffle lru list addition and deletion functions
mm: don't pass "enum lru_list" to lru list addition functions
mm/swap.c: don't pass "enum lru_list" to trace_mm_lru_insertion()
mm/swap.c: don't pass "enum lru_list" to del_page_from_lru_list()
mm: add __clear_page_lru_flags() to replace page_off_lru()
mm: VM_BUG_ON lru page flags
include/linux/mm_inline.h: fold page_lru_base_type() into its sole caller
include/linux/mm_inline.h: fold __update_lru_size() into its sole caller
mm/vmscan.c: make lruvec_lru_size() static
Oscar Salvador <osalvador@suse.de>:
mm: workingset: clarify eviction order and distance calculation
Mike Kravetz <mike.kravetz@oracle.com>:
Patch series "create hugetlb flags to consolidate state", v3:
hugetlb: use page.private for hugetlb specific page flags
hugetlb: convert page_huge_active() HPageMigratable flag
hugetlb: convert PageHugeTemporary() to HPageTemporary flag
hugetlb: convert PageHugeFreed to HPageFreed flag
include/linux/hugetlb.h: add synchronization information for new hugetlb specific flags
hugetlb: fix uninitialized subpool pointer
Dave Hansen <dave.hansen@linux.intel.com>:
mm/vmscan: restore zone_reclaim_mode ABI
Subsystem: mm/z3fold
Miaohe Lin <linmiaohe@huawei.com>:
z3fold: remove unused attribute for release_z3fold_page
z3fold: simplify the zhdr initialization code in init_z3fold_page()
Subsystem: mm/compaction
Alex Shi <alex.shi@linux.alibaba.com>:
mm/compaction: remove rcu_read_lock during page compaction
Miaohe Lin <linmiaohe@huawei.com>:
mm/compaction: remove duplicated VM_BUG_ON_PAGE !PageLocked
Charan Teja Reddy <charante@codeaurora.org>:
mm/compaction: correct deferral logic for proactive compaction
Wonhyuk Yang <vvghjk1234@gmail.com>:
mm/compaction: fix misbehaviors of fast_find_migrateblock()
Vlastimil Babka <vbabka@suse.cz>:
mm, compaction: make fast_isolate_freepages() stay within zone
Subsystem: mm/mempolicy
Huang Ying <ying.huang@intel.com>:
numa balancing: migrate on fault among multiple bound nodes
Miaohe Lin <linmiaohe@huawei.com>:
mm/mempolicy: use helper range_in_vma() in queue_pages_test_walk()
Subsystem: mm/oom-kill
Tang Yizhou <tangyizhou@huawei.com>:
mm, oom: fix a comment in dump_task()
Subsystem: mm/hugetlbfs
Mike Kravetz <mike.kravetz@oracle.com>:
mm/hugetlb: change hugetlb_reserve_pages() to type bool
hugetlbfs: remove special hugetlbfs_set_page_dirty()
Miaohe Lin <linmiaohe@huawei.com>:
hugetlbfs: remove useless BUG_ON(!inode) in hugetlbfs_setattr()
hugetlbfs: use helper macro default_hstate in init_hugetlbfs_fs
hugetlbfs: correct obsolete function name in hugetlbfs_read_iter()
hugetlbfs: remove meaningless variable avoid_reserve
hugetlbfs: make hugepage size conversion more readable
hugetlbfs: correct some obsolete comments about inode i_mutex
hugetlbfs: fix some comment typos
hugetlbfs: remove unneeded return value of hugetlb_vmtruncate()
Subsystem: mm/migration
Chengyang Fan <cy.fan@huawei.com>:
mm/migrate: remove unneeded semicolons
Documentation/admin-guide/cgroup-v2.rst | 4
Documentation/admin-guide/kernel-parameters.txt | 8
Documentation/admin-guide/sysctl/vm.rst | 10
Documentation/core-api/mm-api.rst | 7
Documentation/dev-tools/kasan.rst | 24
Documentation/vm/arch_pgtable_helpers.rst | 8
arch/arm64/include/asm/memory.h | 1
arch/arm64/include/asm/mte-kasan.h | 12
arch/arm64/kernel/mte.c | 12
arch/arm64/kernel/sleep.S | 2
arch/arm64/mm/fault.c | 20
arch/hexagon/configs/comet_defconfig | 1
arch/ia64/include/asm/pgtable.h | 6
arch/ia64/mm/init.c | 18
arch/mips/mm/pgtable-32.c | 1
arch/mips/mm/pgtable-64.c | 1
arch/x86/kernel/acpi/wakeup_64.S | 2
drivers/base/node.c | 33
drivers/video/fbdev/acornfb.c | 34
fs/block_dev.c | 2
fs/btrfs/file.c | 2
fs/buffer.c | 7
fs/dcache.c | 4
fs/direct-io.c | 4
fs/exec.c | 4
fs/fhandle.c | 2
fs/fuse/dev.c | 6
fs/hugetlbfs/inode.c | 72 --
fs/ntfs/inode.c | 6
fs/ntfs/layout.h | 4
fs/ocfs2/cluster/heartbeat.c | 8
fs/ocfs2/dlm/dlmast.c | 10
fs/ocfs2/dlm/dlmcommon.h | 4
fs/ocfs2/refcounttree.c | 2
fs/ocfs2/super.c | 2
fs/pipe.c | 2
fs/proc/meminfo.c | 10
fs/proc/vmcore.c | 7
fs/ramfs/inode.c | 13
include/linux/fs.h | 4
include/linux/gfp.h | 14
include/linux/highmem-internal.h | 5
include/linux/huge_mm.h | 15
include/linux/hugetlb.h | 98 ++
include/linux/kasan-checks.h | 6
include/linux/kasan.h | 39 -
include/linux/memcontrol.h | 43 -
include/linux/migrate.h | 2
include/linux/mm.h | 28
include/linux/mm_inline.h | 123 +--
include/linux/mmzone.h | 30
include/linux/page-flags.h | 6
include/linux/page_counter.h | 9
include/linux/pagemap.h | 5
include/linux/swap.h | 8
include/trace/events/kmem.h | 24
include/trace/events/pagemap.h | 11
include/uapi/linux/mempolicy.h | 4
init/Kconfig | 14
lib/Kconfig.kasan | 14
lib/Makefile | 2
lib/test_kasan.c | 446 ++++++++----
lib/test_kasan_module.c | 5
mm/backing-dev.c | 6
mm/compaction.c | 73 +-
mm/debug.c | 10
mm/debug_vm_pgtable.c | 86 ++
mm/filemap.c | 859 +++++++++++-------------
mm/gup.c | 5
mm/huge_memory.c | 28
mm/hugetlb.c | 376 ++++------
mm/hugetlb_cgroup.c | 6
mm/kasan/common.c | 60 -
mm/kasan/generic.c | 40 -
mm/kasan/hw_tags.c | 16
mm/kasan/kasan.h | 87 +-
mm/kasan/quarantine.c | 22
mm/kasan/report.c | 15
mm/kasan/report_generic.c | 10
mm/kasan/report_hw_tags.c | 8
mm/kasan/report_sw_tags.c | 8
mm/kasan/shadow.c | 27
mm/kasan/sw_tags.c | 22
mm/khugepaged.c | 6
mm/list_lru.c | 12
mm/memcontrol.c | 309 ++++----
mm/memory-failure.c | 34
mm/memory.c | 24
mm/memory_hotplug.c | 11
mm/mempolicy.c | 18
mm/mempool.c | 2
mm/migrate.c | 10
mm/mlock.c | 3
mm/mmap.c | 4
mm/mprotect.c | 7
mm/mremap.c | 8
mm/oom_kill.c | 5
mm/page_alloc.c | 70 -
mm/page_io.c | 12
mm/page_owner.c | 4
mm/page_reporting.c | 2
mm/pgtable-generic.c | 9
mm/rmap.c | 35
mm/shmem.c | 2
mm/slab.c | 21
mm/slab.h | 20
mm/slab_common.c | 40 -
mm/slob.c | 2
mm/slub.c | 169 ++--
mm/swap.c | 54 -
mm/swap_slots.c | 3
mm/swap_state.c | 31
mm/swapfile.c | 8
mm/vmscan.c | 100 +-
mm/vmstat.c | 14
mm/workingset.c | 7
mm/z3fold.c | 11
scripts/Makefile.kasan | 10
scripts/spelling.txt | 30
tools/objtool/check.c | 2
120 files changed, 2249 insertions(+), 1954 deletions(-)
^ permalink raw reply [flat|nested] 232+ messages in thread
* Re: incoming
2021-02-24 19:58 incoming Andrew Morton
@ 2021-02-24 21:30 ` Linus Torvalds
2021-02-24 21:37 ` incoming Linus Torvalds
0 siblings, 1 reply; 232+ messages in thread
From: Linus Torvalds @ 2021-02-24 21:30 UTC (permalink / raw)
To: Andrew Morton; +Cc: Linux-MM, mm-commits
On Wed, Feb 24, 2021 at 11:58 AM Andrew Morton
<akpm@linux-foundation.org> wrote:
>
> A few small subsystems and some of MM.
Hmm. I haven't bisected things yet, but I suspect it's something with
the KASAN patches. With this all applied, I get:
lib/crypto/curve25519-hacl64.c: In function ‘ladder_cmult.constprop’:
lib/crypto/curve25519-hacl64.c:601:1: warning: the frame size of
2288 bytes is larger than 2048 bytes [-Wframe-larger-than=]
and
lib/bitfield_kunit.c: In function ‘test_bitfields_constants’:
lib/bitfield_kunit.c:93:1: warning: the frame size of 11200 bytes is
larger than 2048 bytes [-Wframe-larger-than=]
which is obviously not really acceptable. A 11kB stack frame _will_
cause issues.
Linus
^ permalink raw reply [flat|nested] 232+ messages in thread
* Re: incoming
2021-02-24 21:30 ` incoming Linus Torvalds
@ 2021-02-24 21:37 ` Linus Torvalds
2021-02-25 8:53 ` incoming Arnd Bergmann
0 siblings, 1 reply; 232+ messages in thread
From: Linus Torvalds @ 2021-02-24 21:37 UTC (permalink / raw)
To: Andrew Morton, Walter Wu, Dmitry Vyukov, Nathan Chancellor,
Arnd Bergmann, Andrey Konovalov
Cc: Linux-MM, mm-commits, Andrey Ryabinin, Alexander Potapenko
On Wed, Feb 24, 2021 at 1:30 PM Linus Torvalds
<torvalds@linux-foundation.org> wrote:
>
> Hmm. I haven't bisected things yet, but I suspect it's something with
> the KASAN patches. With this all applied, I get:
>
> lib/crypto/curve25519-hacl64.c: In function ‘ladder_cmult.constprop’:
> lib/crypto/curve25519-hacl64.c:601:1: warning: the frame size of
> 2288 bytes is larger than 2048 bytes [-Wframe-larger-than=]
>
> and
>
> lib/bitfield_kunit.c: In function ‘test_bitfields_constants’:
> lib/bitfield_kunit.c:93:1: warning: the frame size of 11200 bytes is
> larger than 2048 bytes [-Wframe-larger-than=]
>
> which is obviously not really acceptable. A 11kB stack frame _will_
> cause issues.
A quick bisect shoes that this was introduced by "[patch 101/173]
kasan: remove redundant config option".
I didn't check what part of that patch screws up, but it's definitely
doing something bad.
I will drop that patch.
Linus
^ permalink raw reply [flat|nested] 232+ messages in thread
* Re: incoming
2021-02-24 21:37 ` incoming Linus Torvalds
@ 2021-02-25 8:53 ` Arnd Bergmann
2021-02-25 9:12 ` incoming Andrey Ryabinin
0 siblings, 1 reply; 232+ messages in thread
From: Arnd Bergmann @ 2021-02-25 8:53 UTC (permalink / raw)
To: Linus Torvalds
Cc: Andrew Morton, Walter Wu, Dmitry Vyukov, Nathan Chancellor,
Arnd Bergmann, Andrey Konovalov, Linux-MM, mm-commits,
Andrey Ryabinin, Alexander Potapenko
On Wed, Feb 24, 2021 at 10:37 PM Linus Torvalds
<torvalds@linux-foundation.org> wrote:
>
> On Wed, Feb 24, 2021 at 1:30 PM Linus Torvalds
> <torvalds@linux-foundation.org> wrote:
> >
> > Hmm. I haven't bisected things yet, but I suspect it's something with
> > the KASAN patches. With this all applied, I get:
> >
> > lib/crypto/curve25519-hacl64.c: In function ‘ladder_cmult.constprop’:
> > lib/crypto/curve25519-hacl64.c:601:1: warning: the frame size of
> > 2288 bytes is larger than 2048 bytes [-Wframe-larger-than=]
> >
> > and
> >
> > lib/bitfield_kunit.c: In function ‘test_bitfields_constants’:
> > lib/bitfield_kunit.c:93:1: warning: the frame size of 11200 bytes is
> > larger than 2048 bytes [-Wframe-larger-than=]
> >
> > which is obviously not really acceptable. A 11kB stack frame _will_
> > cause issues.
>
> A quick bisect shoes that this was introduced by "[patch 101/173]
> kasan: remove redundant config option".
>
> I didn't check what part of that patch screws up, but it's definitely
> doing something bad.
I'm not sure why that patch surfaced the bug, but it's worth pointing
out that the underlying problem is asan-stack in combination
with the structleak plugin. This will happen for every user of kunit.
I sent a series[1] out earlier this year to turn off the structleak
plugin as an alternative workaround, but need to follow up on
the remaining patches. Someone suggested adding a more
generic way to turn off the plugin for a file instead of open-coding
the CLFAGS_REMOVE_*.o Makefile bit, which would help.
I am also still hoping that someone can come up with a way
to make kunit work better with the structleak plugin, as there
shouldn't be a fundamental reason why it can't work, just that
it the code pattern triggers a particularly bad case in the compiler.
Arnd
[1] https://lore.kernel.org/lkml/20210125124533.101339-1-arnd@kernel.org/
^ permalink raw reply [flat|nested] 232+ messages in thread
* Re: incoming
2021-02-25 8:53 ` incoming Arnd Bergmann
@ 2021-02-25 9:12 ` Andrey Ryabinin
2021-02-25 11:07 ` incoming Walter Wu
0 siblings, 1 reply; 232+ messages in thread
From: Andrey Ryabinin @ 2021-02-25 9:12 UTC (permalink / raw)
To: Arnd Bergmann
Cc: Linus Torvalds, Andrew Morton, Walter Wu, Dmitry Vyukov,
Nathan Chancellor, Arnd Bergmann, Andrey Konovalov, Linux-MM,
mm-commits, Andrey Ryabinin, Alexander Potapenko
On Thu, Feb 25, 2021 at 11:53 AM Arnd Bergmann <arnd@kernel.org> wrote:
>
> On Wed, Feb 24, 2021 at 10:37 PM Linus Torvalds
> <torvalds@linux-foundation.org> wrote:
> >
> > On Wed, Feb 24, 2021 at 1:30 PM Linus Torvalds
> > <torvalds@linux-foundation.org> wrote:
> > >
> > > Hmm. I haven't bisected things yet, but I suspect it's something with
> > > the KASAN patches. With this all applied, I get:
> > >
> > > lib/crypto/curve25519-hacl64.c: In function ‘ladder_cmult.constprop’:
> > > lib/crypto/curve25519-hacl64.c:601:1: warning: the frame size of
> > > 2288 bytes is larger than 2048 bytes [-Wframe-larger-than=]
> > >
> > > and
> > >
> > > lib/bitfield_kunit.c: In function ‘test_bitfields_constants’:
> > > lib/bitfield_kunit.c:93:1: warning: the frame size of 11200 bytes is
> > > larger than 2048 bytes [-Wframe-larger-than=]
> > >
> > > which is obviously not really acceptable. A 11kB stack frame _will_
> > > cause issues.
> >
> > A quick bisect shoes that this was introduced by "[patch 101/173]
> > kasan: remove redundant config option".
> >
> > I didn't check what part of that patch screws up, but it's definitely
> > doing something bad.
>
> I'm not sure why that patch surfaced the bug, but it's worth pointing
> out that the underlying problem is asan-stack in combination
> with the structleak plugin. This will happen for every user of kunit.
>
The patch didn't update KASAN_STACK dependency in kconfig:
config GCC_PLUGIN_STRUCTLEAK_BYREF
....
depends on !(KASAN && KASAN_STACK=1)
This 'depends on' stopped working with the patch
^ permalink raw reply [flat|nested] 232+ messages in thread
* Re: incoming
2021-02-25 9:12 ` incoming Andrey Ryabinin
@ 2021-02-25 11:07 ` Walter Wu
0 siblings, 0 replies; 232+ messages in thread
From: Walter Wu @ 2021-02-25 11:07 UTC (permalink / raw)
To: Andrey Ryabinin
Cc: Arnd Bergmann, Linus Torvalds, Andrew Morton, Dmitry Vyukov,
Nathan Chancellor, Arnd Bergmann, Andrey Konovalov, Linux-MM,
mm-commits, Andrey Ryabinin, Alexander Potapenko
Hi Andrey,
On Thu, 2021-02-25 at 12:12 +0300, Andrey Ryabinin wrote:
> On Thu, Feb 25, 2021 at 11:53 AM Arnd Bergmann <arnd@kernel.org> wrote:
> >
> > On Wed, Feb 24, 2021 at 10:37 PM Linus Torvalds
> > <torvalds@linux-foundation.org> wrote:
> > >
> > > On Wed, Feb 24, 2021 at 1:30 PM Linus Torvalds
> > > <torvalds@linux-foundation.org> wrote:
> > > >
> > > > Hmm. I haven't bisected things yet, but I suspect it's something with
> > > > the KASAN patches. With this all applied, I get:
> > > >
> > > > lib/crypto/curve25519-hacl64.c: In function ‘ladder_cmult.constprop’:
> > > > lib/crypto/curve25519-hacl64.c:601:1: warning: the frame size of
> > > > 2288 bytes is larger than 2048 bytes [-Wframe-larger-than=]
> > > >
> > > > and
> > > >
> > > > lib/bitfield_kunit.c: In function ‘test_bitfields_constants’:
> > > > lib/bitfield_kunit.c:93:1: warning: the frame size of 11200 bytes is
> > > > larger than 2048 bytes [-Wframe-larger-than=]
> > > >
> > > > which is obviously not really acceptable. A 11kB stack frame _will_
> > > > cause issues.
> > >
> > > A quick bisect shoes that this was introduced by "[patch 101/173]
> > > kasan: remove redundant config option".
> > >
> > > I didn't check what part of that patch screws up, but it's definitely
> > > doing something bad.
> >
> > I'm not sure why that patch surfaced the bug, but it's worth pointing
> > out that the underlying problem is asan-stack in combination
> > with the structleak plugin. This will happen for every user of kunit.
> >
>
> The patch didn't update KASAN_STACK dependency in kconfig:
> config GCC_PLUGIN_STRUCTLEAK_BYREF
> ....
> depends on !(KASAN && KASAN_STACK=1)
>
> This 'depends on' stopped working with the patch
Thanks for pointing out this problem. I will re-send that patch.
Walter
^ permalink raw reply [flat|nested] 232+ messages in thread
* incoming
@ 2021-02-26 1:14 Andrew Morton
2021-02-26 17:55 ` incoming Linus Torvalds
0 siblings, 1 reply; 232+ messages in thread
From: Andrew Morton @ 2021-02-26 1:14 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm
- The rest of MM.
Includes kfence - another runtime memory validator. Not as
thorough as KASAN, but it has unmeasurable overhead and is intended
to be usable in production builds.
- Everything else
118 patches, based on 6fbd6cf85a3be127454a1ad58525a3adcf8612ab.
Subsystems affected by this patch series:
mm/thp
mm/cma
mm/vmstat
mm/memory-hotplug
mm/mlock
mm/rmap
mm/zswap
mm/zsmalloc
mm/cleanups
mm/kfence
mm/kasan2
alpha
procfs
sysctl
misc
core-kernel
MAINTAINERS
lib
bitops
checkpatch
init
coredump
seq_file
gdb
ubsan
initramfs
mm/pagemap2
Subsystem: mm/thp
"Matthew Wilcox (Oracle)" <willy@infradead.org>:
Patch series "Overhaul multi-page lookups for THP", v4:
mm: make pagecache tagged lookups return only head pages
mm/shmem: use pagevec_lookup in shmem_unlock_mapping
mm/swap: optimise get_shadow_from_swap_cache
mm: add FGP_ENTRY
mm/filemap: rename find_get_entry to mapping_get_entry
mm/filemap: add helper for finding pages
mm/filemap: add mapping_seek_hole_data
iomap: use mapping_seek_hole_data
mm: add and use find_lock_entries
mm: add an 'end' parameter to find_get_entries
mm: add an 'end' parameter to pagevec_lookup_entries
mm: remove nr_entries parameter from pagevec_lookup_entries
mm: pass pvec directly to find_get_entries
mm: remove pagevec_lookup_entries
Rik van Riel <riel@surriel.com>:
Patch series "mm,thp,shm: limit shmem THP alloc gfp_mask", v6:
mm,thp,shmem: limit shmem THP alloc gfp_mask
mm,thp,shm: limit gfp mask to no more than specified
mm,thp,shmem: make khugepaged obey tmpfs mount flags
mm,shmem,thp: limit shmem THP allocations to requested zones
Subsystem: mm/cma
Roman Gushchin <guro@fb.com>:
mm: cma: allocate cma areas bottom-up
David Hildenbrand <david@redhat.com>:
mm/cma: expose all pages to the buddy if activation of an area fails
mm/page_alloc: count CMA pages per zone and print them in /proc/zoneinfo
Patrick Daly <pdaly@codeaurora.org>:
mm: cma: print region name on failure
Subsystem: mm/vmstat
Johannes Weiner <hannes@cmpxchg.org>:
mm: vmstat: fix NOHZ wakeups for node stat changes
mm: vmstat: add some comments on internal storage of byte items
Jiang Biao <benbjiang@tencent.com>:
mm/vmstat.c: erase latency in vmstat_shepherd
Subsystem: mm/memory-hotplug
Dan Williams <dan.j.williams@intel.com>:
Patch series "mm: Fix pfn_to_online_page() with respect to ZONE_DEVICE", v4:
mm: move pfn_to_online_page() out of line
mm: teach pfn_to_online_page() to consider subsection validity
mm: teach pfn_to_online_page() about ZONE_DEVICE section collisions
mm: fix memory_failure() handling of dax-namespace metadata
Anshuman Khandual <anshuman.khandual@arm.com>:
mm/memory_hotplug: rename all existing 'memhp' into 'mhp'
David Hildenbrand <david@redhat.com>:
mm/memory_hotplug: MEMHP_MERGE_RESOURCE -> MHP_MERGE_RESOURCE
Miaohe Lin <linmiaohe@huawei.com>:
mm/memory_hotplug: use helper function zone_end_pfn() to get end_pfn
David Hildenbrand <david@redhat.com>:
drivers/base/memory: don't store phys_device in memory blocks
Documentation: sysfs/memory: clarify some memory block device properties
Anshuman Khandual <anshuman.khandual@arm.com>:
Patch series "mm/memory_hotplug: Pre-validate the address range with platform", v5:
mm/memory_hotplug: prevalidate the address range being added with platform
arm64/mm: define arch_get_mappable_range()
s390/mm: define arch_get_mappable_range()
David Hildenbrand <david@redhat.com>:
virtio-mem: check against mhp_get_pluggable_range() which memory we can hotplug
Subsystem: mm/mlock
Miaohe Lin <linmiaohe@huawei.com>:
mm/mlock: stop counting mlocked pages when none vma is found
Subsystem: mm/rmap
Miaohe Lin <linmiaohe@huawei.com>:
mm/rmap: correct some obsolete comments of anon_vma
mm/rmap: remove unneeded semicolon in page_not_mapped()
mm/rmap: fix obsolete comment in __page_check_anon_rmap()
mm/rmap: use page_not_mapped in try_to_unmap()
mm/rmap: correct obsolete comment of page_get_anon_vma()
mm/rmap: fix potential pte_unmap on an not mapped pte
Subsystem: mm/zswap
Randy Dunlap <rdunlap@infradead.org>:
mm: zswap: clean up confusing comment
Tian Tao <tiantao6@hisilicon.com>:
Patch series "Fix the compatibility of zsmalloc and zswap":
mm/zswap: add the flag can_sleep_mapped
mm: set the sleep_mapped to true for zbud and z3fold
Subsystem: mm/zsmalloc
Miaohe Lin <linmiaohe@huawei.com>:
mm/zsmalloc.c: convert to use kmem_cache_zalloc in cache_alloc_zspage()
Rokudo Yan <wu-yan@tcl.com>:
zsmalloc: account the number of compacted pages correctly
Miaohe Lin <linmiaohe@huawei.com>:
mm/zsmalloc.c: use page_private() to access page->private
Subsystem: mm/cleanups
Guo Ren <guoren@linux.alibaba.com>:
mm: page-flags.h: Typo fix (It -> If)
Daniel Vetter <daniel.vetter@ffwll.ch>:
mm/dmapool: use might_alloc()
mm/backing-dev.c: use might_alloc()
Stephen Zhang <stephenzhangzsd@gmail.com>:
mm/early_ioremap.c: use __func__ instead of function name
Subsystem: mm/kfence
Alexander Potapenko <glider@google.com>:
Patch series "KFENCE: A low-overhead sampling-based memory safety error detector", v7:
mm: add Kernel Electric-Fence infrastructure
x86, kfence: enable KFENCE for x86
Marco Elver <elver@google.com>:
arm64, kfence: enable KFENCE for ARM64
kfence: use pt_regs to generate stack trace on faults
Alexander Potapenko <glider@google.com>:
mm, kfence: insert KFENCE hooks for SLAB
mm, kfence: insert KFENCE hooks for SLUB
kfence, kasan: make KFENCE compatible with KASAN
Marco Elver <elver@google.com>:
kfence, Documentation: add KFENCE documentation
kfence: add test suite
MAINTAINERS: add entry for KFENCE
kfence: report sensitive information based on no_hash_pointers
Alexander Potapenko <glider@google.com>:
Patch series "Add error_report_end tracepoint to KFENCE and KASAN", v3:
tracing: add error_report_end trace point
kfence: use error_report_end tracepoint
kasan: use error_report_end tracepoint
Subsystem: mm/kasan2
Andrey Konovalov <andreyknvl@google.com>:
Patch series "kasan: optimizations and fixes for HW_TAGS", v4:
kasan, mm: don't save alloc stacks twice
kasan, mm: optimize kmalloc poisoning
kasan: optimize large kmalloc poisoning
kasan: clean up setting free info in kasan_slab_free
kasan: unify large kfree checks
kasan: rework krealloc tests
kasan, mm: fail krealloc on freed objects
kasan, mm: optimize krealloc poisoning
kasan: ensure poisoning size alignment
arm64: kasan: simplify and inline MTE functions
kasan: inline HW_TAGS helper functions
kasan: clarify that only first bug is reported in HW_TAGS
Subsystem: alpha
Randy Dunlap <rdunlap@infradead.org>:
alpha: remove CONFIG_EXPERIMENTAL from defconfigs
Subsystem: procfs
Helge Deller <deller@gmx.de>:
proc/wchan: use printk format instead of lookup_symbol_name()
Josef Bacik <josef@toxicpanda.com>:
proc: use kvzalloc for our kernel buffer
Subsystem: sysctl
Lin Feng <linf@wangsu.com>:
sysctl.c: fix underflow value setting risk in vm_table
Subsystem: misc
Randy Dunlap <rdunlap@infradead.org>:
include/linux: remove repeated words
Miguel Ojeda <ojeda@kernel.org>:
treewide: Miguel has moved
Subsystem: core-kernel
Hubert Jasudowicz <hubert.jasudowicz@gmail.com>:
groups: use flexible-array member in struct group_info
groups: simplify struct group_info allocation
Randy Dunlap <rdunlap@infradead.org>:
kernel: delete repeated words in comments
Subsystem: MAINTAINERS
Vlastimil Babka <vbabka@suse.cz>:
MAINTAINERS: add uapi directories to API/ABI section
Subsystem: lib
Huang Shijie <sjhuang@iluvatar.ai>:
lib/genalloc.c: change return type to unsigned long for bitmap_set_ll
Francis Laniel <laniel_francis@privacyrequired.com>:
string.h: move fortified functions definitions in a dedicated header.
Yogesh Lal <ylal@codeaurora.org>:
lib: stackdepot: add support to configure STACK_HASH_SIZE
Vijayanand Jitta <vjitta@codeaurora.org>:
lib: stackdepot: add support to disable stack depot
lib: stackdepot: fix ignoring return value warning
Masahiro Yamada <masahiroy@kernel.org>:
lib/cmdline: remove an unneeded local variable in next_arg()
Subsystem: bitops
Geert Uytterhoeven <geert+renesas@glider.be>:
include/linux/bitops.h: spelling s/synomyn/synonym/
Subsystem: checkpatch
Joe Perches <joe@perches.com>:
checkpatch: improve blank line after declaration test
Peng Wang <rocking@linux.alibaba.com>:
checkpatch: ignore warning designated initializers using NR_CPUS
Dwaipayan Ray <dwaipayanray1@gmail.com>:
checkpatch: trivial style fixes
Joe Perches <joe@perches.com>:
checkpatch: prefer ftrace over function entry/exit printks
checkpatch: improve TYPECAST_INT_CONSTANT test message
Aditya Srivastava <yashsri421@gmail.com>:
checkpatch: add warning for avoiding .L prefix symbols in assembly files
Joe Perches <joe@perches.com>:
checkpatch: add kmalloc_array_node to unnecessary OOM message check
Chris Down <chris@chrisdown.name>:
checkpatch: don't warn about colon termination in linker scripts
Song Liu <songliubraving@fb.com>:
checkpatch: do not apply "initialise globals to 0" check to BPF progs
Subsystem: init
Masahiro Yamada <masahiroy@kernel.org>:
init/version.c: remove Version_<LINUX_VERSION_CODE> symbol
init: clean up early_param_on_off() macro
Bhaskar Chowdhury <unixbhaskar@gmail.com>:
init/Kconfig: fix a typo in CC_VERSION_TEXT help text
Subsystem: coredump
Ira Weiny <ira.weiny@intel.com>:
fs/coredump: use kmap_local_page()
Subsystem: seq_file
NeilBrown <neilb@suse.de>:
Patch series "Fix some seq_file users that were recently broken":
seq_file: document how per-entry resources are managed.
x86: fix seq_file iteration for pat/memtype.c
Subsystem: gdb
George Prekas <prekageo@amazon.com>:
scripts/gdb: fix list_for_each
Sumit Garg <sumit.garg@linaro.org>:
kgdb: fix to kill breakpoints on initmem after boot
Subsystem: ubsan
Andrey Ryabinin <ryabinin.a.a@gmail.com>:
ubsan: remove overflow checks
Subsystem: initramfs
Florian Fainelli <f.fainelli@gmail.com>:
initramfs: panic with memory information
Subsystem: mm/pagemap2
Huang Pei <huangpei@loongson.cn>:
MIPS: make userspace mapping young by default
.mailmap | 1
CREDITS | 9
Documentation/ABI/testing/sysfs-devices-memory | 58 -
Documentation/admin-guide/auxdisplay/cfag12864b.rst | 2
Documentation/admin-guide/auxdisplay/ks0108.rst | 2
Documentation/admin-guide/kernel-parameters.txt | 6
Documentation/admin-guide/mm/memory-hotplug.rst | 20
Documentation/dev-tools/index.rst | 1
Documentation/dev-tools/kasan.rst | 8
Documentation/dev-tools/kfence.rst | 318 +++++++
Documentation/filesystems/seq_file.rst | 6
MAINTAINERS | 26
arch/alpha/configs/defconfig | 1
arch/arm64/Kconfig | 1
arch/arm64/include/asm/cache.h | 1
arch/arm64/include/asm/kasan.h | 1
arch/arm64/include/asm/kfence.h | 26
arch/arm64/include/asm/mte-def.h | 2
arch/arm64/include/asm/mte-kasan.h | 65 +
arch/arm64/include/asm/mte.h | 2
arch/arm64/kernel/mte.c | 46 -
arch/arm64/lib/mte.S | 16
arch/arm64/mm/fault.c | 8
arch/arm64/mm/mmu.c | 23
arch/mips/mm/cache.c | 30
arch/s390/mm/init.c | 1
arch/s390/mm/vmem.c | 14
arch/x86/Kconfig | 1
arch/x86/include/asm/kfence.h | 76 +
arch/x86/mm/fault.c | 10
arch/x86/mm/pat/memtype.c | 4
drivers/auxdisplay/cfag12864b.c | 4
drivers/auxdisplay/cfag12864bfb.c | 4
drivers/auxdisplay/ks0108.c | 4
drivers/base/memory.c | 35
drivers/block/zram/zram_drv.c | 2
drivers/hv/hv_balloon.c | 2
drivers/virtio/virtio_mem.c | 43
drivers/xen/balloon.c | 2
fs/coredump.c | 4
fs/iomap/seek.c | 125 --
fs/proc/base.c | 21
fs/proc/proc_sysctl.c | 4
include/linux/bitops.h | 2
include/linux/cfag12864b.h | 2
include/linux/cred.h | 2
include/linux/fortify-string.h | 302 ++++++
include/linux/gfp.h | 2
include/linux/init.h | 4
include/linux/kasan.h | 25
include/linux/kfence.h | 230 +++++
include/linux/kgdb.h | 2
include/linux/khugepaged.h | 2
include/linux/ks0108.h | 2
include/linux/mdev.h | 2
include/linux/memory.h | 3
include/linux/memory_hotplug.h | 33
include/linux/memremap.h | 6
include/linux/mmzone.h | 49 -
include/linux/page-flags.h | 4
include/linux/pagemap.h | 10
include/linux/pagevec.h | 10
include/linux/pgtable.h | 8
include/linux/ptrace.h | 2
include/linux/rmap.h | 3
include/linux/slab_def.h | 3
include/linux/slub_def.h | 3
include/linux/stackdepot.h | 9
include/linux/string.h | 282 ------
include/linux/vmstat.h | 6
include/linux/zpool.h | 3
include/linux/zsmalloc.h | 2
include/trace/events/error_report.h | 74 +
include/uapi/linux/firewire-cdev.h | 2
include/uapi/linux/input.h | 2
init/Kconfig | 2
init/initramfs.c | 19
init/main.c | 6
init/version.c | 8
kernel/debug/debug_core.c | 11
kernel/events/core.c | 8
kernel/events/uprobes.c | 2
kernel/groups.c | 7
kernel/locking/rtmutex.c | 4
kernel/locking/rwsem.c | 2
kernel/locking/semaphore.c | 2
kernel/sched/fair.c | 2
kernel/sched/membarrier.c | 2
kernel/sysctl.c | 8
kernel/trace/Makefile | 1
kernel/trace/error_report-traces.c | 12
lib/Kconfig | 9
lib/Kconfig.debug | 1
lib/Kconfig.kfence | 84 +
lib/Kconfig.ubsan | 17
lib/cmdline.c | 7
lib/genalloc.c | 3
lib/stackdepot.c | 41
lib/test_kasan.c | 111 ++
lib/test_ubsan.c | 49 -
lib/ubsan.c | 68 -
mm/Makefile | 1
mm/backing-dev.c | 3
mm/cma.c | 64 -
mm/dmapool.c | 3
mm/early_ioremap.c | 12
mm/filemap.c | 361 +++++---
mm/huge_memory.c | 6
mm/internal.h | 6
mm/kasan/common.c | 213 +++-
mm/kasan/generic.c | 3
mm/kasan/hw_tags.c | 2
mm/kasan/kasan.h | 97 +-
mm/kasan/report.c | 8
mm/kasan/shadow.c | 78 +
mm/kfence/Makefile | 6
mm/kfence/core.c | 875 +++++++++++++++++++-
mm/kfence/kfence.h | 126 ++
mm/kfence/kfence_test.c | 860 +++++++++++++++++++
mm/kfence/report.c | 350 ++++++--
mm/khugepaged.c | 22
mm/memory-failure.c | 6
mm/memory.c | 4
mm/memory_hotplug.c | 178 +++-
mm/memremap.c | 23
mm/mlock.c | 2
mm/page_alloc.c | 1
mm/rmap.c | 24
mm/shmem.c | 160 +--
mm/slab.c | 38
mm/slab_common.c | 29
mm/slub.c | 63 +
mm/swap.c | 54 -
mm/swap_state.c | 7
mm/truncate.c | 141 ---
mm/vmstat.c | 35
mm/z3fold.c | 1
mm/zbud.c | 1
mm/zpool.c | 13
mm/zsmalloc.c | 22
mm/zswap.c | 57 +
samples/auxdisplay/cfag12864b-example.c | 2
scripts/Makefile.ubsan | 2
scripts/checkpatch.pl | 152 ++-
scripts/gdb/linux/lists.py | 5
145 files changed, 5046 insertions(+), 1682 deletions(-)
^ permalink raw reply [flat|nested] 232+ messages in thread
* Re: incoming
2021-02-26 1:14 incoming Andrew Morton
@ 2021-02-26 17:55 ` Linus Torvalds
2021-02-26 19:16 ` incoming Andrew Morton
0 siblings, 1 reply; 232+ messages in thread
From: Linus Torvalds @ 2021-02-26 17:55 UTC (permalink / raw)
To: Andrew Morton; +Cc: mm-commits, Linux-MM
On Thu, Feb 25, 2021 at 5:14 PM Andrew Morton <akpm@linux-foundation.org> wrote:
>
> - The rest of MM.
>
> Includes kfence - another runtime memory validator. Not as
> thorough as KASAN, but it has unmeasurable overhead and is intended
> to be usable in production builds.
>
> - Everything else
Just to clarify: you have nothing else really pending?
I'm hoping to just do -rc1 this weekend after all - despite my late
start due to loss of power for several days.
I'll allow late stragglers with good reason through, but the fewer of
those there are, the better, of course.
Thanks,
Linus
^ permalink raw reply [flat|nested] 232+ messages in thread
* Re: incoming
2021-02-26 17:55 ` incoming Linus Torvalds
@ 2021-02-26 19:16 ` Andrew Morton
0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2021-02-26 19:16 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, Linux-MM
On Fri, 26 Feb 2021 09:55:27 -0800 Linus Torvalds <torvalds@linux-foundation.org> wrote:
> On Thu, Feb 25, 2021 at 5:14 PM Andrew Morton <akpm@linux-foundation.org> wrote:
> >
> > - The rest of MM.
> >
> > Includes kfence - another runtime memory validator. Not as
> > thorough as KASAN, but it has unmeasurable overhead and is intended
> > to be usable in production builds.
> >
> > - Everything else
>
> Just to clarify: you have nothing else really pending?
Yes, that's it from me for -rc1.
^ permalink raw reply [flat|nested] 232+ messages in thread
* incoming
@ 2021-03-13 5:06 Andrew Morton
0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2021-03-13 5:06 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm
29 patches, based on f78d76e72a4671ea52d12752d92077788b4f5d50.
Subsystems affected by this patch series:
mm/memblock
core-kernel
kconfig
mm/pagealloc
fork
mm/hugetlb
mm/highmem
binfmt
MAINTAINERS
kbuild
mm/kfence
mm/oom-kill
mm/madvise
mm/kasan
mm/userfaultfd
mm/memory-failure
ia64
mm/memcg
mm/zram
Subsystem: mm/memblock
Arnd Bergmann <arnd@arndb.de>:
memblock: fix section mismatch warning
Subsystem: core-kernel
Arnd Bergmann <arnd@arndb.de>:
stop_machine: mark helpers __always_inline
Subsystem: kconfig
Masahiro Yamada <masahiroy@kernel.org>:
init/Kconfig: make COMPILE_TEST depend on HAS_IOMEM
Subsystem: mm/pagealloc
Mike Rapoport <rppt@linux.ibm.com>:
mm/page_alloc.c: refactor initialization of struct page for holes in memory layout
Subsystem: fork
Fenghua Yu <fenghua.yu@intel.com>:
mm/fork: clear PASID for new mm
Subsystem: mm/hugetlb
Peter Xu <peterx@redhat.com>:
Patch series "mm/hugetlb: Early cow on fork, and a few cleanups", v5:
hugetlb: dedup the code to add a new file_region
hugetlb: break earlier in add_reservation_in_range() when we can
mm: introduce page_needs_cow_for_dma() for deciding whether cow
mm: use is_cow_mapping() across tree where proper
hugetlb: do early cow when page pinned on src mm
Subsystem: mm/highmem
OGAWA Hirofumi <hirofumi@mail.parknet.co.jp>:
mm/highmem.c: fix zero_user_segments() with start > end
Subsystem: binfmt
Lior Ribak <liorribak@gmail.com>:
binfmt_misc: fix possible deadlock in bm_register_write
Subsystem: MAINTAINERS
Vlastimil Babka <vbabka@suse.cz>:
MAINTAINERS: exclude uapi directories in API/ABI section
Subsystem: kbuild
Arnd Bergmann <arnd@arndb.de>:
linux/compiler-clang.h: define HAVE_BUILTIN_BSWAP*
Subsystem: mm/kfence
Marco Elver <elver@google.com>:
kfence: fix printk format for ptrdiff_t
kfence, slab: fix cache_alloc_debugcheck_after() for bulk allocations
kfence: fix reports if constant function prefixes exist
Subsystem: mm/oom-kill
"Matthew Wilcox (Oracle)" <willy@infradead.org>:
include/linux/sched/mm.h: use rcu_dereference in in_vfork()
Subsystem: mm/madvise
Suren Baghdasaryan <surenb@google.com>:
mm/madvise: replace ptrace attach requirement for process_madvise
Subsystem: mm/kasan
Andrey Konovalov <andreyknvl@google.com>:
kasan, mm: fix crash with HW_TAGS and DEBUG_PAGEALLOC
kasan: fix KASAN_STACK dependency for HW_TAGS
Subsystem: mm/userfaultfd
Nadav Amit <namit@vmware.com>:
mm/userfaultfd: fix memory corruption due to writeprotect
Subsystem: mm/memory-failure
Naoya Horiguchi <naoya.horiguchi@nec.com>:
mm, hwpoison: do not lock page again when me_huge_page() successfully recovers
Subsystem: ia64
Sergei Trofimovich <slyfox@gentoo.org>:
ia64: fix ia64_syscall_get_set_arguments() for break-based syscalls
ia64: fix ptrace(PTRACE_SYSCALL_INFO_EXIT) sign
Subsystem: mm/memcg
Zhou Guanghui <zhouguanghui1@huawei.com>:
mm/memcg: rename mem_cgroup_split_huge_fixup to split_page_memcg and add nr_pages argument
mm/memcg: set memcg when splitting page
Subsystem: mm/zram
Minchan Kim <minchan@kernel.org>:
zram: fix return value on writeback_store
zram: fix broken page writeback
MAINTAINERS | 4
arch/ia64/include/asm/syscall.h | 2
arch/ia64/kernel/ptrace.c | 24 +++-
drivers/block/zram/zram_drv.c | 17 +-
drivers/gpu/drm/vmwgfx/vmwgfx_page_dirty.c | 4
drivers/gpu/drm/vmwgfx/vmwgfx_ttm_glue.c | 2
fs/binfmt_misc.c | 29 ++---
fs/proc/task_mmu.c | 2
include/linux/compiler-clang.h | 6 +
include/linux/memblock.h | 4
include/linux/memcontrol.h | 6 -
include/linux/mm.h | 21 +++
include/linux/mm_types.h | 1
include/linux/sched/mm.h | 3
include/linux/stop_machine.h | 11 +
init/Kconfig | 3
kernel/fork.c | 8 +
lib/Kconfig.kasan | 1
mm/highmem.c | 17 ++
mm/huge_memory.c | 10 -
mm/hugetlb.c | 123 +++++++++++++++------
mm/internal.h | 5
mm/kfence/report.c | 30 +++--
mm/madvise.c | 13 ++
mm/memcontrol.c | 15 +-
mm/memory-failure.c | 4
mm/memory.c | 16 +-
mm/page_alloc.c | 167 ++++++++++++++---------------
mm/slab.c | 2
29 files changed, 334 insertions(+), 216 deletions(-)
^ permalink raw reply [flat|nested] 232+ messages in thread
* incoming
@ 2021-03-25 4:36 Andrew Morton
0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2021-03-25 4:36 UTC (permalink / raw)
To: Linus Torvalds; +Cc: linux-mm, mm-commits
14 patches, based on 7acac4b3196caee5e21fb5ea53f8bc124e6a16fc.
Subsystems affected by this patch series:
mm/hugetlb
mm/kasan
mm/gup
mm/selftests
mm/z3fold
squashfs
ia64
gcov
mm/kfence
mm/memblock
mm/highmem
mailmap
Subsystem: mm/hugetlb
Miaohe Lin <linmiaohe@huawei.com>:
hugetlb_cgroup: fix imbalanced css_get and css_put pair for shared mappings
Subsystem: mm/kasan
Andrey Konovalov <andreyknvl@google.com>:
kasan: fix per-page tags for non-page_alloc pages
Subsystem: mm/gup
Sean Christopherson <seanjc@google.com>:
mm/mmu_notifiers: ensure range_end() is paired with range_start()
Subsystem: mm/selftests
Rong Chen <rong.a.chen@intel.com>:
selftests/vm: fix out-of-tree build
Subsystem: mm/z3fold
Thomas Hebb <tommyhebb@gmail.com>:
z3fold: prevent reclaim/free race for headless pages
Subsystem: squashfs
Sean Nyekjaer <sean@geanix.com>:
squashfs: fix inode lookup sanity checks
Phillip Lougher <phillip@squashfs.org.uk>:
squashfs: fix xattr id and id lookup sanity checks
Subsystem: ia64
Sergei Trofimovich <slyfox@gentoo.org>:
ia64: mca: allocate early mca with GFP_ATOMIC
ia64: fix format strings for err_inject
Subsystem: gcov
Nick Desaulniers <ndesaulniers@google.com>:
gcov: fix clang-11+ support
Subsystem: mm/kfence
Marco Elver <elver@google.com>:
kfence: make compatible with kmemleak
Subsystem: mm/memblock
Mike Rapoport <rppt@linux.ibm.com>:
mm: memblock: fix section mismatch warning again
Subsystem: mm/highmem
Ira Weiny <ira.weiny@intel.com>:
mm/highmem: fix CONFIG_DEBUG_KMAP_LOCAL_FORCE_MAP
Subsystem: mailmap
Andrey Konovalov <andreyknvl@google.com>:
mailmap: update Andrey Konovalov's email address
.mailmap | 1
arch/ia64/kernel/err_inject.c | 22 +++++------
arch/ia64/kernel/mca.c | 2 -
fs/squashfs/export.c | 8 +++-
fs/squashfs/id.c | 6 ++-
fs/squashfs/squashfs_fs.h | 1
fs/squashfs/xattr_id.c | 6 ++-
include/linux/hugetlb_cgroup.h | 15 ++++++-
include/linux/memblock.h | 4 +-
include/linux/mm.h | 18 +++++++--
include/linux/mmu_notifier.h | 10 ++---
kernel/gcov/clang.c | 69 ++++++++++++++++++++++++++++++++++++
mm/highmem.c | 4 +-
mm/hugetlb.c | 41 +++++++++++++++++++--
mm/hugetlb_cgroup.c | 10 ++++-
mm/kfence/core.c | 9 ++++
mm/kmemleak.c | 3 +
mm/mmu_notifier.c | 23 ++++++++++++
mm/z3fold.c | 16 +++++++-
tools/testing/selftests/vm/Makefile | 4 +-
20 files changed, 230 insertions(+), 42 deletions(-)
^ permalink raw reply [flat|nested] 232+ messages in thread
* incoming
@ 2021-04-09 20:26 Andrew Morton
0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2021-04-09 20:26 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm
16 patches, based on 17e7124aad766b3f158943acb51467f86220afe9.
Subsystems affected by this patch series:
MAINTAINERS
mailmap
mm/kasan
mm/gup
nds32
gcov
ocfs2
ia64
mm/pagecache
mm/kasan
mm/kfence
lib
Subsystem: MAINTAINERS
Marek Behún <kabel@kernel.org>:
MAINTAINERS: update CZ.NIC's Turris information
treewide: change my e-mail address, fix my name
Subsystem: mailmap
Jordan Crouse <jordan@cosmicpenguin.net>:
mailmap: update email address for Jordan Crouse
Matthew Wilcox <willy@infradead.org>:
.mailmap: fix old email addresses
Subsystem: mm/kasan
Arnd Bergmann <arnd@arndb.de>:
kasan: fix hwasan build for gcc
Walter Wu <walter-zh.wu@mediatek.com>:
kasan: remove redundant config option
Subsystem: mm/gup
Aili Yao <yaoaili@kingsoft.com>:
mm/gup: check page posion status for coredump.
Subsystem: nds32
Mike Rapoport <rppt@linux.ibm.com>:
nds32: flush_dcache_page: use page_mapping_file to avoid races with swapoff
Subsystem: gcov
Nick Desaulniers <ndesaulniers@google.com>:
gcov: re-fix clang-11+ support
Subsystem: ocfs2
Wengang Wang <wen.gang.wang@oracle.com>:
ocfs2: fix deadlock between setattr and dio_end_io_write
Subsystem: ia64
Sergei Trofimovich <slyfox@gentoo.org>:
ia64: fix user_stack_pointer() for ptrace()
Subsystem: mm/pagecache
Jack Qiu <jack.qiu@huawei.com>:
fs: direct-io: fix missing sdio->boundary
Subsystem: mm/kasan
Andrey Konovalov <andreyknvl@google.com>:
kasan: fix conflict with page poisoning
Andrew Morton <akpm@linux-foundation.org>:
lib/test_kasan_module.c: suppress unused var warning
Subsystem: mm/kfence
Marco Elver <elver@google.com>:
kfence, x86: fix preemptible warning on KPTI-enabled systems
Subsystem: lib
Julian Braha <julianbraha@gmail.com>:
lib: fix kconfig dependency on ARCH_WANT_FRAME_POINTERS
.mailmap | 7 ++
Documentation/ABI/testing/debugfs-moxtet | 4 -
Documentation/ABI/testing/debugfs-turris-mox-rwtm | 2
Documentation/ABI/testing/sysfs-bus-moxtet-devices | 6 +-
Documentation/ABI/testing/sysfs-class-led-driver-turris-omnia | 2
Documentation/ABI/testing/sysfs-firmware-turris-mox-rwtm | 10 +--
Documentation/devicetree/bindings/leds/cznic,turris-omnia-leds.yaml | 2
MAINTAINERS | 13 +++-
arch/arm64/boot/dts/marvell/armada-3720-turris-mox.dts | 2
arch/arm64/kernel/sleep.S | 2
arch/ia64/include/asm/ptrace.h | 8 --
arch/nds32/mm/cacheflush.c | 2
arch/x86/include/asm/kfence.h | 7 ++
arch/x86/kernel/acpi/wakeup_64.S | 2
drivers/bus/moxtet.c | 4 -
drivers/firmware/turris-mox-rwtm.c | 4 -
drivers/gpio/gpio-moxtet.c | 4 -
drivers/leds/leds-turris-omnia.c | 4 -
drivers/mailbox/armada-37xx-rwtm-mailbox.c | 4 -
drivers/watchdog/armada_37xx_wdt.c | 4 -
fs/direct-io.c | 5 +
fs/ocfs2/aops.c | 11 ---
fs/ocfs2/file.c | 8 ++
include/dt-bindings/bus/moxtet.h | 2
include/linux/armada-37xx-rwtm-mailbox.h | 2
include/linux/kasan.h | 2
include/linux/moxtet.h | 2
kernel/gcov/clang.c | 29 ++++++----
lib/Kconfig.debug | 6 +-
lib/Kconfig.kasan | 9 ---
lib/test_kasan_module.c | 2
mm/gup.c | 4 +
mm/internal.h | 20 ++++++
mm/kasan/common.c | 2
mm/kasan/kasan.h | 2
mm/kasan/report_generic.c | 2
mm/page_poison.c | 4 +
scripts/Makefile.kasan | 18 ++++--
security/Kconfig.hardening | 4 -
39 files changed, 136 insertions(+), 91 deletions(-)
^ permalink raw reply [flat|nested] 232+ messages in thread
* incoming
@ 2021-04-16 22:45 Andrew Morton
0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2021-04-16 22:45 UTC (permalink / raw)
To: Linus Torvalds; +Cc: linux-mm, mm-commits
12 patches, based on 06c2aac4014c38247256fe49c61b7f55890271e7.
Subsystems affected by this patch series:
mm/documentation
mm/kasan
csky
ia64
mm/pagemap
gcov
lib
Subsystem: mm/documentation
Randy Dunlap <rdunlap@infradead.org>:
mm: eliminate "expecting prototype" kernel-doc warnings
Subsystem: mm/kasan
Arnd Bergmann <arnd@arndb.de>:
kasan: fix hwasan build for gcc
Walter Wu <walter-zh.wu@mediatek.com>:
kasan: remove redundant config option
Subsystem: csky
Randy Dunlap <rdunlap@infradead.org>:
csky: change a Kconfig symbol name to fix e1000 build error
Subsystem: ia64
Randy Dunlap <rdunlap@infradead.org>:
ia64: remove duplicate entries in generic_defconfig
ia64: fix discontig.c section mismatches
John Paul Adrian Glaubitz <glaubitz () physik ! fu-berlin ! de>:
ia64: tools: remove inclusion of ia64-specific version of errno.h header
John Paul Adrian Glaubitz <glaubitz@physik.fu-berlin.de>:
ia64: tools: remove duplicate definition of ia64_mf() on ia64
Subsystem: mm/pagemap
Zack Rusin <zackr@vmware.com>:
mm/mapping_dirty_helpers: guard hugepage pud's usage
Christophe Leroy <christophe.leroy@csgroup.eu>:
mm: ptdump: fix build failure
Subsystem: gcov
Johannes Berg <johannes.berg@intel.com>:
gcov: clang: fix clang-11+ build
Subsystem: lib
Randy Dunlap <rdunlap@infradead.org>:
lib: remove "expecting prototype" kernel-doc warnings
arch/arm64/kernel/sleep.S | 2 +-
arch/csky/Kconfig | 2 +-
arch/csky/include/asm/page.h | 2 +-
arch/ia64/configs/generic_defconfig | 2 --
arch/ia64/mm/discontig.c | 6 +++---
arch/x86/kernel/acpi/wakeup_64.S | 2 +-
include/linux/kasan.h | 2 +-
kernel/gcov/clang.c | 2 +-
lib/Kconfig.kasan | 9 ++-------
lib/earlycpio.c | 4 ++--
lib/lru_cache.c | 3 ++-
lib/parman.c | 4 ++--
lib/radix-tree.c | 11 ++++++-----
mm/kasan/common.c | 2 +-
mm/kasan/kasan.h | 2 +-
mm/kasan/report_generic.c | 2 +-
mm/mapping_dirty_helpers.c | 2 ++
mm/mmu_gather.c | 29 +++++++++++++++++++----------
mm/oom_kill.c | 2 +-
mm/ptdump.c | 2 +-
mm/shuffle.c | 4 ++--
scripts/Makefile.kasan | 22 ++++++++++++++--------
security/Kconfig.hardening | 4 ++--
tools/arch/ia64/include/asm/barrier.h | 3 ---
tools/include/uapi/asm/errno.h | 2 --
25 files changed, 67 insertions(+), 60 deletions(-)
^ permalink raw reply [flat|nested] 232+ messages in thread
* incoming
@ 2021-04-23 21:28 Andrew Morton
0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2021-04-23 21:28 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm
5 patches, based on 5bfc75d92efd494db37f5c4c173d3639d4772966.
Subsystems affected by this patch series:
coda
overlayfs
mm/pagecache
mm/memcg
Subsystem: coda
Christian König <christian.koenig@amd.com>:
coda: fix reference counting in coda_file_mmap error path
Subsystem: overlayfs
Christian König <christian.koenig@amd.com>:
ovl: fix reference counting in ovl_mmap error path
Subsystem: mm/pagecache
Hugh Dickins <hughd@google.com>:
mm/filemap: fix find_lock_entries hang on 32-bit THP
mm/filemap: fix mapping_seek_hole_data on THP & 32-bit
Subsystem: mm/memcg
Vasily Averin <vvs@virtuozzo.com>:
tools/cgroup/slabinfo.py: updated to work on current kernel
fs/coda/file.c | 6 +++---
fs/overlayfs/file.c | 11 +----------
mm/filemap.c | 31 +++++++++++++++++++------------
tools/cgroup/memcg_slabinfo.py | 8 ++++----
4 files changed, 27 insertions(+), 29 deletions(-)
^ permalink raw reply [flat|nested] 232+ messages in thread
* incoming
@ 2021-04-30 5:52 Andrew Morton
0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2021-04-30 5:52 UTC (permalink / raw)
To: Linus Torvalds; +Cc: linux-mm, mm-commits
A few misc subsystems and some of MM.
178 patches, based on 8ca5297e7e38f2dc8c753d33a5092e7be181fff0.
Subsystems affected by this patch series:
ia64
kbuild
scripts
sh
ocfs2
kfifo
vfs
kernel/watchdog
mm/slab-generic
mm/slub
mm/kmemleak
mm/debug
mm/pagecache
mm/msync
mm/gup
mm/memremap
mm/memcg
mm/pagemap
mm/mremap
mm/dma
mm/sparsemem
mm/vmalloc
mm/documentation
mm/kasan
mm/initialization
mm/pagealloc
mm/memory-failure
Subsystem: ia64
Zhang Yunkai <zhang.yunkai@zte.com.cn>:
arch/ia64/kernel/head.S: remove duplicate include
Bhaskar Chowdhury <unixbhaskar@gmail.com>:
arch/ia64/kernel/fsys.S: fix typos
arch/ia64/include/asm/pgtable.h: minor typo fixes
Valentin Schneider <valentin.schneider@arm.com>:
ia64: ensure proper NUMA distance and possible map initialization
Sergei Trofimovich <slyfox@gentoo.org>:
ia64: drop unused IA64_FW_EMU ifdef
ia64: simplify code flow around swiotlb init
Bhaskar Chowdhury <unixbhaskar@gmail.com>:
ia64: trivial spelling fixes
Sergei Trofimovich <slyfox@gentoo.org>:
ia64: fix EFI_DEBUG build
ia64: mca: always make IA64_MCA_DEBUG an expression
ia64: drop marked broken DISCONTIGMEM and VIRTUAL_MEM_MAP
ia64: module: fix symbolizer crash on fdescr
Subsystem: kbuild
Luc Van Oostenryck <luc.vanoostenryck@gmail.com>:
include/linux/compiler-gcc.h: sparse can do constant folding of __builtin_bswap*()
Subsystem: scripts
Tom Saeger <tom.saeger@oracle.com>:
scripts/spelling.txt: add entries for recent discoveries
Wan Jiabing <wanjiabing@vivo.com>:
scripts: a new script for checking duplicate struct declaration
Subsystem: sh
Zhang Yunkai <zhang.yunkai@zte.com.cn>:
arch/sh/include/asm/tlb.h: remove duplicate include
Subsystem: ocfs2
Yang Li <yang.lee@linux.alibaba.com>:
ocfs2: replace DEFINE_SIMPLE_ATTRIBUTE with DEFINE_DEBUGFS_ATTRIBUTE
Joseph Qi <joseph.qi@linux.alibaba.com>:
ocfs2: map flags directly in flags_to_o2dlm()
Bhaskar Chowdhury <unixbhaskar@gmail.com>:
ocfs2: fix a typo
Jiapeng Chong <jiapeng.chong@linux.alibaba.com>:
ocfs2/dlm: remove unused function
Subsystem: kfifo
Dan Carpenter <dan.carpenter@oracle.com>:
kfifo: fix ternary sign extension bugs
Subsystem: vfs
Randy Dunlap <rdunlap@infradead.org>:
vfs: fs_parser: clean up kernel-doc warnings
Subsystem: kernel/watchdog
Petr Mladek <pmladek@suse.com>:
Patch series "watchdog/softlockup: Report overall time and some cleanup", v2:
watchdog: rename __touch_watchdog() to a better descriptive name
watchdog: explicitly update timestamp when reporting softlockup
watchdog/softlockup: report the overall time of softlockups
watchdog/softlockup: remove logic that tried to prevent repeated reports
watchdog: fix barriers when printing backtraces from all CPUs
watchdog: cleanup handling of false positives
Subsystem: mm/slab-generic
Rafael Aquini <aquini@redhat.com>:
mm/slab_common: provide "slab_merge" option for !IS_ENABLED(CONFIG_SLAB_MERGE_DEFAULT) builds
Subsystem: mm/slub
Vlastimil Babka <vbabka@suse.cz>:
mm, slub: enable slub_debug static key when creating cache with explicit debug flags
Oliver Glitta <glittao@gmail.com>:
kunit: add a KUnit test for SLUB debugging functionality
slub: remove resiliency_test() function
Bhaskar Chowdhury <unixbhaskar@gmail.com>:
mm/slub.c: trivial typo fixes
Subsystem: mm/kmemleak
Bhaskar Chowdhury <unixbhaskar@gmail.com>:
mm/kmemleak.c: fix a typo
Subsystem: mm/debug
Georgi Djakov <georgi.djakov@linaro.org>:
mm/page_owner: record the timestamp of all pages during free
zhongjiang-ali <zhongjiang-ali@linux.alibaba.com>:
mm, page_owner: remove unused parameter in __set_page_owner_handle
Sergei Trofimovich <slyfox@gentoo.org>:
mm: page_owner: fetch backtrace only for tracked pages
mm: page_owner: use kstrtobool() to parse bool option
mm: page_owner: detect page_owner recursion via task_struct
mm: page_poison: print page info when corruption is caught
Anshuman Khandual <anshuman.khandual@arm.com>:
mm/memtest: add ARCH_USE_MEMTEST
Subsystem: mm/pagecache
Jens Axboe <axboe@kernel.dk>:
Patch series "Improve IOCB_NOWAIT O_DIRECT reads", v3:
mm: provide filemap_range_needs_writeback() helper
mm: use filemap_range_needs_writeback() for O_DIRECT reads
iomap: use filemap_range_needs_writeback() for O_DIRECT reads
"Matthew Wilcox (Oracle)" <willy@infradead.org>:
mm/filemap: use filemap_read_page in filemap_fault
mm/filemap: drop check for truncated page after I/O
Johannes Weiner <hannes@cmpxchg.org>:
mm: page-writeback: simplify memcg handling in test_clear_page_writeback()
"Matthew Wilcox (Oracle)" <willy@infradead.org>:
mm: move page_mapping_file to pagemap.h
Rui Sun <sunrui26@huawei.com>:
mm/filemap: update stale comment
Subsystem: mm/msync
Nikita Ermakov <sh1r4s3@mail.si-head.nl>:
mm/msync: exit early when the flags is an MS_ASYNC and start < vm_start
Subsystem: mm/gup
Joao Martins <joao.m.martins@oracle.com>:
Patch series "mm/gup: page unpining improvements", v4:
mm/gup: add compound page list iterator
mm/gup: decrement head page once for group of subpages
mm/gup: add a range variant of unpin_user_pages_dirty_lock()
RDMA/umem: batch page unpin in __ib_umem_release()
Yang Shi <shy828301@gmail.com>:
mm: gup: remove FOLL_SPLIT
Subsystem: mm/memremap
Zhiyuan Dai <daizhiyuan@phytium.com.cn>:
mm/memremap.c: fix improper SPDX comment style
Subsystem: mm/memcg
Muchun Song <songmuchun@bytedance.com>:
mm: memcontrol: fix kernel stack account
Shakeel Butt <shakeelb@google.com>:
memcg: cleanup root memcg checks
memcg: enable memcg oom-kill for __GFP_NOFAIL
Johannes Weiner <hannes@cmpxchg.org>:
Patch series "mm: memcontrol: switch to rstat", v3:
mm: memcontrol: fix cpuhotplug statistics flushing
mm: memcontrol: kill mem_cgroup_nodeinfo()
mm: memcontrol: privatize memcg_page_state query functions
cgroup: rstat: support cgroup1
cgroup: rstat: punt root-level optimization to individual controllers
mm: memcontrol: switch to rstat
mm: memcontrol: consolidate lruvec stat flushing
kselftests: cgroup: update kmem test for new vmstat implementation
Shakeel Butt <shakeelb@google.com>:
memcg: charge before adding to swapcache on swapin
Muchun Song <songmuchun@bytedance.com>:
Patch series "Use obj_cgroup APIs to charge kmem pages", v5:
mm: memcontrol: slab: fix obtain a reference to a freeing memcg
mm: memcontrol: introduce obj_cgroup_{un}charge_pages
mm: memcontrol: directly access page->memcg_data in mm/page_alloc.c
mm: memcontrol: change ug->dummy_page only if memcg changed
mm: memcontrol: use obj_cgroup APIs to charge kmem pages
mm: memcontrol: inline __memcg_kmem_{un}charge() into obj_cgroup_{un}charge_pages()
mm: memcontrol: move PageMemcgKmem to the scope of CONFIG_MEMCG_KMEM
Wan Jiabing <wanjiabing@vivo.com>:
linux/memcontrol.h: remove duplicate struct declaration
Johannes Weiner <hannes@cmpxchg.org>:
mm: page_counter: mitigate consequences of a page_counter underflow
Subsystem: mm/pagemap
Wang Qing <wangqing@vivo.com>:
mm/memory.c: do_numa_page(): delete bool "migrated"
Zhiyuan Dai <daizhiyuan@phytium.com.cn>:
mm/interval_tree: add comments to improve code readability
Oscar Salvador <osalvador@suse.de>:
Patch series "Cleanup and fixups for vmemmap handling", v6:
x86/vmemmap: drop handling of 4K unaligned vmemmap range
x86/vmemmap: drop handling of 1GB vmemmap ranges
x86/vmemmap: handle unpopulated sub-pmd ranges
x86/vmemmap: optimize for consecutive sections in partial populated PMDs
Ovidiu Panait <ovidiu.panait@windriver.com>:
mm, tracing: improve rss_stat tracepoint message
Christoph Hellwig <hch@lst.de>:
Patch series "add remap_pfn_range_notrack instead of reinventing it in i915", v2:
mm: add remap_pfn_range_notrack
mm: add a io_mapping_map_user helper
i915: use io_mapping_map_user
i915: fix remap_io_sg to verify the pgprot
Huang Ying <ying.huang@intel.com>:
NUMA balancing: reduce TLB flush via delaying mapping on hint page fault
Subsystem: mm/mremap
Brian Geffon <bgeffon@google.com>:
Patch series "mm: Extend MREMAP_DONTUNMAP to non-anonymous mappings", v5:
mm: extend MREMAP_DONTUNMAP to non-anonymous mappings
Revert "mremap: don't allow MREMAP_DONTUNMAP on special_mappings and aio"
selftests: add a MREMAP_DONTUNMAP selftest for shmem
Subsystem: mm/dma
Zhiyuan Dai <daizhiyuan@phytium.com.cn>:
mm/dmapool: switch from strlcpy to strscpy
Subsystem: mm/sparsemem
Wang Wensheng <wangwensheng4@huawei.com>:
mm/sparse: add the missing sparse_buffer_fini() in error branch
Subsystem: mm/vmalloc
Christoph Hellwig <hch@lst.de>:
Patch series "remap_vmalloc_range cleanups":
samples/vfio-mdev/mdpy: use remap_vmalloc_range
mm: unexport remap_vmalloc_range_partial
Serapheim Dimitropoulos <serapheim.dimitro@delphix.com>:
mm/vmalloc: use rb_tree instead of list for vread() lookups
Nicholas Piggin <npiggin@gmail.com>:
Patch series "huge vmalloc mappings", v13:
ARM: mm: add missing pud_page define to 2-level page tables
mm/vmalloc: fix HUGE_VMAP regression by enabling huge pages in vmalloc_to_page
mm: apply_to_pte_range warn and fail if a large pte is encountered
mm/vmalloc: rename vmap_*_range vmap_pages_*_range
mm/ioremap: rename ioremap_*_range to vmap_*_range
mm: HUGE_VMAP arch support cleanup
powerpc: inline huge vmap supported functions
arm64: inline huge vmap supported functions
x86: inline huge vmap supported functions
mm/vmalloc: provide fallback arch huge vmap support functions
mm: move vmap_range from mm/ioremap.c to mm/vmalloc.c
mm/vmalloc: add vmap_range_noflush variant
mm/vmalloc: hugepage vmalloc mappings
Patch series "mm/vmalloc: cleanup after hugepage series", v2:
mm/vmalloc: remove map_kernel_range
kernel/dma: remove unnecessary unmap_kernel_range
powerpc/xive: remove unnecessary unmap_kernel_range
mm/vmalloc: remove unmap_kernel_range
mm/vmalloc: improve allocation failure error messages
Vijayanand Jitta <vjitta@codeaurora.org>:
mm: vmalloc: prevent use after free in _vm_unmap_aliases
"Uladzislau Rezki (Sony)" <urezki@gmail.com>:
lib/test_vmalloc.c: remove two kvfree_rcu() tests
lib/test_vmalloc.c: add a new 'nr_threads' parameter
vm/test_vmalloc.sh: adapt for updated driver interface
mm/vmalloc: refactor the preloading loagic
mm/vmalloc: remove an empty line
Subsystem: mm/documentation
"Matthew Wilcox (Oracle)" <willy@infradead.org>:
mm/doc: fix fault_flag_allow_retry_first kerneldoc
mm/doc: fix page_maybe_dma_pinned kerneldoc
mm/doc: turn fault flags into an enum
mm/doc: add mm.h and mm_types.h to the mm-api document
Lukas Bulwahn <lukas.bulwahn@gmail.com>:
Patch series "kernel-doc and MAINTAINERS clean-up":
MAINTAINERS: assign pagewalk.h to MEMORY MANAGEMENT
pagewalk: prefix struct kernel-doc descriptions
Subsystem: mm/kasan
Zhiyuan Dai <daizhiyuan@phytium.com.cn>:
mm/kasan: switch from strlcpy to strscpy
Peter Collingbourne <pcc@google.com>:
kasan: fix kasan_byte_accessible() to be consistent with actual checks
Andrey Konovalov <andreyknvl@google.com>:
kasan: initialize shadow to TAG_INVALID for SW_TAGS
mm, kasan: don't poison boot memory with tag-based modes
Patch series "kasan: integrate with init_on_alloc/free", v3:
arm64: kasan: allow to init memory when setting tags
kasan: init memory in kasan_(un)poison for HW_TAGS
kasan, mm: integrate page_alloc init with HW_TAGS
kasan, mm: integrate slab init_on_alloc with HW_TAGS
kasan, mm: integrate slab init_on_free with HW_TAGS
kasan: docs: clean up sections
kasan: docs: update overview section
kasan: docs: update usage section
kasan: docs: update error reports section
kasan: docs: update boot parameters section
kasan: docs: update GENERIC implementation details section
kasan: docs: update SW_TAGS implementation details section
kasan: docs: update HW_TAGS implementation details section
kasan: docs: update shadow memory section
kasan: docs: update ignoring accesses section
kasan: docs: update tests section
Walter Wu <walter-zh.wu@mediatek.com>:
kasan: record task_work_add() call stack
Andrey Konovalov <andreyknvl@google.com>:
kasan: detect false-positives in tests
Zqiang <qiang.zhang@windriver.com>:
irq_work: record irq_work_queue() call stack
Subsystem: mm/initialization
Kefeng Wang <wangkefeng.wang@huawei.com>:
mm: move mem_init_print_info() into mm_init()
Subsystem: mm/pagealloc
David Hildenbrand <david@redhat.com>:
mm/page_alloc: drop pr_info_ratelimited() in alloc_contig_range()
Minchan Kim <minchan@kernel.org>:
mm: remove lru_add_drain_all in alloc_contig_range
Yu Zhao <yuzhao@google.com>:
include/linux/page-flags-layout.h: correctly determine LAST_CPUPID_WIDTH
include/linux/page-flags-layout.h: cleanups
"Matthew Wilcox (Oracle)" <willy@infradead.org>:
Patch series "Rationalise __alloc_pages wrappers", v3:
mm/page_alloc: rename alloc_mask to alloc_gfp
mm/page_alloc: rename gfp_mask to gfp
mm/page_alloc: combine __alloc_pages and __alloc_pages_nodemask
mm/mempolicy: rename alloc_pages_current to alloc_pages
mm/mempolicy: rewrite alloc_pages documentation
mm/mempolicy: rewrite alloc_pages_vma documentation
mm/mempolicy: fix mpol_misplaced kernel-doc
Minchan Kim <minchan@kernel.org>:
mm: page_alloc: dump migrate-failed pages
Geert Uytterhoeven <geert@linux-m68k.org>:
mm/Kconfig: remove default DISCONTIGMEM_MANUAL
Kefeng Wang <wangkefeng.wang@huawei.com>:
mm, page_alloc: avoid page_to_pfn() in move_freepages()
zhouchuangao <zhouchuangao@vivo.com>:
mm/page_alloc: duplicate include linux/vmalloc.h
Mel Gorman <mgorman@techsingularity.net>:
Patch series "Introduce a bulk order-0 page allocator with two in-tree users", v6:
mm/page_alloc: rename alloced to allocated
mm/page_alloc: add a bulk page allocator
mm/page_alloc: add an array-based interface to the bulk page allocator
Jesper Dangaard Brouer <brouer@redhat.com>:
mm/page_alloc: optimize code layout for __alloc_pages_bulk
mm/page_alloc: inline __rmqueue_pcplist
Chuck Lever <chuck.lever@oracle.com>:
Patch series "SUNRPC consumer for the bulk page allocator":
SUNRPC: set rq_page_end differently
SUNRPC: refresh rq_pages using a bulk page allocator
Jesper Dangaard Brouer <brouer@redhat.com>:
net: page_pool: refactor dma_map into own function page_pool_dma_map
net: page_pool: use alloc_pages_bulk in refill code path
Sergei Trofimovich <slyfox@gentoo.org>:
mm: page_alloc: ignore init_on_free=1 for debug_pagealloc=1
huxiang <huxiang@uniontech.com>:
mm/page_alloc: redundant definition variables of pfn in for loop
Mike Rapoport <rppt@linux.ibm.com>:
mm/mmzone.h: fix existing kernel-doc comments and link them to core-api
Subsystem: mm/memory-failure
Jane Chu <jane.chu@oracle.com>:
mm/memory-failure: unnecessary amount of unmapping
Documentation/admin-guide/kernel-parameters.txt | 7
Documentation/admin-guide/mm/transhuge.rst | 2
Documentation/core-api/cachetlb.rst | 4
Documentation/core-api/mm-api.rst | 6
Documentation/dev-tools/kasan.rst | 355 +++++-----
Documentation/vm/page_owner.rst | 2
Documentation/vm/transhuge.rst | 5
MAINTAINERS | 1
arch/Kconfig | 11
arch/alpha/mm/init.c | 1
arch/arc/mm/init.c | 1
arch/arm/Kconfig | 1
arch/arm/include/asm/pgtable-3level.h | 2
arch/arm/include/asm/pgtable.h | 3
arch/arm/mm/copypage-v4mc.c | 1
arch/arm/mm/copypage-v6.c | 1
arch/arm/mm/copypage-xscale.c | 1
arch/arm/mm/init.c | 2
arch/arm64/Kconfig | 1
arch/arm64/include/asm/memory.h | 4
arch/arm64/include/asm/mte-kasan.h | 39 -
arch/arm64/include/asm/vmalloc.h | 38 -
arch/arm64/mm/init.c | 4
arch/arm64/mm/mmu.c | 36 -
arch/csky/abiv1/cacheflush.c | 1
arch/csky/mm/init.c | 1
arch/h8300/mm/init.c | 2
arch/hexagon/mm/init.c | 1
arch/ia64/Kconfig | 23
arch/ia64/configs/bigsur_defconfig | 1
arch/ia64/include/asm/meminit.h | 11
arch/ia64/include/asm/module.h | 6
arch/ia64/include/asm/page.h | 25
arch/ia64/include/asm/pgtable.h | 7
arch/ia64/kernel/Makefile | 2
arch/ia64/kernel/acpi.c | 7
arch/ia64/kernel/efi.c | 11
arch/ia64/kernel/fsys.S | 4
arch/ia64/kernel/head.S | 6
arch/ia64/kernel/ia64_ksyms.c | 12
arch/ia64/kernel/machine_kexec.c | 2
arch/ia64/kernel/mca.c | 4
arch/ia64/kernel/module.c | 29
arch/ia64/kernel/pal.S | 6
arch/ia64/mm/Makefile | 1
arch/ia64/mm/contig.c | 4
arch/ia64/mm/discontig.c | 21
arch/ia64/mm/fault.c | 15
arch/ia64/mm/init.c | 221 ------
arch/m68k/mm/init.c | 1
arch/microblaze/mm/init.c | 1
arch/mips/Kconfig | 1
arch/mips/loongson64/numa.c | 1
arch/mips/mm/cache.c | 1
arch/mips/mm/init.c | 1
arch/mips/sgi-ip27/ip27-memory.c | 1
arch/nds32/mm/init.c | 1
arch/nios2/mm/cacheflush.c | 1
arch/nios2/mm/init.c | 1
arch/openrisc/mm/init.c | 2
arch/parisc/mm/init.c | 2
arch/powerpc/Kconfig | 1
arch/powerpc/include/asm/vmalloc.h | 34 -
arch/powerpc/kernel/isa-bridge.c | 4
arch/powerpc/kernel/pci_64.c | 2
arch/powerpc/mm/book3s64/radix_pgtable.c | 29
arch/powerpc/mm/ioremap.c | 2
arch/powerpc/mm/mem.c | 1
arch/powerpc/sysdev/xive/common.c | 4
arch/riscv/mm/init.c | 1
arch/s390/mm/init.c | 2
arch/sh/include/asm/tlb.h | 10
arch/sh/mm/cache-sh4.c | 1
arch/sh/mm/cache-sh7705.c | 1
arch/sh/mm/init.c | 1
arch/sparc/include/asm/pgtable_32.h | 3
arch/sparc/mm/init_32.c | 2
arch/sparc/mm/init_64.c | 1
arch/sparc/mm/tlb.c | 1
arch/um/kernel/mem.c | 1
arch/x86/Kconfig | 1
arch/x86/include/asm/vmalloc.h | 42 -
arch/x86/kernel/cpu/resctrl/pseudo_lock.c | 2
arch/x86/mm/init_32.c | 2
arch/x86/mm/init_64.c | 222 ++++--
arch/x86/mm/ioremap.c | 33
arch/x86/mm/pgtable.c | 13
arch/xtensa/Kconfig | 1
arch/xtensa/mm/init.c | 1
block/blk-cgroup.c | 17
drivers/gpu/drm/i915/Kconfig | 1
drivers/gpu/drm/i915/gem/i915_gem_mman.c | 9
drivers/gpu/drm/i915/i915_drv.h | 3
drivers/gpu/drm/i915/i915_mm.c | 117 ---
drivers/infiniband/core/umem.c | 12
drivers/pci/pci.c | 2
fs/aio.c | 5
fs/fs_parser.c | 2
fs/iomap/direct-io.c | 24
fs/ocfs2/blockcheck.c | 2
fs/ocfs2/dlm/dlmrecovery.c | 7
fs/ocfs2/stack_o2cb.c | 36 -
fs/ocfs2/stackglue.c | 2
include/linux/compiler-gcc.h | 8
include/linux/fs.h | 2
include/linux/gfp.h | 45 -
include/linux/io-mapping.h | 3
include/linux/io.h | 9
include/linux/kasan.h | 51 +
include/linux/memcontrol.h | 271 ++++----
include/linux/mm.h | 50 -
include/linux/mmzone.h | 43 -
include/linux/page-flags-layout.h | 64 -
include/linux/pagemap.h | 10
include/linux/pagewalk.h | 4
include/linux/sched.h | 4
include/linux/slab.h | 2
include/linux/slub_def.h | 2
include/linux/vmalloc.h | 73 +-
include/linux/vmstat.h | 24
include/net/page_pool.h | 2
include/trace/events/kmem.h | 24
init/main.c | 2
kernel/cgroup/cgroup.c | 34 -
kernel/cgroup/rstat.c | 61 +
kernel/dma/remap.c | 1
kernel/fork.c | 13
kernel/irq_work.c | 7
kernel/task_work.c | 3
kernel/watchdog.c | 102 +--
lib/Kconfig.debug | 14
lib/Makefile | 1
lib/test_kasan.c | 59 -
lib/test_slub.c | 124 +++
lib/test_vmalloc.c | 128 +--
mm/Kconfig | 4
mm/Makefile | 1
mm/debug_vm_pgtable.c | 4
mm/dmapool.c | 2
mm/filemap.c | 61 +
mm/gup.c | 145 +++-
mm/hugetlb.c | 2
mm/internal.h | 25
mm/interval_tree.c | 2
mm/io-mapping.c | 29
mm/ioremap.c | 361 ++--------
mm/kasan/common.c | 53 -
mm/kasan/generic.c | 12
mm/kasan/kasan.h | 28
mm/kasan/report_generic.c | 2
mm/kasan/shadow.c | 10
mm/kasan/sw_tags.c | 12
mm/kmemleak.c | 2
mm/memcontrol.c | 798 ++++++++++++------------
mm/memory-failure.c | 2
mm/memory.c | 191 +++--
mm/mempolicy.c | 78 --
mm/mempool.c | 4
mm/memremap.c | 2
mm/migrate.c | 2
mm/mm_init.c | 4
mm/mmap.c | 6
mm/mremap.c | 6
mm/msync.c | 6
mm/page-writeback.c | 9
mm/page_alloc.c | 430 +++++++++---
mm/page_counter.c | 8
mm/page_owner.c | 68 --
mm/page_poison.c | 6
mm/percpu-vm.c | 7
mm/slab.c | 43 -
mm/slab.h | 24
mm/slab_common.c | 10
mm/slub.c | 215 ++----
mm/sparse.c | 1
mm/swap_state.c | 13
mm/util.c | 10
mm/vmalloc.c | 728 ++++++++++++++++-----
net/core/page_pool.c | 127 ++-
net/sunrpc/svc_xprt.c | 38 -
samples/kfifo/bytestream-example.c | 8
samples/kfifo/inttype-example.c | 8
samples/kfifo/record-example.c | 8
samples/vfio-mdev/mdpy.c | 4
scripts/checkdeclares.pl | 53 +
scripts/spelling.txt | 26
tools/testing/selftests/cgroup/test_kmem.c | 22
tools/testing/selftests/vm/mremap_dontunmap.c | 52 +
tools/testing/selftests/vm/test_vmalloc.sh | 21
189 files changed, 3642 insertions(+), 3013 deletions(-)
^ permalink raw reply [flat|nested] 232+ messages in thread
* incoming
@ 2021-05-05 1:32 Andrew Morton
2021-05-05 1:47 ` incoming Linus Torvalds
0 siblings, 1 reply; 232+ messages in thread
From: Andrew Morton @ 2021-05-05 1:32 UTC (permalink / raw)
To: Linus Torvalds; +Cc: linux-mm, mm-commits
The remainder of the main mm/ queue.
143 patches, based on 8ca5297e7e38f2dc8c753d33a5092e7be181fff0, plus
previously sent patches.
Subsystems affected by this patch series:
mm/pagecache
mm/hugetlb
mm/userfaultfd
mm/vmscan
mm/compaction
mm/migration
mm/cma
mm/ksm
mm/vmstat
mm/mmap
mm/kconfig
mm/util
mm/memory-hotplug
mm/zswap
mm/zsmalloc
mm/highmem
mm/cleanups
mm/kfence
Subsystem: mm/pagecache
"Matthew Wilcox (Oracle)" <willy@infradead.org>:
Patch series "Remove nrexceptional tracking", v2:
mm: introduce and use mapping_empty()
mm: stop accounting shadow entries
dax: account DAX entries as nrpages
mm: remove nrexceptional from inode
Hugh Dickins <hughd@google.com>:
mm: remove nrexceptional from inode: remove BUG_ON
Subsystem: mm/hugetlb
Peter Xu <peterx@redhat.com>:
Patch series "hugetlb: Disable huge pmd unshare for uffd-wp", v4:
hugetlb: pass vma into huge_pte_alloc() and huge_pmd_share()
hugetlb/userfaultfd: forbid huge pmd sharing when uffd enabled
mm/hugetlb: move flush_hugetlb_tlb_range() into hugetlb.h
hugetlb/userfaultfd: unshare all pmds for hugetlbfs when register wp
Miaohe Lin <linmiaohe@huawei.com>:
mm/hugetlb: remove redundant reservation check condition in alloc_huge_page()
Anshuman Khandual <anshuman.khandual@arm.com>:
mm: generalize HUGETLB_PAGE_SIZE_VARIABLE
Miaohe Lin <linmiaohe@huawei.com>:
Patch series "Some cleanups for hugetlb":
mm/hugetlb: use some helper functions to cleanup code
mm/hugetlb: optimize the surplus state transfer code in move_hugetlb_state()
mm/hugetlb_cgroup: remove unnecessary VM_BUG_ON_PAGE in hugetlb_cgroup_migrate()
mm/hugetlb: simplify the code when alloc_huge_page() failed in hugetlb_no_page()
mm/hugetlb: avoid calculating fault_mutex_hash in truncate_op case
Patch series "Cleanup and fixup for khugepaged", v2:
khugepaged: remove unneeded return value of khugepaged_collapse_pte_mapped_thps()
khugepaged: reuse the smp_wmb() inside __SetPageUptodate()
khugepaged: use helper khugepaged_test_exit() in __khugepaged_enter()
khugepaged: fix wrong result value for trace_mm_collapse_huge_page_isolate()
mm/huge_memory.c: remove unnecessary local variable ret2
Patch series "Some cleanups for huge_memory", v3:
mm/huge_memory.c: rework the function vma_adjust_trans_huge()
mm/huge_memory.c: make get_huge_zero_page() return bool
mm/huge_memory.c: rework the function do_huge_pmd_numa_page() slightly
mm/huge_memory.c: remove redundant PageCompound() check
mm/huge_memory.c: remove unused macro TRANSPARENT_HUGEPAGE_DEBUG_COW_FLAG
mm/huge_memory.c: use helper function migration_entry_to_page()
Yanfei Xu <yanfei.xu@windriver.com>:
mm/khugepaged.c: replace barrier() with READ_ONCE() for a selective variable
Miaohe Lin <linmiaohe@huawei.com>:
Patch series "Cleanup for khugepaged":
khugepaged: use helper function range_in_vma() in collapse_pte_mapped_thp()
khugepaged: remove unnecessary out label in collapse_huge_page()
khugepaged: remove meaningless !pte_present() check in khugepaged_scan_pmd()
Zi Yan <ziy@nvidia.com>:
mm: huge_memory: a new debugfs interface for splitting THP tests
mm: huge_memory: debugfs for file-backed THP split
Miaohe Lin <linmiaohe@huawei.com>:
Patch series "Cleanup and fixup for hugetlb", v2:
mm/hugeltb: remove redundant VM_BUG_ON() in region_add()
mm/hugeltb: simplify the return code of __vma_reservation_common()
mm/hugeltb: clarify (chg - freed) won't go negative in hugetlb_unreserve_pages()
mm/hugeltb: handle the error case in hugetlb_fix_reserve_counts()
mm/hugetlb: remove unused variable pseudo_vma in remove_inode_hugepages()
Mike Kravetz <mike.kravetz@oracle.com>:
Patch series "make hugetlb put_page safe for all calling contexts", v5:
mm/cma: change cma mutex to irq safe spinlock
hugetlb: no need to drop hugetlb_lock to call cma_release
hugetlb: add per-hstate mutex to synchronize user adjustments
hugetlb: create remove_hugetlb_page() to separate functionality
hugetlb: call update_and_free_page without hugetlb_lock
hugetlb: change free_pool_huge_page to remove_pool_huge_page
hugetlb: make free_huge_page irq safe
hugetlb: add lockdep_assert_held() calls for hugetlb_lock
Oscar Salvador <osalvador@suse.de>:
Patch series "Make alloc_contig_range handle Hugetlb pages", v10:
mm,page_alloc: bail out earlier on -ENOMEM in alloc_contig_migrate_range
mm,compaction: let isolate_migratepages_{range,block} return error codes
mm,hugetlb: drop clearing of flag from prep_new_huge_page
mm,hugetlb: split prep_new_huge_page functionality
mm: make alloc_contig_range handle free hugetlb pages
mm: make alloc_contig_range handle in-use hugetlb pages
mm,page_alloc: drop unnecessary checks from pfn_range_valid_contig
Subsystem: mm/userfaultfd
Axel Rasmussen <axelrasmussen@google.com>:
Patch series "userfaultfd: add minor fault handling", v9:
userfaultfd: add minor fault registration mode
userfaultfd: disable huge PMD sharing for MINOR registered VMAs
userfaultfd: hugetlbfs: only compile UFFD helpers if config enabled
userfaultfd: add UFFDIO_CONTINUE ioctl
userfaultfd: update documentation to describe minor fault handling
userfaultfd/selftests: add test exercising minor fault handling
Subsystem: mm/vmscan
Dave Hansen <dave.hansen@linux.intel.com>:
mm/vmscan: move RECLAIM* bits to uapi header
mm/vmscan: replace implicit RECLAIM_ZONE checks with explicit checks
Yang Shi <shy828301@gmail.com>:
Patch series "Make shrinker's nr_deferred memcg aware", v10:
mm: vmscan: use nid from shrink_control for tracepoint
mm: vmscan: consolidate shrinker_maps handling code
mm: vmscan: use shrinker_rwsem to protect shrinker_maps allocation
mm: vmscan: remove memcg_shrinker_map_size
mm: vmscan: use kvfree_rcu instead of call_rcu
mm: memcontrol: rename shrinker_map to shrinker_info
mm: vmscan: add shrinker_info_protected() helper
mm: vmscan: use a new flag to indicate shrinker is registered
mm: vmscan: add per memcg shrinker nr_deferred
mm: vmscan: use per memcg nr_deferred of shrinker
mm: vmscan: don't need allocate shrinker->nr_deferred for memcg aware shrinkers
mm: memcontrol: reparent nr_deferred when memcg offline
mm: vmscan: shrink deferred objects proportional to priority
Subsystem: mm/compaction
Pintu Kumar <pintu@codeaurora.org>:
mm/compaction: remove unused variable sysctl_compact_memory
Charan Teja Reddy <charante@codeaurora.org>:
mm: compaction: update the COMPACT[STALL|FAIL] events properly
Subsystem: mm/migration
Minchan Kim <minchan@kernel.org>:
mm: disable LRU pagevec during the migration temporarily
mm: replace migrate_[prep|finish] with lru_cache_[disable|enable]
mm: fs: invalidate BH LRU during page migration
Miaohe Lin <linmiaohe@huawei.com>:
Patch series "Cleanup and fixup for mm/migrate.c", v3:
mm/migrate.c: make putback_movable_page() static
mm/migrate.c: remove unnecessary rc != MIGRATEPAGE_SUCCESS check in 'else' case
mm/migrate.c: fix potential indeterminate pte entry in migrate_vma_insert_page()
mm/migrate.c: use helper migrate_vma_collect_skip() in migrate_vma_collect_hole()
Revert "mm: migrate: skip shared exec THP for NUMA balancing"
Subsystem: mm/cma
Minchan Kim <minchan@kernel.org>:
mm: vmstat: add cma statistics
Baolin Wang <baolin.wang@linux.alibaba.com>:
mm: cma: use pr_err_ratelimited for CMA warning
Liam Mark <lmark@codeaurora.org>:
mm: cma: add trace events for CMA alloc perf testing
Minchan Kim <minchan@kernel.org>:
mm: cma: support sysfs
mm: cma: add the CMA instance name to cma trace events
mm: use proper type for cma_[alloc|release]
Subsystem: mm/ksm
Miaohe Lin <linmiaohe@huawei.com>:
Patch series "Cleanup and fixup for ksm":
ksm: remove redundant VM_BUG_ON_PAGE() on stable_tree_search()
ksm: use GET_KSM_PAGE_NOLOCK to get ksm page in remove_rmap_item_from_tree()
ksm: remove dedicated macro KSM_FLAG_MASK
ksm: fix potential missing rmap_item for stable_node
Chengyang Fan <cy.fan@huawei.com>:
mm/ksm: remove unused parameter from remove_trailing_rmap_items()
Subsystem: mm/vmstat
Hugh Dickins <hughd@google.com>:
mm: restore node stat checking in /proc/sys/vm/stat_refresh
mm: no more EINVAL from /proc/sys/vm/stat_refresh
mm: /proc/sys/vm/stat_refresh skip checking known negative stats
mm: /proc/sys/vm/stat_refresh stop checking monotonic numa stats
Saravanan D <saravanand@fb.com>:
x86/mm: track linear mapping split events
Subsystem: mm/mmap
Liam Howlett <liam.howlett@oracle.com>:
mm/mmap.c: don't unlock VMAs in remap_file_pages()
Subsystem: mm/kconfig
Anshuman Khandual <anshuman.khandual@arm.com>:
Patch series "mm: some config cleanups", v2:
mm: generalize ARCH_HAS_CACHE_LINE_SIZE
mm: generalize SYS_SUPPORTS_HUGETLBFS (rename as ARCH_SUPPORTS_HUGETLBFS)
mm: generalize ARCH_ENABLE_MEMORY_[HOTPLUG|HOTREMOVE]
mm: drop redundant ARCH_ENABLE_[HUGEPAGE|THP]_MIGRATION
mm: drop redundant ARCH_ENABLE_SPLIT_PMD_PTLOCK
mm: drop redundant HAVE_ARCH_TRANSPARENT_HUGEPAGE
Subsystem: mm/util
Joe Perches <joe@perches.com>:
mm/util.c: reduce mem_dump_obj() object size
Bhaskar Chowdhury <unixbhaskar@gmail.com>:
mm/util.c: fix typo
Subsystem: mm/memory-hotplug
Pavel Tatashin <pasha.tatashin@soleen.com>:
Patch series "prohibit pinning pages in ZONE_MOVABLE", v11:
mm/gup: don't pin migrated cma pages in movable zone
mm/gup: check every subpage of a compound page during isolation
mm/gup: return an error on migration failure
mm/gup: check for isolation errors
mm cma: rename PF_MEMALLOC_NOCMA to PF_MEMALLOC_PIN
mm: apply per-task gfp constraints in fast path
mm: honor PF_MEMALLOC_PIN for all movable pages
mm/gup: do not migrate zero page
mm/gup: migrate pinned pages out of movable zone
memory-hotplug.rst: add a note about ZONE_MOVABLE and page pinning
mm/gup: change index type to long as it counts pages
mm/gup: longterm pin migration cleanup
selftests/vm: gup_test: fix test flag
selftests/vm: gup_test: test faulting in kernel, and verify pinnable pages
Mel Gorman <mgorman@techsingularity.net>:
mm/memory_hotplug: remove broken locking of zone PCP structures during hot remove
Oscar Salvador <osalvador@suse.de>:
Patch series "Allocate memmap from hotadded memory (per device)", v10:
drivers/base/memory: introduce memory_block_{online,offline}
mm,memory_hotplug: relax fully spanned sections check
David Hildenbrand <david@redhat.com>:
mm,memory_hotplug: factor out adjusting present pages into adjust_present_page_count()
Oscar Salvador <osalvador@suse.de>:
mm,memory_hotplug: allocate memmap from the added memory range
acpi,memhotplug: enable MHP_MEMMAP_ON_MEMORY when supported
mm,memory_hotplug: add kernel boot option to enable memmap_on_memory
x86/Kconfig: introduce ARCH_MHP_MEMMAP_ON_MEMORY_ENABLE
arm64/Kconfig: introduce ARCH_MHP_MEMMAP_ON_MEMORY_ENABLE
Subsystem: mm/zswap
Zhiyuan Dai <daizhiyuan@phytium.com.cn>:
mm/zswap.c: switch from strlcpy to strscpy
Subsystem: mm/zsmalloc
zhouchuangao <zhouchuangao@vivo.com>:
mm/zsmalloc: use BUG_ON instead of if condition followed by BUG.
Subsystem: mm/highmem
Ira Weiny <ira.weiny@intel.com>:
Patch series "btrfs: Convert kmap/memset/kunmap to memzero_user()":
iov_iter: lift memzero_page() to highmem.h
btrfs: use memzero_page() instead of open coded kmap pattern
songqiang <songqiang@uniontech.com>:
mm/highmem.c: fix coding style issue
Subsystem: mm/cleanups
Zhiyuan Dai <daizhiyuan@phytium.com.cn>:
mm/mempool: minor coding style tweaks
Zhang Yunkai <zhang.yunkai@zte.com.cn>:
mm/process_vm_access.c: remove duplicate include
Subsystem: mm/kfence
Marco Elver <elver@google.com>:
kfence: zero guard page after out-of-bounds access
Patch series "kfence: optimize timer scheduling", v2:
kfence: await for allocation using wait_event
kfence: maximize allocation wait timeout duration
kfence: use power-efficient work queue to run delayed work
Documentation/ABI/testing/sysfs-kernel-mm-cma | 25
Documentation/admin-guide/kernel-parameters.txt | 17
Documentation/admin-guide/mm/memory-hotplug.rst | 9
Documentation/admin-guide/mm/userfaultfd.rst | 105 +-
arch/arc/Kconfig | 9
arch/arm/Kconfig | 10
arch/arm64/Kconfig | 34
arch/arm64/mm/hugetlbpage.c | 7
arch/ia64/Kconfig | 14
arch/ia64/mm/hugetlbpage.c | 3
arch/mips/Kconfig | 6
arch/mips/mm/hugetlbpage.c | 4
arch/parisc/Kconfig | 5
arch/parisc/mm/hugetlbpage.c | 2
arch/powerpc/Kconfig | 17
arch/powerpc/mm/hugetlbpage.c | 3
arch/powerpc/platforms/Kconfig.cputype | 16
arch/riscv/Kconfig | 5
arch/s390/Kconfig | 12
arch/s390/mm/hugetlbpage.c | 2
arch/sh/Kconfig | 7
arch/sh/mm/Kconfig | 8
arch/sh/mm/hugetlbpage.c | 2
arch/sparc/mm/hugetlbpage.c | 2
arch/x86/Kconfig | 33
arch/x86/mm/pat/set_memory.c | 8
drivers/acpi/acpi_memhotplug.c | 5
drivers/base/memory.c | 105 ++
fs/Kconfig | 5
fs/block_dev.c | 2
fs/btrfs/compression.c | 5
fs/btrfs/extent_io.c | 22
fs/btrfs/inode.c | 33
fs/btrfs/reflink.c | 6
fs/btrfs/zlib.c | 5
fs/btrfs/zstd.c | 5
fs/buffer.c | 36
fs/dax.c | 8
fs/gfs2/glock.c | 3
fs/hugetlbfs/inode.c | 9
fs/inode.c | 11
fs/proc/task_mmu.c | 3
fs/userfaultfd.c | 149 +++
include/linux/buffer_head.h | 4
include/linux/cma.h | 4
include/linux/compaction.h | 1
include/linux/fs.h | 2
include/linux/gfp.h | 2
include/linux/highmem.h | 7
include/linux/huge_mm.h | 3
include/linux/hugetlb.h | 37
include/linux/memcontrol.h | 27
include/linux/memory.h | 8
include/linux/memory_hotplug.h | 15
include/linux/memremap.h | 2
include/linux/migrate.h | 11
include/linux/mm.h | 28
include/linux/mmzone.h | 20
include/linux/pagemap.h | 5
include/linux/pgtable.h | 12
include/linux/sched.h | 2
include/linux/sched/mm.h | 27
include/linux/shrinker.h | 7
include/linux/swap.h | 21
include/linux/userfaultfd_k.h | 55 +
include/linux/vm_event_item.h | 8
include/trace/events/cma.h | 92 +-
include/trace/events/migrate.h | 25
include/trace/events/mmflags.h | 7
include/uapi/linux/mempolicy.h | 7
include/uapi/linux/userfaultfd.h | 36
init/Kconfig | 5
kernel/sysctl.c | 2
lib/Kconfig.kfence | 1
lib/iov_iter.c | 8
mm/Kconfig | 28
mm/Makefile | 6
mm/cma.c | 70 +
mm/cma.h | 25
mm/cma_debug.c | 8
mm/cma_sysfs.c | 112 ++
mm/compaction.c | 113 ++
mm/filemap.c | 24
mm/frontswap.c | 12
mm/gup.c | 264 +++---
mm/gup_test.c | 29
mm/gup_test.h | 3
mm/highmem.c | 11
mm/huge_memory.c | 326 +++++++-
mm/hugetlb.c | 843 ++++++++++++++--------
mm/hugetlb_cgroup.c | 9
mm/internal.h | 10
mm/kfence/core.c | 61 +
mm/khugepaged.c | 63 -
mm/ksm.c | 17
mm/list_lru.c | 6
mm/memcontrol.c | 137 ---
mm/memory_hotplug.c | 220 +++++
mm/mempolicy.c | 16
mm/mempool.c | 2
mm/migrate.c | 103 --
mm/mlock.c | 4
mm/mmap.c | 18
mm/oom_kill.c | 2
mm/page_alloc.c | 83 +-
mm/process_vm_access.c | 1
mm/shmem.c | 2
mm/sparse.c | 4
mm/swap.c | 69 +
mm/swap_state.c | 4
mm/swapfile.c | 4
mm/truncate.c | 19
mm/userfaultfd.c | 39 -
mm/util.c | 26
mm/vmalloc.c | 2
mm/vmscan.c | 543 +++++++++-----
mm/vmstat.c | 45 -
mm/workingset.c | 1
mm/zsmalloc.c | 6
mm/zswap.c | 2
tools/testing/selftests/vm/.gitignore | 1
tools/testing/selftests/vm/Makefile | 1
tools/testing/selftests/vm/gup_test.c | 38
tools/testing/selftests/vm/split_huge_page_test.c | 400 ++++++++++
tools/testing/selftests/vm/userfaultfd.c | 164 ++++
125 files changed, 3596 insertions(+), 1668 deletions(-)
^ permalink raw reply [flat|nested] 232+ messages in thread
* Re: incoming
2021-05-05 1:32 incoming Andrew Morton
@ 2021-05-05 1:47 ` Linus Torvalds
2021-05-05 3:16 ` incoming Andrew Morton
0 siblings, 1 reply; 232+ messages in thread
From: Linus Torvalds @ 2021-05-05 1:47 UTC (permalink / raw)
To: Andrew Morton; +Cc: Linux-MM, mm-commits
On Tue, May 4, 2021 at 6:32 PM Andrew Morton <akpm@linux-foundation.org> wrote:
>
> 143 patches
Hmm. Only 140 seem to have made it to the list, with 103, 106 and 107 missing.
Maybe just some mail delay? But at least right now
https://lore.kernel.org/mm-commits/
doesn't show them (and thus 'b4' doesn't work).
I'll check again later.
Linus
^ permalink raw reply [flat|nested] 232+ messages in thread
* Re: incoming
2021-05-05 1:47 ` incoming Linus Torvalds
@ 2021-05-05 3:16 ` Andrew Morton
2021-05-05 17:10 ` incoming Linus Torvalds
0 siblings, 1 reply; 232+ messages in thread
From: Andrew Morton @ 2021-05-05 3:16 UTC (permalink / raw)
To: Linus Torvalds; +Cc: Linux-MM, mm-commits
On Tue, 4 May 2021 18:47:19 -0700 Linus Torvalds <torvalds@linux-foundation.org> wrote:
> On Tue, May 4, 2021 at 6:32 PM Andrew Morton <akpm@linux-foundation.org> wrote:
> >
> > 143 patches
>
> Hmm. Only 140 seem to have made it to the list, with 103, 106 and 107 missing.
>
> Maybe just some mail delay? But at least right now
>
> https://lore.kernel.org/mm-commits/
>
> doesn't show them (and thus 'b4' doesn't work).
>
> I'll check again later.
>
Well that's strange. I see all three via cc:me, but not on linux-mm or
mm-commits.
Let me resend right now with the same in-reply-to. Hopefully they will
land in the correct place.
^ permalink raw reply [flat|nested] 232+ messages in thread
* Re: incoming
2021-05-05 3:16 ` incoming Andrew Morton
@ 2021-05-05 17:10 ` Linus Torvalds
2021-05-05 17:44 ` incoming Andrew Morton
0 siblings, 1 reply; 232+ messages in thread
From: Linus Torvalds @ 2021-05-05 17:10 UTC (permalink / raw)
To: Andrew Morton, Konstantin Ryabitsev; +Cc: Linux-MM, mm-commits
On Tue, May 4, 2021 at 8:16 PM Andrew Morton <akpm@linux-foundation.org> wrote:
>
> Let me resend right now with the same in-reply-to. Hopefully they will
> land in the correct place.
Well, you re-sent it twice, and I have three copies in my own mailbox,
bot they still don't show up on the mm-commits mailing list.
So the list hates them for some odd reason.
I've picked them up locally, but adding Konstantin to the participants
to see if he can see what's up.
Konstantin: patches 103/106/107 are missing on lore out of Andrew's
series of 143. Odd.
Linus
^ permalink raw reply [flat|nested] 232+ messages in thread
* Re: incoming
2021-05-05 17:10 ` incoming Linus Torvalds
@ 2021-05-05 17:44 ` Andrew Morton
2021-05-06 3:19 ` incoming Anshuman Khandual
0 siblings, 1 reply; 232+ messages in thread
From: Andrew Morton @ 2021-05-05 17:44 UTC (permalink / raw)
To: Linus Torvalds; +Cc: Konstantin Ryabitsev, Linux-MM, mm-commits
[-- Attachment #1: Type: text/plain, Size: 1387 bytes --]
On Wed, 5 May 2021 10:10:33 -0700 Linus Torvalds <torvalds@linux-foundation.org> wrote:
> On Tue, May 4, 2021 at 8:16 PM Andrew Morton <akpm@linux-foundation.org> wrote:
> >
> > Let me resend right now with the same in-reply-to. Hopefully they will
> > land in the correct place.
>
> Well, you re-sent it twice, and I have three copies in my own mailbox,
> bot they still don't show up on the mm-commits mailing list.
>
> So the list hates them for some odd reason.
>
> I've picked them up locally, but adding Konstantin to the participants
> to see if he can see what's up.
>
> Konstantin: patches 103/106/107 are missing on lore out of Andrew's
> series of 143. Odd.
It's weird. They don't turn up on linux-mm either, and that's running
at kvack.org, also majordomo. They don't get through when sent with
either heirloom-mailx or with sylpheed.
Also, it seems that when Anshuman originally sent the patch, linux-mm
and linux-kernel didn't send it back out. So perhaps a spam filter
triggered?
I'm seeing
https://lore.kernel.org/linux-arm-kernel/1615278790-18053-3-git-send-email-anshuman.khandual@arm.com/
which is via linux-arm-kernel@lists.infradead.org but the linux-kernel
server massacred that patch series. Searching
https://lkml.org/lkml/2021/3/9 for "anshuman" only shows 3 of the 7
email series.
One of the emails (as sent my me) is attached, if that helps.
[-- Attachment #2: x.txt --]
[-- Type: text/plain, Size: 21048 bytes --]
Return-Path: <akpm@linux-foundation.org>
X-Spam-Checker-Version: SpamAssassin 3.4.1 (2015-04-28) on y
X-Spam-Level: (none)
X-Spam-Status: No, score=-101.5 required=2.5 tests=BAYES_00,T_DKIM_INVALID,
USER_IN_WHITELIST autolearn=ham autolearn_force=no version=3.4.1
Received: from localhost.localdomain (localhost.localdomain [127.0.0.1])
by localhost.localdomain (8.15.2/8.15.2/Debian-8ubuntu1) with ESMTP id 1453H2fk032202
for <akpm@localhost>; Tue, 4 May 2021 20:17:03 -0700
Received: from imap.fastmail.com [66.111.4.135]
by localhost.localdomain with IMAP (fetchmail-6.3.26)
for <akpm@localhost> (single-drop); Tue, 04 May 2021 20:17:03 -0700 (PDT)
Received: from compute1.internal (compute1.nyi.internal [10.202.2.41])
by sloti11d1t06 (Cyrus 3.5.0-alpha0-442-g5daca166b9-fm-20210428.001-g5daca166) with LMTPA;
Tue, 04 May 2021 23:16:31 -0400
X-Cyrus-Session-Id: sloti11d1t06-1620184591-1699471-2-6359664467419938249
X-Sieve: CMU Sieve 3.0
X-Resolved-to: akpm@mbx.kernel.org
X-Delivered-to: akpm@mbx.kernel.org
X-Mail-from: akpm@linux-foundation.org
Received: from mx6 ([10.202.2.205])
by compute1.internal (LMTPProxy); Tue, 04 May 2021 23:16:31 -0400
Received: from mx6.messagingengine.com (localhost [127.0.0.1])
by mailmx.nyi.internal (Postfix) with ESMTP id 40796C800E1
for <akpm@mbx.kernel.org>; Tue, 4 May 2021 23:16:31 -0400 (EDT)
Received: from mx6.messagingengine.com (localhost [127.0.0.1])
by mx6.messagingengine.com (Authentication Milter) with ESMTP
id 14870833D7F;
Tue, 4 May 2021 23:16:31 -0400
ARC-Seal: i=2; a=rsa-sha256; cv=pass; d=messagingengine.com; s=fm2; t=
1620184591; b=FBo7Gf3JFN+4QYg5Byan0oNm6RESv+sIf5HcaslVNsUd9SOTGS
yI0+IsXr1CUpGH783hE6fmgEq9SyfOwQVZjdikLaJS1+7u0JtfAYQFU3RORCtXlr
djJWrScfjVa8nAHX4rQCtzvtPYuzx5w7cTgGgeILgoJMxgLj7EC9xcT8BIf68+9W
Lw+ohAmcuiKhL2ez+de4SMuwdh3dh2FwAIHQOsSjEU1/NV+WGxMLwYbxWgTrqQGH
RQIzFNdq30qslW9huK47+e80uHOX2tXwxtshwbThFEn458bdV5LL6Y8Oh4ZWMbv1
tFgTt515DVedonZknxc07XsXtAjaJyB8bfHw==
ARC-Message-Signature: i=2; a=rsa-sha256; c=relaxed/relaxed; d=
messagingengine.com; h=date:from:to:subject:message-id
:in-reply-to; s=fm2; t=1620184591; bh=LuH7mbm3+zp863vKBEqKeoZtnp
uFxYpIb5oTVwf56Es=; b=m5E1fbz2b+an/X406oY3BuG0Zm4/W05vWAki8Lsnud
gPCc1LfPUFSuXaMppcEDPbLKprp4hH3T52itK4pivXMQCLEOyme7kVStaLMVTiky
Xxqh5ZdhOWvygBfda/GjfuLBSbbj2gfm8HPKpbL7CA5foelknIBhJHDzGkJyxetZ
YagZfVvtdo2OEwnC1mmjUCpKPO5+m5kaZO0ol6rPdl+TV0MKGhjLg+/i6Ia+0nFp
zDwV4VeACvVcGb2xY7KG5Z+BtqVxeVFn+w5JcqpWUtxEKoSBR4bWARzjwHg6eouh
7psOOKPTt/NzDKk+3f49lso5KlPiTF2xEU/+5SIttCkQ==
ARC-Authentication-Results: i=2; mx6.messagingengine.com;
arc=pass (as.1.google.com=pass, ams.1.google.com=pass)
smtp.remote-ip=209.85.215.198;
bimi=skipped (DMARC did not pass);
dkim=pass (1024-bit rsa key sha256) header.d=linux-foundation.org
header.i=@linux-foundation.org header.b=Gdz/3wY9 header.a=rsa-sha256
header.s=korg x-bits=1024;
dmarc=none policy.published-domain-policy=none
policy.applied-disposition=none policy.evaluated-disposition=none
(p=none,d=none,d.eval=none) policy.policy-from=p
header.from=linux-foundation.org;
iprev=pass smtp.remote-ip=209.85.215.198 (mail-pg1-f198.google.com);
spf=pass smtp.mailfrom=akpm@linux-foundation.org
smtp.helo=mail-pg1-f198.google.com;
x-aligned-from=pass (Address match);
x-arc-spf=pass
(google.com: domain of akpm@linux-foundation.org designates 198.145.29.99 as permitted sender)
smtp.mailfrom=akpm@linux-foundation.org x-arc-instance=1
x-arc-domain=google.com (Trusted from aar.1.google.com);
x-csa=none;
x-google-dkim=fail (message has been altered, 2048-bit rsa key)
header.d=1e100.net header.i=@1e100.net header.b=VZuDOxUf;
x-me-sender=none;
x-ptr=pass smtp.helo=mail-pg1-f198.google.com
policy.ptr=mail-pg1-f198.google.com;
x-return-mx=pass header.domain=linux-foundation.org policy.is_org=yes
(MX Records found: ASPMX.L.GOOGLE.COM,ALT1.ASPMX.L.GOOGLE.COM,ALT2.ASPMX.L.GOOGLE.COM,ALT3.ASPMX.L.GOOGLE.COM,ALT4.ASPMX.L.GOOGLE.COM);
x-return-mx=pass smtp.domain=linux-foundation.org policy.is_org=yes
(MX Records found: ASPMX.L.GOOGLE.COM,ALT1.ASPMX.L.GOOGLE.COM,ALT2.ASPMX.L.GOOGLE.COM,ALT3.ASPMX.L.GOOGLE.COM,ALT4.ASPMX.L.GOOGLE.COM);
x-tls=pass smtp.version=TLSv1.3 smtp.cipher=TLS_AES_256_GCM_SHA384
smtp.bits=256/256;
x-vs=clean score=40 state=0
Authentication-Results: mx6.messagingengine.com;
arc=pass (as.1.google.com=pass, ams.1.google.com=pass)
smtp.remote-ip=209.85.215.198;
bimi=skipped (DMARC did not pass);
dkim=pass (1024-bit rsa key sha256) header.d=linux-foundation.org
header.i=@linux-foundation.org header.b=Gdz/3wY9 header.a=rsa-sha256
header.s=korg x-bits=1024;
dmarc=none policy.published-domain-policy=none
policy.applied-disposition=none policy.evaluated-disposition=none
(p=none,d=none,d.eval=none) policy.policy-from=p
header.from=linux-foundation.org;
iprev=pass smtp.remote-ip=209.85.215.198 (mail-pg1-f198.google.com);
spf=pass smtp.mailfrom=akpm@linux-foundation.org
smtp.helo=mail-pg1-f198.google.com;
x-aligned-from=pass (Address match);
x-arc-spf=pass
(google.com: domain of akpm@linux-foundation.org designates 198.145.29.99 as permitted sender)
smtp.mailfrom=akpm@linux-foundation.org x-arc-instance=1
x-arc-domain=google.com (Trusted from aar.1.google.com);
x-csa=none;
x-google-dkim=fail (message has been altered, 2048-bit rsa key)
header.d=1e100.net header.i=@1e100.net header.b=VZuDOxUf;
x-me-sender=none;
x-ptr=pass smtp.helo=mail-pg1-f198.google.com
policy.ptr=mail-pg1-f198.google.com;
x-return-mx=pass header.domain=linux-foundation.org policy.is_org=yes
(MX Records found: ASPMX.L.GOOGLE.COM,ALT1.ASPMX.L.GOOGLE.COM,ALT2.ASPMX.L.GOOGLE.COM,ALT3.ASPMX.L.GOOGLE.COM,ALT4.ASPMX.L.GOOGLE.COM);
x-return-mx=pass smtp.domain=linux-foundation.org policy.is_org=yes
(MX Records found: ASPMX.L.GOOGLE.COM,ALT1.ASPMX.L.GOOGLE.COM,ALT2.ASPMX.L.GOOGLE.COM,ALT3.ASPMX.L.GOOGLE.COM,ALT4.ASPMX.L.GOOGLE.COM);
x-tls=pass smtp.version=TLSv1.3 smtp.cipher=TLS_AES_256_GCM_SHA384
smtp.bits=256/256;
x-vs=clean score=40 state=0
X-ME-VSCause: gggruggvucftvghtrhhoucdtuddrgeduledrvdefjedgieegucetufdoteggodetrfdotf
fvucfrrhhofhhilhgvmecuhfgrshhtofgrihhlpdggtfgfnhhsuhgsshgtrhhisggvpdfu
rfetoffkrfgpnffqhgenuceurghilhhouhhtmecufedttdenucgoufhorhhtvggutfgvtg
hiphdvucdlgedtmdenucfjughrpeffhffvuffkjggfsedttdertddtredtnecuhfhrohhm
peetnhgurhgvficuofhorhhtohhnuceorghkphhmsehlihhnuhigqdhfohhunhgurghtih
honhdrohhrgheqnecuggftrfgrthhtvghrnhepjeevfeduveffvddvudetkefhgeduveeu
geevvdfhhfevhfekkedtieefgfduheeinecuffhomhgrihhnpehkvghrnhgvlhdrohhrgh
enucfkphepvddtledrkeehrddvudehrdduleekpdduleekrddugeehrddvledrleelnecu
uegrugftvghpuhhtkfhppeduleekrddugeehrddvledrleelnecuvehluhhsthgvrhfuih
iivgeptdenucfrrghrrghmpehinhgvthepvddtledrkeehrddvudehrdduleekpdhhvghl
ohepmhgrihhlqdhpghduqdhfudelkedrghhoohhglhgvrdgtohhmpdhmrghilhhfrhhomh
epoegrkhhpmheslhhinhhugidqfhhouhhnuggrthhiohhnrdhorhhgqe
X-ME-VSScore: 40
X-ME-VSCategory: clean
X-ME-CSA: none
Received-SPF: pass
(linux-foundation.org: Sender is authorized to use 'akpm@linux-foundation.org' in 'mfrom' identity (mechanism 'include:_spf.google.com' matched))
receiver=mx6.messagingengine.com;
identity=mailfrom;
envelope-from="akpm@linux-foundation.org";
helo=mail-pg1-f198.google.com;
client-ip=209.85.215.198
Received: from mail-pg1-f198.google.com (mail-pg1-f198.google.com [209.85.215.198])
(using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits)
key-exchange X25519 server-signature RSA-PSS (2048 bits) server-digest SHA256)
(No client certificate requested)
by mx6.messagingengine.com (Postfix) with ESMTPS
for <akpm@mbx.kernel.org>; Tue, 4 May 2021 23:16:31 -0400 (EDT)
Received: by mail-pg1-f198.google.com with SMTP id g5-20020a63f4050000b02901f6c7b9a6d0so593624pgi.5
for <akpm@mbx.kernel.org>; Tue, 04 May 2021 20:16:30 -0700 (PDT)
X-Google-DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed;
d=1e100.net; s=20161025;
h=x-gm-message-state:dkim-signature:date:from:to:subject:message-id
:in-reply-to:user-agent;
bh=LuH7mbm3+zp863vKBEqKeoZtnpuFxYpIb5oTVwf56Es=;
b=VZuDOxUfeHXJz1/CiFfcxuMVHkmW5RznvqYS+Py8Ub6nHHXprQJGE9Ze3WgH+1ylSe
NJLEC7xgv15SR9A+e/MT4RTj3OVOwtd1Zi2vPav39a9K4tP+2uL2Ei+5d7FtT3LLZsjo
feek/DqCGSkJ/EC5woLyU9BBkfLUuQ9/2HiDCk10BMetEfWdor69Slb39NOXES8br02X
25Btabu9ZCWroyjQj7W5gwGr5Z6Hs2nbnnfAb+e92FalcUD/4ql77lNzRcWGi4/9TT8s
ntqI2g46Xv+k5LURaRH5CRBpxkkKgzcrioRPYFUHkEgOEWy1hPzg9QPk8ZO35Xm9R9d2
vl3Q==
X-Gm-Message-State: AOAM531IlYUTVWcMrsTunnxZWB7SKeeOmoZj5mZ1A5tl7N/JlZUueN8L
tvyRKnvxHr6a5mDaGHN9Tb1N/iCzT0U5oQgRVTxTnj1qFGibRa9+leLQNKX0aGlNg9JiaMfromb
xyOlCUpVXOlVvchuwTUSTn7rXum+Hh3PWQZm5II/EX+0AkzKqez62Z8U=
X-Received: by 2002:a17:90a:a581:: with SMTP id b1mr32203271pjq.53.1620184589161;
Tue, 04 May 2021 20:16:29 -0700 (PDT)
X-Google-Smtp-Source: ABdhPJxffoGdRqAjUagWoMVD5p/Lk1KTEDftEhkWh8ewatgDmZLlxh0lO1hxYIdYYwoO5dsJ/i0z
X-Received: by 2002:a17:90a:a581:: with SMTP id b1mr32203198pjq.53.1620184588109;
Tue, 04 May 2021 20:16:28 -0700 (PDT)
ARC-Seal: i=1; a=rsa-sha256; t=1620184588; cv=none;
d=google.com; s=arc-20160816;
b=Fr2b2AMXJr6OeNpSql45tq1korkuDOunp7t+DpARuEBnwvQnKfagyipQ93jywsRf/c
/i/mP2eTmJwOLWNORClh1MGF/0VfBx1ULoB9W4CI3LpVgGFXGGFis8LTcvUYD5yvhlsV
50rm2j34iS9lyo04FB/hbhGkwLtUhz2PGkLGuqHspTd+pUpUCf5SLxGJbZC5uCcUEsbO
8WSDBWyvaCPjFzJQZK60gK70ticKW+fCG1xHtOG4qsFCbqEpFKBy8eVK83OBazo/dQDr
DOheWNWyw2o/WMP4GpZMvZuj30dx3j8xnBahIpnMIQJaog6wLMcVX9pkQ8UJym3/PGNm
pO/g==
ARC-Message-Signature: i=1; a=rsa-sha256; c=relaxed/relaxed; d=google.com; s=arc-20160816;
h=user-agent:in-reply-to:message-id:subject:to:from:date
:dkim-signature;
bh=LuH7mbm3+zp863vKBEqKeoZtnpuFxYpIb5oTVwf56Es=;
b=vVN16NPMKjoxSJQ6b36VXFCkZqnmG7wABfilgE069txZqmHpEMyZb8lRStkHy557LM
Kn7UfJFP3xwsP8ZTCipVDZ6tpFW/hYFU9o4th9G8asWs+MOf9xpWX2LQZ1FTmaao2Fg5
uCHypz39cnAh0Z1EJfNsTcaTGIrkbBd6zje+mtBgs8hnfH8HcWBYTPCHCCx950Z928tb
XOPd/Igs7yzD1ioBiGXZj/ciwPbWVTaZXBg4JOZSApxkDMfuMyfyLLOs++EVkyxJHUme
TmgwvLkixcwEtKF7gIeqEhwvOUSVvilLuJLFVaLumwTcjJ1amVfGcJhBE7LIM9C3SMpA
rOOg==
ARC-Authentication-Results: i=1; mx.google.com;
dkim=pass header.i=@linux-foundation.org header.s=korg header.b="Gdz/3wY9";
spf=pass (google.com: domain of akpm@linux-foundation.org designates 198.145.29.99 as permitted sender) smtp.mailfrom=akpm@linux-foundation.org
Received: from mail.kernel.org (mail.kernel.org. [198.145.29.99])
by mx.google.com with ESMTPS id c85si20173199pfb.8.2021.05.04.20.16.27
(version=TLS1_2 cipher=ECDHE-ECDSA-AES128-GCM-SHA256 bits=128/128);
Tue, 04 May 2021 20:16:28 -0700 (PDT)
Received-SPF: pass (google.com: domain of akpm@linux-foundation.org designates 198.145.29.99 as permitted sender) client-ip=198.145.29.99;
Authentication-Results: mx.google.com;
dkim=pass header.i=@linux-foundation.org header.s=korg header.b="Gdz/3wY9";
spf=pass (google.com: domain of akpm@linux-foundation.org designates 198.145.29.99 as permitted sender) smtp.mailfrom=akpm@linux-foundation.org
Received: by mail.kernel.org (Postfix) with ESMTPSA id A4DB4610D2;
Wed, 5 May 2021 03:16:26 +0000 (UTC)
DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/simple; d=linux-foundation.org;
s=korg; t=1620184587;
bh=TxN4wgKcKf2UUem+5pL09m9GL/7U592mEalo2U6vwAU=;
h=Date:From:To:Subject:In-Reply-To:From;
b=Gdz/3wY9ktH3hOmn2DAOkfh0JXwPdMJ8xsNQFa9eI25K39Z3iHdRGo9jX3QtMDtog
D4Zakt52CQCYsV91c9oCai8KnCTkkAjJq/Ez7p8UHpz97Go3yYYxqg6DDl6d8HCQvN
H47dTaZAgeH2sw29bjB9fRzNuTx7k4RAPlqZIpiE=
Date: Tue, 04 May 2021 20:16:26 -0700
From: Andrew Morton <akpm@linux-foundation.org>
To: akpm@linux-foundation.org, anshuman.khandual@arm.com, aou@eecs.berkeley.edu, arnd@arndb.de, benh@kernel.crashing.org, borntraeger@de.ibm.com, bp@alien8.de, catalin.marinas@arm.com, dalias@libc.org, deller@gmx.de, gor@linux.ibm.com, hca@linux.ibm.com, hpa@zytor.com, James.Bottomley@HansenPartnership.com, linux-mm@kvack.org, linux@armlinux.org.uk, mingo@redhat.com, mm-commits@vger.kernel.org, mpe@ellerman.id.au, palmerdabbelt@google.com, paul.walmsley@sifive.com, paulus@samba.org, tglx@linutronix.de, torvalds@linux-foundation.org, tsbogend@alpha.franken.de, vgupta@synopsys.com, viro@zeniv.linux.org.uk, will@kernel.org, ysato@users.osdn.me
Subject: [patch 103/143] mm: generalize SYS_SUPPORTS_HUGETLBFS (rename as ARCH_SUPPORTS_HUGETLBFS)
Message-ID: <20210505031626.c8o4WL7KE%akpm@linux-foundation.org>
In-Reply-To: <20210504183219.a3cc46aee4013d77402276c5@linux-foundation.org>
User-Agent: s-nail v14.8.16
X-Gm-Original-To: akpm@linux-foundation.org
From: Anshuman Khandual <anshuman.khandual@arm.com>
Subject: mm: generalize SYS_SUPPORTS_HUGETLBFS (rename as ARCH_SUPPORTS_HUGETLBFS)
SYS_SUPPORTS_HUGETLBFS config has duplicate definitions on platforms that
subscribe it. Instead, just make it a generic option which can be
selected on applicable platforms. Also rename it as
ARCH_SUPPORTS_HUGETLBFS instead. This reduces code duplication and makes
it cleaner.
Link: https://lkml.kernel.org/r/1617259448-22529-3-git-send-email-anshuman.khandual@arm.com
Signed-off-by: Anshuman Khandual <anshuman.khandual@arm.com>
Acked-by: Catalin Marinas <catalin.marinas@arm.com> [arm64]
Acked-by: Palmer Dabbelt <palmerdabbelt@google.com> [riscv]
Acked-by: Michael Ellerman <mpe@ellerman.id.au> [powerpc]
Cc: Russell King <linux@armlinux.org.uk>
Cc: Will Deacon <will@kernel.org>
Cc: Thomas Bogendoerfer <tsbogend@alpha.franken.de>
Cc: "James E.J. Bottomley" <James.Bottomley@HansenPartnership.com>
Cc: Helge Deller <deller@gmx.de>
Cc: Benjamin Herrenschmidt <benh@kernel.crashing.org>
Cc: Paul Mackerras <paulus@samba.org>
Cc: Paul Walmsley <paul.walmsley@sifive.com>
Cc: Albert Ou <aou@eecs.berkeley.edu>
Cc: Yoshinori Sato <ysato@users.sourceforge.jp>
Cc: Rich Felker <dalias@libc.org>
Cc: Alexander Viro <viro@zeniv.linux.org.uk>
Cc: Arnd Bergmann <arnd@arndb.de>
Cc: Borislav Petkov <bp@alien8.de>
Cc: Christian Borntraeger <borntraeger@de.ibm.com>
Cc: Heiko Carstens <hca@linux.ibm.com>
Cc: "H. Peter Anvin" <hpa@zytor.com>
Cc: Ingo Molnar <mingo@redhat.com>
Cc: Thomas Gleixner <tglx@linutronix.de>
Cc: Vasily Gorbik <gor@linux.ibm.com>
Cc: Vineet Gupta <vgupta@synopsys.com>
Signed-off-by: Andrew Morton <akpm@linux-foundation.org>
---
arch/arm/Kconfig | 5 +----
arch/arm64/Kconfig | 4 +---
arch/mips/Kconfig | 6 +-----
arch/parisc/Kconfig | 5 +----
arch/powerpc/Kconfig | 3 ---
arch/powerpc/platforms/Kconfig.cputype | 6 +++---
arch/riscv/Kconfig | 5 +----
arch/sh/Kconfig | 5 +----
fs/Kconfig | 5 ++++-
9 files changed, 13 insertions(+), 31 deletions(-)
--- a/arch/arm64/Kconfig~mm-generalize-sys_supports_hugetlbfs-rename-as-arch_supports_hugetlbfs
+++ a/arch/arm64/Kconfig
@@ -73,6 +73,7 @@ config ARM64
select ARCH_USE_QUEUED_SPINLOCKS
select ARCH_USE_SYM_ANNOTATIONS
select ARCH_SUPPORTS_DEBUG_PAGEALLOC
+ select ARCH_SUPPORTS_HUGETLBFS
select ARCH_SUPPORTS_MEMORY_FAILURE
select ARCH_SUPPORTS_SHADOW_CALL_STACK if CC_HAVE_SHADOW_CALL_STACK
select ARCH_SUPPORTS_LTO_CLANG if CPU_LITTLE_ENDIAN
@@ -1072,9 +1073,6 @@ config HW_PERF_EVENTS
def_bool y
depends on ARM_PMU
-config SYS_SUPPORTS_HUGETLBFS
- def_bool y
-
config ARCH_HAS_FILTER_PGPROT
def_bool y
--- a/arch/arm/Kconfig~mm-generalize-sys_supports_hugetlbfs-rename-as-arch_supports_hugetlbfs
+++ a/arch/arm/Kconfig
@@ -31,6 +31,7 @@ config ARM
select ARCH_OPTIONAL_KERNEL_RWX if ARCH_HAS_STRICT_KERNEL_RWX
select ARCH_OPTIONAL_KERNEL_RWX_DEFAULT if CPU_V7
select ARCH_SUPPORTS_ATOMIC_RMW
+ select ARCH_SUPPORTS_HUGETLBFS if ARM_LPAE
select ARCH_USE_BUILTIN_BSWAP
select ARCH_USE_CMPXCHG_LOCKREF
select ARCH_USE_MEMTEST
@@ -1511,10 +1512,6 @@ config HW_PERF_EVENTS
def_bool y
depends on ARM_PMU
-config SYS_SUPPORTS_HUGETLBFS
- def_bool y
- depends on ARM_LPAE
-
config HAVE_ARCH_TRANSPARENT_HUGEPAGE
def_bool y
depends on ARM_LPAE
--- a/arch/mips/Kconfig~mm-generalize-sys_supports_hugetlbfs-rename-as-arch_supports_hugetlbfs
+++ a/arch/mips/Kconfig
@@ -19,6 +19,7 @@ config MIPS
select ARCH_USE_MEMTEST
select ARCH_USE_QUEUED_RWLOCKS
select ARCH_USE_QUEUED_SPINLOCKS
+ select ARCH_SUPPORTS_HUGETLBFS if CPU_SUPPORTS_HUGEPAGES
select ARCH_WANT_DEFAULT_TOPDOWN_MMAP_LAYOUT if MMU
select ARCH_WANT_IPC_PARSE_VERSION
select ARCH_WANT_LD_ORPHAN_WARN
@@ -1287,11 +1288,6 @@ config SYS_SUPPORTS_BIG_ENDIAN
config SYS_SUPPORTS_LITTLE_ENDIAN
bool
-config SYS_SUPPORTS_HUGETLBFS
- bool
- depends on CPU_SUPPORTS_HUGEPAGES
- default y
-
config MIPS_HUGE_TLB_SUPPORT
def_bool HUGETLB_PAGE || TRANSPARENT_HUGEPAGE
--- a/arch/parisc/Kconfig~mm-generalize-sys_supports_hugetlbfs-rename-as-arch_supports_hugetlbfs
+++ a/arch/parisc/Kconfig
@@ -12,6 +12,7 @@ config PARISC
select ARCH_HAS_STRICT_KERNEL_RWX
select ARCH_HAS_UBSAN_SANITIZE_ALL
select ARCH_NO_SG_CHAIN
+ select ARCH_SUPPORTS_HUGETLBFS if PA20
select ARCH_SUPPORTS_MEMORY_FAILURE
select DMA_OPS
select RTC_CLASS
@@ -138,10 +139,6 @@ config PGTABLE_LEVELS
default 3 if 64BIT && PARISC_PAGE_SIZE_4KB
default 2
-config SYS_SUPPORTS_HUGETLBFS
- def_bool y if PA20
-
-
menu "Processor type and features"
choice
--- a/arch/powerpc/Kconfig~mm-generalize-sys_supports_hugetlbfs-rename-as-arch_supports_hugetlbfs
+++ a/arch/powerpc/Kconfig
@@ -697,9 +697,6 @@ config ARCH_SPARSEMEM_DEFAULT
def_bool y
depends on PPC_BOOK3S_64
-config SYS_SUPPORTS_HUGETLBFS
- bool
-
config ILLEGAL_POINTER_VALUE
hex
# This is roughly half way between the top of user space and the bottom
--- a/arch/powerpc/platforms/Kconfig.cputype~mm-generalize-sys_supports_hugetlbfs-rename-as-arch_supports_hugetlbfs
+++ a/arch/powerpc/platforms/Kconfig.cputype
@@ -40,8 +40,8 @@ config PPC_85xx
config PPC_8xx
bool "Freescale 8xx"
+ select ARCH_SUPPORTS_HUGETLBFS
select FSL_SOC
- select SYS_SUPPORTS_HUGETLBFS
select PPC_HAVE_KUEP
select PPC_HAVE_KUAP
select HAVE_ARCH_VMAP_STACK
@@ -95,9 +95,9 @@ config PPC_BOOK3S_64
bool "Server processors"
select PPC_FPU
select PPC_HAVE_PMU_SUPPORT
- select SYS_SUPPORTS_HUGETLBFS
select HAVE_ARCH_TRANSPARENT_HUGEPAGE
select ARCH_ENABLE_THP_MIGRATION if TRANSPARENT_HUGEPAGE
+ select ARCH_SUPPORTS_HUGETLBFS
select ARCH_SUPPORTS_NUMA_BALANCING
select IRQ_WORK
select PPC_MM_SLICES
@@ -278,9 +278,9 @@ config FSL_BOOKE
# this is for common code between PPC32 & PPC64 FSL BOOKE
config PPC_FSL_BOOK3E
bool
+ select ARCH_SUPPORTS_HUGETLBFS if PHYS_64BIT || PPC64
select FSL_EMB_PERFMON
select PPC_SMP_MUXED_IPI
- select SYS_SUPPORTS_HUGETLBFS if PHYS_64BIT || PPC64
select PPC_DOORBELL
default y if FSL_BOOKE
--- a/arch/riscv/Kconfig~mm-generalize-sys_supports_hugetlbfs-rename-as-arch_supports_hugetlbfs
+++ a/arch/riscv/Kconfig
@@ -30,6 +30,7 @@ config RISCV
select ARCH_HAS_STRICT_KERNEL_RWX if MMU
select ARCH_OPTIONAL_KERNEL_RWX if ARCH_HAS_STRICT_KERNEL_RWX
select ARCH_OPTIONAL_KERNEL_RWX_DEFAULT
+ select ARCH_SUPPORTS_HUGETLBFS if MMU
select ARCH_WANT_DEFAULT_TOPDOWN_MMAP_LAYOUT if MMU
select ARCH_WANT_FRAME_POINTERS
select ARCH_WANT_HUGE_PMD_SHARE if 64BIT
@@ -165,10 +166,6 @@ config ARCH_WANT_GENERAL_HUGETLB
config ARCH_SUPPORTS_UPROBES
def_bool y
-config SYS_SUPPORTS_HUGETLBFS
- depends on MMU
- def_bool y
-
config STACKTRACE_SUPPORT
def_bool y
--- a/arch/sh/Kconfig~mm-generalize-sys_supports_hugetlbfs-rename-as-arch_supports_hugetlbfs
+++ a/arch/sh/Kconfig
@@ -101,9 +101,6 @@ config SYS_SUPPORTS_APM_EMULATION
bool
select ARCH_SUSPEND_POSSIBLE
-config SYS_SUPPORTS_HUGETLBFS
- bool
-
config SYS_SUPPORTS_SMP
bool
@@ -175,12 +172,12 @@ config CPU_SH3
config CPU_SH4
bool
+ select ARCH_SUPPORTS_HUGETLBFS if MMU
select CPU_HAS_INTEVT
select CPU_HAS_SR_RB
select CPU_HAS_FPU if !CPU_SH4AL_DSP
select SH_INTC
select SYS_SUPPORTS_SH_TMU
- select SYS_SUPPORTS_HUGETLBFS if MMU
config CPU_SH4A
bool
--- a/fs/Kconfig~mm-generalize-sys_supports_hugetlbfs-rename-as-arch_supports_hugetlbfs
+++ a/fs/Kconfig
@@ -223,10 +223,13 @@ config TMPFS_INODE64
If unsure, say N.
+config ARCH_SUPPORTS_HUGETLBFS
+ def_bool n
+
config HUGETLBFS
bool "HugeTLB file system support"
depends on X86 || IA64 || SPARC64 || (S390 && 64BIT) || \
- SYS_SUPPORTS_HUGETLBFS || BROKEN
+ ARCH_SUPPORTS_HUGETLBFS || BROKEN
help
hugetlbfs is a filesystem backing for HugeTLB pages, based on
ramfs. For architectures that support it, say Y here and read
_
^ permalink raw reply [flat|nested] 232+ messages in thread
* Re: incoming
2021-05-05 17:44 ` incoming Andrew Morton
@ 2021-05-06 3:19 ` Anshuman Khandual
0 siblings, 0 replies; 232+ messages in thread
From: Anshuman Khandual @ 2021-05-06 3:19 UTC (permalink / raw)
To: Andrew Morton, Linus Torvalds; +Cc: Konstantin Ryabitsev, Linux-MM, mm-commits
On 5/5/21 11:14 PM, Andrew Morton wrote:
> On Wed, 5 May 2021 10:10:33 -0700 Linus Torvalds <torvalds@linux-foundation.org> wrote:
>
>> On Tue, May 4, 2021 at 8:16 PM Andrew Morton <akpm@linux-foundation.org> wrote:
>>> Let me resend right now with the same in-reply-to. Hopefully they will
>>> land in the correct place.
>> Well, you re-sent it twice, and I have three copies in my own mailbox,
>> bot they still don't show up on the mm-commits mailing list.
>>
>> So the list hates them for some odd reason.
>>
>> I've picked them up locally, but adding Konstantin to the participants
>> to see if he can see what's up.
>>
>> Konstantin: patches 103/106/107 are missing on lore out of Andrew's
>> series of 143. Odd.
> It's weird. They don't turn up on linux-mm either, and that's running
> at kvack.org, also majordomo. They don't get through when sent with
> either heirloom-mailx or with sylpheed.
>
> Also, it seems that when Anshuman originally sent the patch, linux-mm
> and linux-kernel didn't send it back out. So perhaps a spam filter
> triggered?
>
> I'm seeing
>
> https://lore.kernel.org/linux-arm-kernel/1615278790-18053-3-git-send-email-anshuman.khandual@arm.com/
>
> which is via linux-arm-kernel@lists.infradead.org but the linux-kernel
> server massacred that patch series. Searching
> https://lkml.org/lkml/2021/3/9 for "anshuman" only shows 3 of the 7
> email series.
Yeah these patches faced problem from the very beginning getting
into the MM/LKML list for some strange reason.
^ permalink raw reply [flat|nested] 232+ messages in thread
* incoming
@ 2021-05-07 1:01 Andrew Morton
2021-05-07 7:12 ` incoming Linus Torvalds
0 siblings, 1 reply; 232+ messages in thread
From: Andrew Morton @ 2021-05-07 1:01 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm
This is everything else from -mm for this merge window, with the
possible exception of Mike Rapoport's "secretmem" syscall patch series
(https://lkml.kernel.org/r/20210303162209.8609-1-rppt@kernel.org).
I've been wobbly about the secretmem patches due to doubts about
whether the feature is sufficiently useful to justify inclusion, but
developers are now weighing in with helpful information and I've asked Mike
for an extensively updated [0/n] changelog. This will take a few days
to play out so it is possible that I will prevail upon you for a post-rc1
merge. If that's a problem, there's always 5.13-rc1.
91 patches, based on 8ca5297e7e38f2dc8c753d33a5092e7be181fff0, plus
previously sent patches.
Thanks.
Subsystems affected by this patch series:
alpha
procfs
sysctl
misc
core-kernel
bitmap
lib
compat
checkpatch
epoll
isofs
nilfs2
hpfs
exit
fork
kexec
gcov
panic
delayacct
gdb
resource
selftests
async
initramfs
ipc
mm/cleanups
drivers/char
mm/slub
spelling
Subsystem: alpha
Randy Dunlap <rdunlap@infradead.org>:
alpha: eliminate old-style function definitions
alpha: csum_partial_copy.c: add function prototypes from <net/checksum.h>
Subsystem: procfs
Colin Ian King <colin.king@canonical.com>:
fs/proc/generic.c: fix incorrect pde_is_permanent check
Alexey Dobriyan <adobriyan@gmail.com>:
proc: save LOC in __xlate_proc_name()
proc: mandate ->proc_lseek in "struct proc_ops"
proc: delete redundant subset=pid check
selftests: proc: test subset=pid
Subsystem: sysctl
zhouchuangao <zhouchuangao@vivo.com>:
proc/sysctl: fix function name error in comments
Subsystem: misc
"Matthew Wilcox (Oracle)" <willy@infradead.org>:
include: remove pagemap.h from blkdev.h
Andy Shevchenko <andriy.shevchenko@linux.intel.com>:
kernel.h: drop inclusion in bitmap.h
Wan Jiabing <wanjiabing@vivo.com>:
linux/profile.h: remove unnecessary declaration
Subsystem: core-kernel
Rasmus Villemoes <linux@rasmusvillemoes.dk>:
kernel/async.c: fix pr_debug statement
kernel/cred.c: make init_groups static
Subsystem: bitmap
Yury Norov <yury.norov@gmail.com>:
Patch series "lib/find_bit: fast path for small bitmaps", v6:
tools: disable -Wno-type-limits
tools: bitmap: sync function declarations with the kernel
tools: sync BITMAP_LAST_WORD_MASK() macro with the kernel
arch: rearrange headers inclusion order in asm/bitops for m68k, sh and h8300
lib: extend the scope of small_const_nbits() macro
tools: sync small_const_nbits() macro with the kernel
lib: inline _find_next_bit() wrappers
tools: sync find_next_bit implementation
lib: add fast path for find_next_*_bit()
lib: add fast path for find_first_*_bit() and find_last_bit()
tools: sync lib/find_bit implementation
MAINTAINERS: add entry for the bitmap API
Subsystem: lib
Bhaskar Chowdhury <unixbhaskar@gmail.com>:
lib/bch.c: fix a typo in the file bch.c
Wang Qing <wangqing@vivo.com>:
lib: fix inconsistent indenting in process_bit1()
ToastC <mrtoastcheng@gmail.com>:
lib/list_sort.c: fix typo in function description
Bhaskar Chowdhury <unixbhaskar@gmail.com>:
lib/genalloc.c: Fix a typo
Richard Fitzgerald <rf@opensource.cirrus.com>:
lib: crc8: pointer to data block should be const
Zqiang <qiang.zhang@windriver.com>:
lib: stackdepot: turn depot_lock spinlock to raw_spinlock
Alex Shi <alexs@kernel.org>:
lib/percpu_counter: tame kernel-doc compile warning
lib/genalloc: add parameter description to fix doc compile warning
Randy Dunlap <rdunlap@infradead.org>:
lib: parser: clean up kernel-doc
Subsystem: compat
Masahiro Yamada <masahiroy@kernel.org>:
include/linux/compat.h: remove unneeded declaration from COMPAT_SYSCALL_DEFINEx()
Subsystem: checkpatch
Joe Perches <joe@perches.com>:
checkpatch: warn when missing newline in return sysfs_emit() formats
Vincent Mailhol <mailhol.vincent@wanadoo.fr>:
checkpatch: exclude four preprocessor sub-expressions from MACRO_ARG_REUSE
Christophe JAILLET <christophe.jaillet@wanadoo.fr>:
checkpatch: improve ALLOC_ARRAY_ARGS test
Subsystem: epoll
Davidlohr Bueso <dave@stgolabs.net>:
Patch series "fs/epoll: restore user-visible behavior upon event ready":
kselftest: introduce new epoll test case
fs/epoll: restore waking from ep_done_scan()
Subsystem: isofs
"Gustavo A. R. Silva" <gustavoars@kernel.org>:
isofs: fix fall-through warnings for Clang
Subsystem: nilfs2
Liu xuzhi <liu.xuzhi@zte.com.cn>:
fs/nilfs2: fix misspellings using codespell tool
Lu Jialin <lujialin4@huawei.com>:
nilfs2: fix typos in comments
Subsystem: hpfs
"Gustavo A. R. Silva" <gustavoars@kernel.org>:
hpfs: replace one-element array with flexible-array member
Subsystem: exit
Jim Newsome <jnewsome@torproject.org>:
do_wait: make PIDTYPE_PID case O(1) instead of O(n)
Subsystem: fork
Rolf Eike Beer <eb@emlix.com>:
kernel/fork.c: simplify copy_mm()
Xiaofeng Cao <cxfcosmos@gmail.com>:
kernel/fork.c: fix typos
Subsystem: kexec
Saeed Mirzamohammadi <saeed.mirzamohammadi@oracle.com>:
kernel/crash_core: add crashkernel=auto for vmcore creation
Joe LeVeque <jolevequ@microsoft.com>:
kexec: Add kexec reboot string
Jia-Ju Bai <baijiaju1990@gmail.com>:
kernel: kexec_file: fix error return code of kexec_calculate_store_digests()
Pavel Tatashin <pasha.tatashin@soleen.com>:
kexec: dump kmessage before machine_kexec
Subsystem: gcov
Johannes Berg <johannes.berg@intel.com>:
gcov: combine common code
gcov: simplify buffer allocation
gcov: use kvmalloc()
Nick Desaulniers <ndesaulniers@google.com>:
gcov: clang: drop support for clang-10 and older
Subsystem: panic
He Ying <heying24@huawei.com>:
smp: kernel/panic.c - silence warnings
Subsystem: delayacct
Yafang Shao <laoar.shao@gmail.com>:
delayacct: clear right task's flag after blkio completes
Subsystem: gdb
Johannes Berg <johannes.berg@intel.com>:
gdb: lx-symbols: store the abspath()
Barry Song <song.bao.hua@hisilicon.com>:
Patch series "scripts/gdb: clarify the platforms supporting lx_current and add arm64 support", v2:
scripts/gdb: document lx_current is only supported by x86
scripts/gdb: add lx_current support for arm64
Subsystem: resource
David Hildenbrand <david@redhat.com>:
Patch series "kernel/resource: make walk_system_ram_res() and walk_mem_res() search the whole tree", v2:
kernel/resource: make walk_system_ram_res() find all busy IORESOURCE_SYSTEM_RAM resources
kernel/resource: make walk_mem_res() find all busy IORESOURCE_MEM resources
kernel/resource: remove first_lvl / siblings_only logic
Alistair Popple <apopple@nvidia.com>:
kernel/resource: allow region_intersects users to hold resource_lock
kernel/resource: refactor __request_region to allow external locking
kernel/resource: fix locking in request_free_mem_region
Subsystem: selftests
Zhang Yunkai <zhang.yunkai@zte.com.cn>:
selftests: remove duplicate include
Subsystem: async
Rasmus Villemoes <linux@rasmusvillemoes.dk>:
kernel/async.c: stop guarding pr_debug() statements
kernel/async.c: remove async_unregister_domain()
Subsystem: initramfs
Rasmus Villemoes <linux@rasmusvillemoes.dk>:
Patch series "background initramfs unpacking, and CONFIG_MODPROBE_PATH", v3:
init/initramfs.c: do unpacking asynchronously
modules: add CONFIG_MODPROBE_PATH
Subsystem: ipc
Bhaskar Chowdhury <unixbhaskar@gmail.com>:
ipc/sem.c: mundane typo fixes
Subsystem: mm/cleanups
Shijie Luo <luoshijie1@huawei.com>:
mm: fix some typos and code style problems
Subsystem: drivers/char
David Hildenbrand <david@redhat.com>:
Patch series "drivers/char: remove /dev/kmem for good":
drivers/char: remove /dev/kmem for good
mm: remove xlate_dev_kmem_ptr()
mm/vmalloc: remove vwrite()
Subsystem: mm/slub
Maninder Singh <maninder1.s@samsung.com>:
arm: print alloc free paths for address in registers
Subsystem: spelling
Drew Fustini <drew@beagleboard.org>:
scripts/spelling.txt: add "overlfow"
zuoqilin <zuoqilin@yulong.com>:
scripts/spelling.txt: Add "diabled" typo
Drew Fustini <drew@beagleboard.org>:
scripts/spelling.txt: add "overflw"
Colin Ian King <colin.king@canonical.com>:
mm/slab.c: fix spelling mistake "disired" -> "desired"
Bhaskar Chowdhury <unixbhaskar@gmail.com>:
include/linux/pgtable.h: few spelling fixes
zhouchuangao <zhouchuangao@vivo.com>:
kernel/umh.c: fix some spelling mistakes
Xiaofeng Cao <cxfcosmos@gmail.com>:
kernel/user_namespace.c: fix typos
Bhaskar Chowdhury <unixbhaskar@gmail.com>:
kernel/up.c: fix typo
Xiaofeng Cao <caoxiaofeng@yulong.com>:
kernel/sys.c: fix typo
dingsenjie <dingsenjie@yulong.com>:
fs: fat: fix spelling typo of values
Bhaskar Chowdhury <unixbhaskar@gmail.com>:
ipc/sem.c: spelling fix
Masahiro Yamada <masahiroy@kernel.org>:
treewide: remove editor modelines and cruft
Ingo Molnar <mingo@kernel.org>:
mm: fix typos in comments
Lu Jialin <lujialin4@huawei.com>:
mm: fix typos in comments
Documentation/admin-guide/devices.txt | 2
Documentation/admin-guide/kdump/kdump.rst | 3
Documentation/admin-guide/kernel-parameters.txt | 18
Documentation/dev-tools/gdb-kernel-debugging.rst | 4
MAINTAINERS | 16
arch/Kconfig | 20
arch/alpha/include/asm/io.h | 5
arch/alpha/kernel/pc873xx.c | 4
arch/alpha/lib/csum_partial_copy.c | 1
arch/arm/configs/dove_defconfig | 1
arch/arm/configs/magician_defconfig | 1
arch/arm/configs/moxart_defconfig | 1
arch/arm/configs/mps2_defconfig | 1
arch/arm/configs/mvebu_v5_defconfig | 1
arch/arm/configs/xcep_defconfig | 1
arch/arm/include/asm/bug.h | 1
arch/arm/include/asm/io.h | 5
arch/arm/kernel/process.c | 11
arch/arm/kernel/traps.c | 1
arch/h8300/include/asm/bitops.h | 8
arch/hexagon/configs/comet_defconfig | 1
arch/hexagon/include/asm/io.h | 1
arch/ia64/include/asm/io.h | 1
arch/ia64/include/asm/uaccess.h | 18
arch/m68k/atari/time.c | 7
arch/m68k/configs/amcore_defconfig | 1
arch/m68k/include/asm/bitops.h | 6
arch/m68k/include/asm/io_mm.h | 5
arch/mips/include/asm/io.h | 5
arch/openrisc/configs/or1ksim_defconfig | 1
arch/parisc/include/asm/io.h | 5
arch/parisc/include/asm/pdc_chassis.h | 1
arch/powerpc/include/asm/io.h | 5
arch/s390/include/asm/io.h | 5
arch/sh/configs/edosk7705_defconfig | 1
arch/sh/configs/se7206_defconfig | 1
arch/sh/configs/sh2007_defconfig | 1
arch/sh/configs/sh7724_generic_defconfig | 1
arch/sh/configs/sh7770_generic_defconfig | 1
arch/sh/configs/sh7785lcr_32bit_defconfig | 1
arch/sh/include/asm/bitops.h | 5
arch/sh/include/asm/io.h | 5
arch/sparc/configs/sparc64_defconfig | 1
arch/sparc/include/asm/io_64.h | 5
arch/um/drivers/cow.h | 7
arch/xtensa/configs/xip_kc705_defconfig | 1
block/blk-settings.c | 1
drivers/auxdisplay/panel.c | 7
drivers/base/firmware_loader/main.c | 2
drivers/block/brd.c | 1
drivers/block/loop.c | 1
drivers/char/Kconfig | 10
drivers/char/mem.c | 231 --------
drivers/gpu/drm/qxl/qxl_drv.c | 1
drivers/isdn/capi/kcapi_proc.c | 1
drivers/md/bcache/super.c | 1
drivers/media/usb/pwc/pwc-uncompress.c | 3
drivers/net/ethernet/adaptec/starfire.c | 8
drivers/net/ethernet/amd/atarilance.c | 8
drivers/net/ethernet/amd/pcnet32.c | 7
drivers/net/wireless/intersil/hostap/hostap_proc.c | 1
drivers/net/wireless/intersil/orinoco/orinoco_nortel.c | 8
drivers/net/wireless/intersil/orinoco/orinoco_pci.c | 8
drivers/net/wireless/intersil/orinoco/orinoco_plx.c | 8
drivers/net/wireless/intersil/orinoco/orinoco_tmd.c | 8
drivers/nvdimm/btt.c | 1
drivers/nvdimm/pmem.c | 1
drivers/parport/parport_ip32.c | 12
drivers/platform/x86/dell/dell_rbu.c | 3
drivers/scsi/53c700.c | 1
drivers/scsi/53c700.h | 1
drivers/scsi/ch.c | 6
drivers/scsi/esas2r/esas2r_main.c | 1
drivers/scsi/ips.c | 20
drivers/scsi/ips.h | 20
drivers/scsi/lasi700.c | 1
drivers/scsi/megaraid/mbox_defs.h | 2
drivers/scsi/megaraid/mega_common.h | 2
drivers/scsi/megaraid/megaraid_mbox.c | 2
drivers/scsi/megaraid/megaraid_mbox.h | 2
drivers/scsi/qla1280.c | 12
drivers/scsi/scsicam.c | 1
drivers/scsi/sni_53c710.c | 1
drivers/video/fbdev/matrox/matroxfb_base.c | 9
drivers/video/fbdev/vga16fb.c | 10
fs/configfs/configfs_internal.h | 4
fs/configfs/dir.c | 4
fs/configfs/file.c | 4
fs/configfs/inode.c | 4
fs/configfs/item.c | 4
fs/configfs/mount.c | 4
fs/configfs/symlink.c | 4
fs/eventpoll.c | 6
fs/fat/fatent.c | 2
fs/hpfs/hpfs.h | 3
fs/isofs/rock.c | 1
fs/nfs/dir.c | 7
fs/nfs/nfs4proc.c | 6
fs/nfs/nfs4renewd.c | 6
fs/nfs/nfs4state.c | 6
fs/nfs/nfs4xdr.c | 6
fs/nfsd/nfs4proc.c | 6
fs/nfsd/nfs4xdr.c | 6
fs/nfsd/xdr4.h | 6
fs/nilfs2/cpfile.c | 2
fs/nilfs2/ioctl.c | 4
fs/nilfs2/segment.c | 4
fs/nilfs2/the_nilfs.c | 2
fs/ocfs2/acl.c | 4
fs/ocfs2/acl.h | 4
fs/ocfs2/alloc.c | 4
fs/ocfs2/alloc.h | 4
fs/ocfs2/aops.c | 4
fs/ocfs2/aops.h | 4
fs/ocfs2/blockcheck.c | 4
fs/ocfs2/blockcheck.h | 4
fs/ocfs2/buffer_head_io.c | 4
fs/ocfs2/buffer_head_io.h | 4
fs/ocfs2/cluster/heartbeat.c | 4
fs/ocfs2/cluster/heartbeat.h | 4
fs/ocfs2/cluster/masklog.c | 4
fs/ocfs2/cluster/masklog.h | 4
fs/ocfs2/cluster/netdebug.c | 4
fs/ocfs2/cluster/nodemanager.c | 4
fs/ocfs2/cluster/nodemanager.h | 4
fs/ocfs2/cluster/ocfs2_heartbeat.h | 4
fs/ocfs2/cluster/ocfs2_nodemanager.h | 4
fs/ocfs2/cluster/quorum.c | 4
fs/ocfs2/cluster/quorum.h | 4
fs/ocfs2/cluster/sys.c | 4
fs/ocfs2/cluster/sys.h | 4
fs/ocfs2/cluster/tcp.c | 4
fs/ocfs2/cluster/tcp.h | 4
fs/ocfs2/cluster/tcp_internal.h | 4
fs/ocfs2/dcache.c | 4
fs/ocfs2/dcache.h | 4
fs/ocfs2/dir.c | 4
fs/ocfs2/dir.h | 4
fs/ocfs2/dlm/dlmapi.h | 4
fs/ocfs2/dlm/dlmast.c | 4
fs/ocfs2/dlm/dlmcommon.h | 4
fs/ocfs2/dlm/dlmconvert.c | 4
fs/ocfs2/dlm/dlmconvert.h | 4
fs/ocfs2/dlm/dlmdebug.c | 4
fs/ocfs2/dlm/dlmdebug.h | 4
fs/ocfs2/dlm/dlmdomain.c | 4
fs/ocfs2/dlm/dlmdomain.h | 4
fs/ocfs2/dlm/dlmlock.c | 4
fs/ocfs2/dlm/dlmmaster.c | 4
fs/ocfs2/dlm/dlmrecovery.c | 4
fs/ocfs2/dlm/dlmthread.c | 4
fs/ocfs2/dlm/dlmunlock.c | 4
fs/ocfs2/dlmfs/dlmfs.c | 4
fs/ocfs2/dlmfs/userdlm.c | 4
fs/ocfs2/dlmfs/userdlm.h | 4
fs/ocfs2/dlmglue.c | 4
fs/ocfs2/dlmglue.h | 4
fs/ocfs2/export.c | 4
fs/ocfs2/export.h | 4
fs/ocfs2/extent_map.c | 4
fs/ocfs2/extent_map.h | 4
fs/ocfs2/file.c | 4
fs/ocfs2/file.h | 4
fs/ocfs2/filecheck.c | 4
fs/ocfs2/filecheck.h | 4
fs/ocfs2/heartbeat.c | 4
fs/ocfs2/heartbeat.h | 4
fs/ocfs2/inode.c | 4
fs/ocfs2/inode.h | 4
fs/ocfs2/journal.c | 4
fs/ocfs2/journal.h | 4
fs/ocfs2/localalloc.c | 4
fs/ocfs2/localalloc.h | 4
fs/ocfs2/locks.c | 4
fs/ocfs2/locks.h | 4
fs/ocfs2/mmap.c | 4
fs/ocfs2/move_extents.c | 4
fs/ocfs2/move_extents.h | 4
fs/ocfs2/namei.c | 4
fs/ocfs2/namei.h | 4
fs/ocfs2/ocfs1_fs_compat.h | 4
fs/ocfs2/ocfs2.h | 4
fs/ocfs2/ocfs2_fs.h | 4
fs/ocfs2/ocfs2_ioctl.h | 4
fs/ocfs2/ocfs2_lockid.h | 4
fs/ocfs2/ocfs2_lockingver.h | 4
fs/ocfs2/refcounttree.c | 4
fs/ocfs2/refcounttree.h | 4
fs/ocfs2/reservations.c | 4
fs/ocfs2/reservations.h | 4
fs/ocfs2/resize.c | 4
fs/ocfs2/resize.h | 4
fs/ocfs2/slot_map.c | 4
fs/ocfs2/slot_map.h | 4
fs/ocfs2/stack_o2cb.c | 4
fs/ocfs2/stack_user.c | 4
fs/ocfs2/stackglue.c | 4
fs/ocfs2/stackglue.h | 4
fs/ocfs2/suballoc.c | 4
fs/ocfs2/suballoc.h | 4
fs/ocfs2/super.c | 4
fs/ocfs2/super.h | 4
fs/ocfs2/symlink.c | 4
fs/ocfs2/symlink.h | 4
fs/ocfs2/sysfile.c | 4
fs/ocfs2/sysfile.h | 4
fs/ocfs2/uptodate.c | 4
fs/ocfs2/uptodate.h | 4
fs/ocfs2/xattr.c | 4
fs/ocfs2/xattr.h | 4
fs/proc/generic.c | 13
fs/proc/inode.c | 18
fs/proc/proc_sysctl.c | 2
fs/reiserfs/procfs.c | 10
include/asm-generic/bitops/find.h | 108 +++
include/asm-generic/bitops/le.h | 38 +
include/asm-generic/bitsperlong.h | 12
include/asm-generic/io.h | 11
include/linux/align.h | 15
include/linux/async.h | 1
include/linux/bitmap.h | 11
include/linux/bitops.h | 12
include/linux/blkdev.h | 1
include/linux/compat.h | 1
include/linux/configfs.h | 4
include/linux/crc8.h | 2
include/linux/cred.h | 1
include/linux/delayacct.h | 20
include/linux/fs.h | 2
include/linux/genl_magic_func.h | 1
include/linux/genl_magic_struct.h | 1
include/linux/gfp.h | 2
include/linux/init_task.h | 1
include/linux/initrd.h | 2
include/linux/kernel.h | 9
include/linux/mm.h | 2
include/linux/mmzone.h | 2
include/linux/pgtable.h | 10
include/linux/proc_fs.h | 1
include/linux/profile.h | 3
include/linux/smp.h | 8
include/linux/swap.h | 1
include/linux/vmalloc.h | 7
include/uapi/linux/if_bonding.h | 11
include/uapi/linux/nfs4.h | 6
include/xen/interface/elfnote.h | 10
include/xen/interface/hvm/hvm_vcpu.h | 10
include/xen/interface/io/xenbus.h | 10
init/Kconfig | 12
init/initramfs.c | 38 +
init/main.c | 1
ipc/sem.c | 12
kernel/async.c | 68 --
kernel/configs/android-base.config | 1
kernel/crash_core.c | 7
kernel/cred.c | 2
kernel/exit.c | 67 ++
kernel/fork.c | 23
kernel/gcov/Kconfig | 1
kernel/gcov/base.c | 49 +
kernel/gcov/clang.c | 282 ----------
kernel/gcov/fs.c | 146 ++++-
kernel/gcov/gcc_4_7.c | 173 ------
kernel/gcov/gcov.h | 14
kernel/kexec_core.c | 4
kernel/kexec_file.c | 4
kernel/kmod.c | 2
kernel/resource.c | 198 ++++---
kernel/sys.c | 14
kernel/umh.c | 8
kernel/up.c | 2
kernel/user_namespace.c | 6
lib/bch.c | 2
lib/crc8.c | 2
lib/decompress_unlzma.c | 2
lib/find_bit.c | 68 --
lib/genalloc.c | 7
lib/list_sort.c | 2
lib/parser.c | 61 +-
lib/percpu_counter.c | 2
lib/stackdepot.c | 6
mm/balloon_compaction.c | 4
mm/compaction.c | 4
mm/filemap.c | 2
mm/gup.c | 2
mm/highmem.c | 2
mm/huge_memory.c | 6
mm/hugetlb.c | 6
mm/internal.h | 2
mm/kasan/kasan.h | 8
mm/kasan/quarantine.c | 4
mm/kasan/shadow.c | 4
mm/kfence/report.c | 2
mm/khugepaged.c | 2
mm/ksm.c | 6
mm/madvise.c | 4
mm/memcontrol.c | 18
mm/memory-failure.c | 2
mm/memory.c | 18
mm/mempolicy.c | 6
mm/migrate.c | 8
mm/mmap.c | 4
mm/mprotect.c | 2
mm/mremap.c | 2
mm/nommu.c | 10
mm/oom_kill.c | 2
mm/page-writeback.c | 4
mm/page_alloc.c | 16
mm/page_owner.c | 2
mm/page_vma_mapped.c | 2
mm/percpu-internal.h | 2
mm/percpu.c | 2
mm/pgalloc-track.h | 6
mm/rmap.c | 2
mm/slab.c | 8
mm/slub.c | 2
mm/swap.c | 4
mm/swap_slots.c | 2
mm/swap_state.c | 2
mm/vmalloc.c | 124 ----
mm/vmstat.c | 2
mm/z3fold.c | 2
mm/zpool.c | 2
mm/zsmalloc.c | 6
samples/configfs/configfs_sample.c | 2
scripts/checkpatch.pl | 15
scripts/gdb/linux/cpus.py | 23
scripts/gdb/linux/symbols.py | 3
scripts/spelling.txt | 3
tools/include/asm-generic/bitops/find.h | 85 ++-
tools/include/asm-generic/bitsperlong.h | 3
tools/include/linux/bitmap.h | 18
tools/lib/bitmap.c | 4
tools/lib/find_bit.c | 56 -
tools/scripts/Makefile.include | 1
tools/testing/selftests/filesystems/epoll/epoll_wakeup_test.c | 44 +
tools/testing/selftests/kvm/lib/sparsebit.c | 1
tools/testing/selftests/mincore/mincore_selftest.c | 1
tools/testing/selftests/powerpc/mm/tlbie_test.c | 1
tools/testing/selftests/proc/Makefile | 1
tools/testing/selftests/proc/proc-subset-pid.c | 121 ++++
tools/testing/selftests/proc/read.c | 4
tools/usb/hcd-tests.sh | 2
343 files changed, 1383 insertions(+), 2119 deletions(-)
^ permalink raw reply [flat|nested] 232+ messages in thread
* Re: incoming
2021-05-07 1:01 incoming Andrew Morton
@ 2021-05-07 7:12 ` Linus Torvalds
0 siblings, 0 replies; 232+ messages in thread
From: Linus Torvalds @ 2021-05-07 7:12 UTC (permalink / raw)
To: Andrew Morton; +Cc: mm-commits, Linux-MM
On Thu, May 6, 2021 at 6:01 PM Andrew Morton <akpm@linux-foundation.org> wrote:
>
> I've been wobbly about the secretmem patches due to doubts about
> whether the feature is sufficiently useful to justify inclusion, but
> developers are now weighing in with helpful information and I've asked Mike
> for an extensively updated [0/n] changelog. This will take a few days
> to play out so it is possible that I will prevail upon you for a post-rc1
> merge.
Oh, much too late for this release by now.
> If that's a problem, there's always 5.13-rc1.
5.13-rc1 is two days from now, it would be for 5.14-rc1.. How time -
and version numbers - fly.
Linus
^ permalink raw reply [flat|nested] 232+ messages in thread
* incoming
@ 2021-05-15 0:26 Andrew Morton
0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2021-05-15 0:26 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm
13 patches, based on bd3c9cdb21a2674dd0db70199df884828e37abd4.
Subsystems affected by this patch series:
mm/hugetlb
mm/slub
resource
squashfs
mm/userfaultfd
mm/ksm
mm/pagealloc
mm/kasan
mm/pagemap
hfsplus
modprobe
mm/ioremap
Subsystem: mm/hugetlb
Peter Xu <peterx@redhat.com>:
Patch series "mm/hugetlb: Fix issues on file sealing and fork", v2:
mm/hugetlb: fix F_SEAL_FUTURE_WRITE
mm/hugetlb: fix cow where page writtable in child
Subsystem: mm/slub
Vlastimil Babka <vbabka@suse.cz>:
mm, slub: move slub_debug static key enabling outside slab_mutex
Subsystem: resource
Alistair Popple <apopple@nvidia.com>:
kernel/resource: fix return code check in __request_free_mem_region
Subsystem: squashfs
Phillip Lougher <phillip@squashfs.org.uk>:
squashfs: fix divide error in calculate_skip()
Subsystem: mm/userfaultfd
Axel Rasmussen <axelrasmussen@google.com>:
userfaultfd: release page in error path to avoid BUG_ON
Subsystem: mm/ksm
Hugh Dickins <hughd@google.com>:
ksm: revert "use GET_KSM_PAGE_NOLOCK to get ksm page in remove_rmap_item_from_tree()"
Subsystem: mm/pagealloc
"Matthew Wilcox (Oracle)" <willy@infradead.org>:
mm: fix struct page layout on 32-bit systems
Subsystem: mm/kasan
Peter Collingbourne <pcc@google.com>:
kasan: fix unit tests with CONFIG_UBSAN_LOCAL_BOUNDS enabled
Subsystem: mm/pagemap
"Matthew Wilcox (Oracle)" <willy@infradead.org>:
mm/filemap: fix readahead return types
Subsystem: hfsplus
Jouni Roivas <jouni.roivas@tuxera.com>:
hfsplus: prevent corruption in shrinking truncate
Subsystem: modprobe
Rasmus Villemoes <linux@rasmusvillemoes.dk>:
docs: admin-guide: update description for kernel.modprobe sysctl
Subsystem: mm/ioremap
Christophe Leroy <christophe.leroy@csgroup.eu>:
mm/ioremap: fix iomap_max_page_shift
Documentation/admin-guide/sysctl/kernel.rst | 9 ++++---
fs/hfsplus/extents.c | 7 +++--
fs/hugetlbfs/inode.c | 5 ++++
fs/iomap/buffered-io.c | 4 +--
fs/squashfs/file.c | 6 ++--
include/linux/mm.h | 32 ++++++++++++++++++++++++++
include/linux/mm_types.h | 4 +--
include/linux/pagemap.h | 6 ++--
include/net/page_pool.h | 12 +++++++++
kernel/resource.c | 2 -
lib/test_kasan.c | 29 ++++++++++++++++++-----
mm/hugetlb.c | 1
mm/ioremap.c | 6 ++--
mm/ksm.c | 3 +-
mm/shmem.c | 34 ++++++++++++----------------
mm/slab_common.c | 10 ++++++++
mm/slub.c | 9 -------
net/core/page_pool.c | 12 +++++----
18 files changed, 129 insertions(+), 62 deletions(-)
^ permalink raw reply [flat|nested] 232+ messages in thread
* incoming
@ 2021-05-23 0:41 Andrew Morton
0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2021-05-23 0:41 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm
10 patches, based on 4ff2473bdb4cf2bb7d208ccf4418d3d7e6b1652c.
Subsystems affected by this patch series:
mm/pagealloc
mm/gup
ipc
selftests
mm/kasan
kernel/watchdog
bitmap
procfs
lib
mm/userfaultfd
Subsystem: mm/pagealloc
Arnd Bergmann <arnd@arndb.de>:
mm/shuffle: fix section mismatch warning
Subsystem: mm/gup
Michal Hocko <mhocko@suse.com>:
Revert "mm/gup: check page posion status for coredump."
Subsystem: ipc
Varad Gautam <varad.gautam@suse.com>:
ipc/mqueue, msg, sem: avoid relying on a stack reference past its expiry
Subsystem: selftests
Yang Yingliang <yangyingliang@huawei.com>:
tools/testing/selftests/exec: fix link error
Subsystem: mm/kasan
Alexander Potapenko <glider@google.com>:
kasan: slab: always reset the tag in get_freepointer_safe()
Subsystem: kernel/watchdog
Petr Mladek <pmladek@suse.com>:
watchdog: reliable handling of timestamps
Subsystem: bitmap
Rikard Falkeborn <rikard.falkeborn@gmail.com>:
linux/bits.h: fix compilation error with GENMASK
Subsystem: procfs
Alexey Dobriyan <adobriyan@gmail.com>:
proc: remove Alexey from MAINTAINERS
Subsystem: lib
Zhen Lei <thunder.leizhen@huawei.com>:
lib: kunit: suppress a compilation warning of frame size
Subsystem: mm/userfaultfd
Mike Kravetz <mike.kravetz@oracle.com>:
userfaultfd: hugetlbfs: fix new flag usage in error path
MAINTAINERS | 1 -
fs/hugetlbfs/inode.c | 2 +-
include/linux/bits.h | 2 +-
include/linux/const.h | 8 ++++++++
include/linux/minmax.h | 10 ++--------
ipc/mqueue.c | 6 ++++--
ipc/msg.c | 6 ++++--
ipc/sem.c | 6 ++++--
kernel/watchdog.c | 34 ++++++++++++++++++++--------------
lib/Makefile | 1 +
mm/gup.c | 4 ----
mm/internal.h | 20 --------------------
mm/shuffle.h | 4 ++--
mm/slub.c | 1 +
mm/userfaultfd.c | 28 ++++++++++++++--------------
tools/include/linux/bits.h | 2 +-
tools/include/linux/const.h | 8 ++++++++
tools/testing/selftests/exec/Makefile | 6 +++---
18 files changed, 74 insertions(+), 75 deletions(-)
^ permalink raw reply [flat|nested] 232+ messages in thread
* incoming
@ 2021-06-05 3:00 Andrew Morton
0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2021-06-05 3:00 UTC (permalink / raw)
To: Linus Torvalds; +Cc: linux-mm, mm-commits
13 patches, based on 16f0596fc1d78a1f3ae4628cff962bb297dc908c.
Subsystems affected by this patch series:
mips
mm/kfence
init
mm/debug
mm/pagealloc
mm/memory-hotplug
mm/hugetlb
proc
mm/kasan
mm/hugetlb
lib
ocfs2
mailmap
Subsystem: mips
Thomas Bogendoerfer <tsbogend@alpha.franken.de>:
Revert "MIPS: make userspace mapping young by default"
Subsystem: mm/kfence
Marco Elver <elver@google.com>:
kfence: use TASK_IDLE when awaiting allocation
Subsystem: init
Mark Rutland <mark.rutland@arm.com>:
pid: take a reference when initializing `cad_pid`
Subsystem: mm/debug
Gerald Schaefer <gerald.schaefer@linux.ibm.com>:
mm/debug_vm_pgtable: fix alignment for pmd/pud_advanced_tests()
Subsystem: mm/pagealloc
Ding Hui <dinghui@sangfor.com.cn>:
mm/page_alloc: fix counting of free pages after take off from buddy
Subsystem: mm/memory-hotplug
David Hildenbrand <david@redhat.com>:
drivers/base/memory: fix trying offlining memory blocks with memory holes on aarch64
Subsystem: mm/hugetlb
Naoya Horiguchi <naoya.horiguchi@nec.com>:
hugetlb: pass head page to remove_hugetlb_page()
Subsystem: proc
David Matlack <dmatlack@google.com>:
proc: add .gitignore for proc-subset-pid selftest
Subsystem: mm/kasan
Yu Kuai <yukuai3@huawei.com>:
mm/kasan/init.c: fix doc warning
Subsystem: mm/hugetlb
Mina Almasry <almasrymina@google.com>:
mm, hugetlb: fix simple resv_huge_pages underflow on UFFDIO_COPY
Subsystem: lib
YueHaibing <yuehaibing@huawei.com>:
lib: crc64: fix kernel-doc warning
Subsystem: ocfs2
Junxiao Bi <junxiao.bi@oracle.com>:
ocfs2: fix data corruption by fallocate
Subsystem: mailmap
Michel Lespinasse <michel@lespinasse.org>:
mailmap: use private address for Michel Lespinasse
.mailmap | 3 +
arch/mips/mm/cache.c | 30 ++++++++---------
drivers/base/memory.c | 6 +--
fs/ocfs2/file.c | 55 +++++++++++++++++++++++++++++---
include/linux/pgtable.h | 8 ++++
init/main.c | 2 -
lib/crc64.c | 2 -
mm/debug_vm_pgtable.c | 4 +-
mm/hugetlb.c | 16 +++++++--
mm/kasan/init.c | 4 +-
mm/kfence/core.c | 6 +--
mm/memory.c | 4 ++
mm/page_alloc.c | 2 +
tools/testing/selftests/proc/.gitignore | 1
14 files changed, 107 insertions(+), 36 deletions(-)
^ permalink raw reply [flat|nested] 232+ messages in thread
* incoming
@ 2021-06-16 1:22 Andrew Morton
0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2021-06-16 1:22 UTC (permalink / raw)
To: Linus Torvalds; +Cc: linux-mm, mm-commits
18 patches, based on 94f0b2d4a1d0c52035aef425da5e022bd2cb1c71.
Subsystems affected by this patch series:
mm/memory-failure
mm/swap
mm/slub
mm/hugetlb
mm/memory-failure
coredump
mm/slub
mm/thp
mm/sparsemem
Subsystem: mm/memory-failure
Naoya Horiguchi <naoya.horiguchi@nec.com>:
mm,hwpoison: fix race with hugetlb page allocation
Subsystem: mm/swap
Peter Xu <peterx@redhat.com>:
mm/swap: fix pte_same_as_swp() not removing uffd-wp bit when compare
Subsystem: mm/slub
Kees Cook <keescook@chromium.org>:
Patch series "Actually fix freelist pointer vs redzoning", v4:
mm/slub: clarify verification reporting
mm/slub: fix redzoning for small allocations
mm/slub: actually fix freelist pointer vs redzoning
Subsystem: mm/hugetlb
Mike Kravetz <mike.kravetz@oracle.com>:
mm/hugetlb: expand restore_reserve_on_error functionality
Subsystem: mm/memory-failure
yangerkun <yangerkun@huawei.com>:
mm/memory-failure: make sure wait for page writeback in memory_failure
Subsystem: coredump
Pingfan Liu <kernelfans@gmail.com>:
crash_core, vmcoreinfo: append 'SECTION_SIZE_BITS' to vmcoreinfo
Subsystem: mm/slub
Andrew Morton <akpm@linux-foundation.org>:
mm/slub.c: include swab.h
Subsystem: mm/thp
Xu Yu <xuyu@linux.alibaba.com>:
mm, thp: use head page in __migration_entry_wait()
Hugh Dickins <hughd@google.com>:
Patch series "mm/thp: fix THP splitting unmap BUGs and related", v10:
mm/thp: fix __split_huge_pmd_locked() on shmem migration entry
mm/thp: make is_huge_zero_pmd() safe and quicker
mm/thp: try_to_unmap() use TTU_SYNC for safe splitting
mm/thp: fix vma_address() if virtual address below file offset
Jue Wang <juew@google.com>:
mm/thp: fix page_address_in_vma() on file THP tails
Hugh Dickins <hughd@google.com>:
mm/thp: unmap_mapping_page() to fix THP truncate_cleanup_page()
Yang Shi <shy828301@gmail.com>:
mm: thp: replace DEBUG_VM BUG with VM_WARN when unmap fails for split
Subsystem: mm/sparsemem
Miles Chen <miles.chen@mediatek.com>:
mm/sparse: fix check_usemap_section_nr warnings
Documentation/vm/slub.rst | 10 +--
fs/hugetlbfs/inode.c | 1
include/linux/huge_mm.h | 8 ++
include/linux/hugetlb.h | 8 ++
include/linux/mm.h | 3 +
include/linux/rmap.h | 1
include/linux/swapops.h | 15 +++--
kernel/crash_core.c | 1
mm/huge_memory.c | 58 ++++++++++---------
mm/hugetlb.c | 137 +++++++++++++++++++++++++++++++++++++---------
mm/internal.h | 51 ++++++++++++-----
mm/memory-failure.c | 36 +++++++++++-
mm/memory.c | 41 +++++++++++++
mm/migrate.c | 1
mm/page_vma_mapped.c | 27 +++++----
mm/pgtable-generic.c | 5 -
mm/rmap.c | 41 +++++++++----
mm/slab_common.c | 3 -
mm/slub.c | 37 +++++-------
mm/sparse.c | 13 +++-
mm/swapfile.c | 2
mm/truncate.c | 43 ++++++--------
22 files changed, 388 insertions(+), 154 deletions(-)
^ permalink raw reply [flat|nested] 232+ messages in thread
* incoming
@ 2021-06-25 1:38 Andrew Morton
0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2021-06-25 1:38 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm
24 patches, based on 4a09d388f2ab382f217a764e6a152b3f614246f6.
Subsystems affected by this patch series:
mm/thp
nilfs2
mm/vmalloc
kthread
mm/hugetlb
mm/memory-failure
mm/pagealloc
MAINTAINERS
mailmap
Subsystem: mm/thp
Hugh Dickins <hughd@google.com>:
Patch series "mm: page_vma_mapped_walk() cleanup and THP fixes":
mm: page_vma_mapped_walk(): use page for pvmw->page
mm: page_vma_mapped_walk(): settle PageHuge on entry
mm: page_vma_mapped_walk(): use pmde for *pvmw->pmd
mm: page_vma_mapped_walk(): prettify PVMW_MIGRATION block
mm: page_vma_mapped_walk(): crossing page table boundary
mm: page_vma_mapped_walk(): add a level of indentation
mm: page_vma_mapped_walk(): use goto instead of while (1)
mm: page_vma_mapped_walk(): get vma_address_end() earlier
mm/thp: fix page_vma_mapped_walk() if THP mapped by ptes
mm/thp: another PVMW_SYNC fix in page_vma_mapped_walk()
Subsystem: nilfs2
Pavel Skripkin <paskripkin@gmail.com>:
nilfs2: fix memory leak in nilfs_sysfs_delete_device_group
Subsystem: mm/vmalloc
Claudio Imbrenda <imbrenda@linux.ibm.com>:
Patch series "mm: add vmalloc_no_huge and use it", v4:
mm/vmalloc: add vmalloc_no_huge
KVM: s390: prepare for hugepage vmalloc
Daniel Axtens <dja@axtens.net>:
mm/vmalloc: unbreak kasan vmalloc support
Subsystem: kthread
Petr Mladek <pmladek@suse.com>:
Patch series "kthread_worker: Fix race between kthread_mod_delayed_work():
kthread_worker: split code for canceling the delayed work timer
kthread: prevent deadlock when kthread_mod_delayed_work() races with kthread_cancel_delayed_work_sync()
Subsystem: mm/hugetlb
Hugh Dickins <hughd@google.com>:
mm, futex: fix shared futex pgoff on shmem huge page
Subsystem: mm/memory-failure
Tony Luck <tony.luck@intel.com>:
Patch series "mm,hwpoison: fix sending SIGBUS for Action Required MCE", v5:
mm/memory-failure: use a mutex to avoid memory_failure() races
Aili Yao <yaoaili@kingsoft.com>:
mm,hwpoison: return -EHWPOISON to denote that the page has already been poisoned
Naoya Horiguchi <naoya.horiguchi@nec.com>:
mm/hwpoison: do not lock page again when me_huge_page() successfully recovers
Subsystem: mm/pagealloc
Rasmus Villemoes <linux@rasmusvillemoes.dk>:
mm/page_alloc: __alloc_pages_bulk(): do bounds check before accessing array
Mel Gorman <mgorman@techsingularity.net>:
mm/page_alloc: do bulk array bounds check after checking populated elements
Subsystem: MAINTAINERS
Marek Behún <kabel@kernel.org>:
MAINTAINERS: fix Marek's identity again
Subsystem: mailmap
Marek Behún <kabel@kernel.org>:
mailmap: add Marek's other e-mail address and identity without diacritics
.mailmap | 2
MAINTAINERS | 4
arch/s390/kvm/pv.c | 7 +
fs/nilfs2/sysfs.c | 1
include/linux/hugetlb.h | 16 ---
include/linux/pagemap.h | 13 +-
include/linux/vmalloc.h | 1
kernel/futex.c | 3
kernel/kthread.c | 81 ++++++++++------
mm/hugetlb.c | 5 -
mm/memory-failure.c | 83 +++++++++++------
mm/page_alloc.c | 6 +
mm/page_vma_mapped.c | 233 +++++++++++++++++++++++++++---------------------
mm/vmalloc.c | 41 ++++++--
14 files changed, 297 insertions(+), 199 deletions(-)
^ permalink raw reply [flat|nested] 232+ messages in thread
* incoming
@ 2021-06-29 2:32 Andrew Morton
0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2021-06-29 2:32 UTC (permalink / raw)
To: Linus Torvalds; +Cc: linux-mm, mm-commits
192 patches, based on 7cf3dead1ad70c72edb03e2d98e1f3dcd332cdb2.
Subsystems affected by this patch series:
mm/gup
mm/pagealloc
kthread
ia64
scripts
ntfs
squashfs
ocfs2
z
kernel/watchdog
mm/slab
mm/slub
mm/kmemleak
mm/dax
mm/debug
mm/pagecache
mm/gup
mm/swap
mm/memcg
mm/pagemap
mm/mprotect
mm/bootmem
mm/dma
mm/tracing
mm/vmalloc
mm/kasan
mm/initialization
mm/pagealloc
mm/memory-failure
Subsystem: mm/gup
Jann Horn <jannh@google.com>:
mm/gup: fix try_grab_compound_head() race with split_huge_page()
Subsystem: mm/pagealloc
Mike Rapoport <rppt@linux.ibm.com>:
mm/page_alloc: fix memory map initialization for descending nodes
Mel Gorman <mgorman@techsingularity.net>:
mm/page_alloc: correct return value of populated elements if bulk array is populated
Subsystem: kthread
Jonathan Neuschäfer <j.neuschaefer@gmx.net>:
kthread: switch to new kerneldoc syntax for named variable macro argument
Petr Mladek <pmladek@suse.com>:
kthread_worker: fix return value when kthread_mod_delayed_work() races with kthread_cancel_delayed_work_sync()
Subsystem: ia64
Randy Dunlap <rdunlap@infradead.org>:
ia64: headers: drop duplicated words
Arnd Bergmann <arnd@arndb.de>:
ia64: mca_drv: fix incorrect array size calculation
Subsystem: scripts
"Steven Rostedt (VMware)" <rostedt@goodmis.org>:
Patch series "streamline_config.pl: Fix Perl spacing":
streamline_config.pl: make spacing consistent
streamline_config.pl: add softtabstop=4 for vim users
Colin Ian King <colin.king@canonical.com>:
scripts/spelling.txt: add more spellings to spelling.txt
Subsystem: ntfs
Desmond Cheong Zhi Xi <desmondcheongzx@gmail.com>:
ntfs: fix validity check for file name attribute
Subsystem: squashfs
Vincent Whitchurch <vincent.whitchurch@axis.com>:
squashfs: add option to panic on errors
Subsystem: ocfs2
Yang Yingliang <yangyingliang@huawei.com>:
ocfs2: remove unnecessary INIT_LIST_HEAD()
Subsystem: z
Dan Carpenter <dan.carpenter@oracle.com>:
ocfs2: fix snprintf() checking
Colin Ian King <colin.king@canonical.com>:
ocfs2: remove redundant assignment to pointer queue
Wan Jiabing <wanjiabing@vivo.com>:
ocfs2: remove repeated uptodate check for buffer
Chen Huang <chenhuang5@huawei.com>:
ocfs2: replace simple_strtoull() with kstrtoull()
Colin Ian King <colin.king@canonical.com>:
ocfs2: remove redundant initialization of variable ret
Subsystem: kernel/watchdog
Wang Qing <wangqing@vivo.com>:
kernel: watchdog: modify the explanation related to watchdog thread
doc: watchdog: modify the explanation related to watchdog thread
doc: watchdog: modify the doc related to "watchdog/%u"
Subsystem: mm/slab
gumingtao <gumingtao1225@gmail.com>:
slab: use __func__ to trace function name
Subsystem: mm/slub
Vlastimil Babka <vbabka@suse.cz>:
kunit: make test->lock irq safe
Oliver Glitta <glittao@gmail.com>:
mm/slub, kunit: add a KUnit test for SLUB debugging functionality
slub: remove resiliency_test() function
Hyeonggon Yoo <42.hyeyoo@gmail.com>:
mm, slub: change run-time assertion in kmalloc_index() to compile-time
Stephen Boyd <swboyd@chromium.org>:
slub: restore slub_debug=- behavior
slub: actually use 'message' in restore_bytes()
Joe Perches <joe@perches.com>:
slub: indicate slab_fix() uses printf formats
Stephen Boyd <swboyd@chromium.org>:
slub: force on no_hash_pointers when slub_debug is enabled
Faiyaz Mohammed <faiyazm@codeaurora.org>:
mm: slub: move sysfs slab alloc/free interfaces to debugfs
Georgi Djakov <quic_c_gdjako@quicinc.com>:
mm/slub: add taint after the errors are printed
Subsystem: mm/kmemleak
Yanfei Xu <yanfei.xu@windriver.com>:
mm/kmemleak: fix possible wrong memory scanning period
Subsystem: mm/dax
Jan Kara <jack@suse.cz>:
dax: fix ENOMEM handling in grab_mapping_entry()
Subsystem: mm/debug
Tang Bin <tangbin@cmss.chinamobile.com>:
tools/vm/page_owner_sort.c: check malloc() return
Anshuman Khandual <anshuman.khandual@arm.com>:
mm/debug_vm_pgtable: ensure THP availability via has_transparent_hugepage()
Nicolas Saenz Julienne <nsaenzju@redhat.com>:
mm: mmap_lock: use local locks instead of disabling preemption
Gavin Shan <gshan@redhat.com>:
Patch series "mm/page_reporting: Make page reporting work on arm64 with 64KB page size", v4:
mm/page_reporting: fix code style in __page_reporting_request()
mm/page_reporting: export reporting order as module parameter
mm/page_reporting: allow driver to specify reporting order
virtio_balloon: specify page reporting order if needed
Subsystem: mm/pagecache
Kefeng Wang <wangkefeng.wang@huawei.com>:
mm: page-writeback: kill get_writeback_state() comments
Chi Wu <wuchi.zero@gmail.com>:
mm/page-writeback: Fix performance when BDI's share of ratio is 0.
mm/page-writeback: update the comment of Dirty position control
mm/page-writeback: use __this_cpu_inc() in account_page_dirtied()
Roman Gushchin <guro@fb.com>:
Patch series "cgroup, blkcg: prevent dirty inodes to pin dying memory cgroups", v9:
writeback, cgroup: do not switch inodes with I_WILL_FREE flag
writeback, cgroup: add smp_mb() to cgroup_writeback_umount()
writeback, cgroup: increment isw_nr_in_flight before grabbing an inode
writeback, cgroup: switch to rcu_work API in inode_switch_wbs()
writeback, cgroup: keep list of inodes attached to bdi_writeback
writeback, cgroup: split out the functional part of inode_switch_wbs_work_fn()
writeback, cgroup: support switching multiple inodes at once
writeback, cgroup: release dying cgwbs by switching attached inodes
Christoph Hellwig <hch@lst.de>:
Patch series "remove the implicit .set_page_dirty default":
fs: unexport __set_page_dirty
fs: move ramfs_aops to libfs
mm: require ->set_page_dirty to be explicitly wired up
"Matthew Wilcox (Oracle)" <willy@infradead.org>:
Patch series "Further set_page_dirty cleanups":
mm/writeback: move __set_page_dirty() to core mm
mm/writeback: use __set_page_dirty in __set_page_dirty_nobuffers
iomap: use __set_page_dirty_nobuffers
fs: remove anon_set_page_dirty()
fs: remove noop_set_page_dirty()
mm: move page dirtying prototypes from mm.h
Subsystem: mm/gup
Peter Xu <peterx@redhat.com>:
Patch series "mm/gup: Fix pin page write cache bouncing on has_pinned", v2:
mm/gup_benchmark: support threading
Andrea Arcangeli <aarcange@redhat.com>:
mm: gup: allow FOLL_PIN to scale in SMP
mm: gup: pack has_pinned in MMF_HAS_PINNED
Christophe Leroy <christophe.leroy@csgroup.eu>:
mm: pagewalk: fix walk for hugepage tables
Subsystem: mm/swap
Miaohe Lin <linmiaohe@huawei.com>:
Patch series "close various race windows for swap", v6:
mm/swapfile: use percpu_ref to serialize against concurrent swapoff
swap: fix do_swap_page() race with swapoff
mm/swap: remove confusing checking for non_swap_entry() in swap_ra_info()
mm/shmem: fix shmem_swapin() race with swapoff
Patch series "Cleanups for swap", v2:
mm/swapfile: move get_swap_page_of_type() under CONFIG_HIBERNATION
mm/swap: remove unused local variable nr_shadows
mm/swap_slots.c: delete meaningless forward declarations
Huang Ying <ying.huang@intel.com>:
mm, swap: remove unnecessary smp_rmb() in swap_type_to_swap_info()
mm: free idle swap cache page after COW
swap: check mapping_empty() for swap cache before being freed
Subsystem: mm/memcg
Waiman Long <longman@redhat.com>:
Patch series "mm/memcg: Reduce kmemcache memory accounting overhead", v6:
mm/memcg: move mod_objcg_state() to memcontrol.c
mm/memcg: cache vmstat data in percpu memcg_stock_pcp
mm/memcg: improve refill_obj_stock() performance
mm/memcg: optimize user context object stock access
Patch series "mm: memcg/slab: Fix objcg pointer array handling problem", v4:
mm: memcg/slab: properly set up gfp flags for objcg pointer array
mm: memcg/slab: create a new set of kmalloc-cg-<n> caches
mm: memcg/slab: disable cache merging for KMALLOC_NORMAL caches
Muchun Song <songmuchun@bytedance.com>:
mm: memcontrol: fix root_mem_cgroup charging
Patch series "memcontrol code cleanup and simplification", v3:
mm: memcontrol: fix page charging in page replacement
mm: memcontrol: bail out early when !mm in get_mem_cgroup_from_mm
mm: memcontrol: remove the pgdata parameter of mem_cgroup_page_lruvec
mm: memcontrol: simplify lruvec_holds_page_lru_lock
mm: memcontrol: rename lruvec_holds_page_lru_lock to page_matches_lruvec
mm: memcontrol: simplify the logic of objcg pinning memcg
mm: memcontrol: move obj_cgroup_uncharge_pages() out of css_set_lock
mm: vmscan: remove noinline_for_stack
wenhuizhang <wenhui@gwmail.gwu.edu>:
memcontrol: use flexible-array member
Dan Schatzberg <schatzberg.dan@gmail.com>:
Patch series "Charge loop device i/o to issuing cgroup", v14:
loop: use worker per cgroup instead of kworker
mm: charge active memcg when no mm is set
loop: charge i/o to mem and blk cg
Huilong Deng <denghuilong@cdjrlc.com>:
mm: memcontrol: remove trailing semicolon in macros
Subsystem: mm/pagemap
David Hildenbrand <david@redhat.com>:
Patch series "perf/binfmt/mm: remove in-tree usage of MAP_EXECUTABLE":
perf: MAP_EXECUTABLE does not indicate VM_MAYEXEC
binfmt: remove in-tree usage of MAP_EXECUTABLE
mm: ignore MAP_EXECUTABLE in ksys_mmap_pgoff()
Gonzalo Matias Juarez Tello <gmjuareztello@gmail.com>:
mm/mmap.c: logic of find_vma_intersection repeated in __do_munmap
Liam Howlett <liam.howlett@oracle.com>:
mm/mmap: introduce unlock_range() for code cleanup
mm/mmap: use find_vma_intersection() in do_mmap() for overlap
Liu Xiang <liu.xiang@zlingsmart.com>:
mm/memory.c: fix comment of finish_mkwrite_fault()
Liam Howlett <liam.howlett@oracle.com>:
Patch series "mm: Add vma_lookup()", v2:
mm: add vma_lookup(), update find_vma_intersection() comments
drm/i915/selftests: use vma_lookup() in __igt_mmap()
arch/arc/kernel/troubleshoot: use vma_lookup() instead of find_vma()
arch/arm64/kvm: use vma_lookup() instead of find_vma_intersection()
arch/powerpc/kvm/book3s_hv_uvmem: use vma_lookup() instead of find_vma_intersection()
arch/powerpc/kvm/book3s: use vma_lookup() in kvmppc_hv_setup_htab_rma()
arch/mips/kernel/traps: use vma_lookup() instead of find_vma()
arch/m68k/kernel/sys_m68k: use vma_lookup() in sys_cacheflush()
x86/sgx: use vma_lookup() in sgx_encl_find()
virt/kvm: use vma_lookup() instead of find_vma_intersection()
vfio: use vma_lookup() instead of find_vma_intersection()
net/ipv5/tcp: use vma_lookup() in tcp_zerocopy_receive()
drm/amdgpu: use vma_lookup() in amdgpu_ttm_tt_get_user_pages()
media: videobuf2: use vma_lookup() in get_vaddr_frames()
misc/sgi-gru/grufault: use vma_lookup() in gru_find_vma()
kernel/events/uprobes: use vma_lookup() in find_active_uprobe()
lib/test_hmm: use vma_lookup() in dmirror_migrate()
mm/ksm: use vma_lookup() in find_mergeable_vma()
mm/migrate: use vma_lookup() in do_pages_stat_array()
mm/mremap: use vma_lookup() in vma_to_resize()
mm/memory.c: use vma_lookup() in __access_remote_vm()
mm/mempolicy: use vma_lookup() in __access_remote_vm()
Chen Li <chenli@uniontech.com>:
mm: update legacy flush_tlb_* to use vma
Subsystem: mm/mprotect
Peter Collingbourne <pcc@google.com>:
mm: improve mprotect(R|W) efficiency on pages referenced once
Subsystem: mm/bootmem
Souptick Joarder <jrdr.linux@gmail.com>:
h8300: remove unused variable
Subsystem: mm/dma
YueHaibing <yuehaibing@huawei.com>:
mm/dmapool: use DEVICE_ATTR_RO macro
Subsystem: mm/tracing
Vincent Whitchurch <vincent.whitchurch@axis.com>:
mm, tracing: unify PFN format strings
Subsystem: mm/vmalloc
"Uladzislau Rezki (Sony)" <urezki@gmail.com>:
Patch series "vmalloc() vs bulk allocator", v2:
mm/page_alloc: add an alloc_pages_bulk_array_node() helper
mm/vmalloc: switch to bulk allocator in __vmalloc_area_node()
mm/vmalloc: print a warning message first on failure
mm/vmalloc: remove quoted strings split across lines
Uladzislau Rezki <urezki@gmail.com>:
mm/vmalloc: fallback to a single page allocator
Rafael Aquini <aquini@redhat.com>:
mm: vmalloc: add cond_resched() in __vunmap()
Subsystem: mm/kasan
Alexander Potapenko <glider@google.com>:
printk: introduce dump_stack_lvl()
kasan: use dump_stack_lvl(KERN_ERR) to print stacks
David Gow <davidgow@google.com>:
kasan: test: improve failure message in KUNIT_EXPECT_KASAN_FAIL()
Daniel Axtens <dja@axtens.net>:
Patch series "KASAN core changes for ppc64 radix KASAN", v16:
kasan: allow an architecture to disable inline instrumentation
kasan: allow architectures to provide an outline readiness check
mm: define default MAX_PTRS_PER_* in include/pgtable.h
kasan: use MAX_PTRS_PER_* for early shadow tables
Kuan-Ying Lee <Kuan-Ying.Lee@mediatek.com>:
Patch series "kasan: add memory corruption identification support for hw tag-based kasan", v4:
kasan: rename CONFIG_KASAN_SW_TAGS_IDENTIFY to CONFIG_KASAN_TAGS_IDENTIFY
kasan: integrate the common part of two KASAN tag-based modes
kasan: add memory corruption identification support for hardware tag-based mode
Subsystem: mm/initialization
Jungseung Lee <js07.lee@samsung.com>:
mm: report which part of mem is being freed on initmem case
Subsystem: mm/pagealloc
Mike Rapoport <rppt@linux.ibm.com>:
mm/mmzone.h: simplify is_highmem_idx()
"Matthew Wilcox (Oracle)" <willy@infradead.org>:
Patch series "Constify struct page arguments":
mm: make __dump_page static
Aaron Tomlin <atomlin@redhat.com>:
mm/page_alloc: bail out on fatal signal during reclaim/compaction retry attempt
"Matthew Wilcox (Oracle)" <willy@infradead.org>:
mm/debug: factor PagePoisoned out of __dump_page
mm/page_owner: constify dump_page_owner
mm: make compound_head const-preserving
mm: constify get_pfnblock_flags_mask and get_pfnblock_migratetype
mm: constify page_count and page_ref_count
mm: optimise nth_page for contiguous memmap
Heiner Kallweit <hkallweit1@gmail.com>:
mm/page_alloc: switch to pr_debug
Andrii Nakryiko <andrii@kernel.org>:
kbuild: skip per-CPU BTF generation for pahole v1.18-v1.21
Mel Gorman <mgorman@techsingularity.net>:
mm/page_alloc: split per cpu page lists and zone stats
mm/page_alloc: convert per-cpu list protection to local_lock
mm/vmstat: convert NUMA statistics to basic NUMA counters
mm/vmstat: inline NUMA event counter updates
mm/page_alloc: batch the accounting updates in the bulk allocator
mm/page_alloc: reduce duration that IRQs are disabled for VM counters
mm/page_alloc: explicitly acquire the zone lock in __free_pages_ok
mm/page_alloc: avoid conflating IRQs disabled with zone->lock
mm/page_alloc: update PGFREE outside the zone lock in __free_pages_ok
Minchan Kim <minchan@kernel.org>:
mm: page_alloc: dump migrate-failed pages only at -EBUSY
Mel Gorman <mgorman@techsingularity.net>:
Patch series "Calculate pcp->high based on zone sizes and active CPUs", v2:
mm/page_alloc: delete vm.percpu_pagelist_fraction
mm/page_alloc: disassociate the pcp->high from pcp->batch
mm/page_alloc: adjust pcp->high after CPU hotplug events
mm/page_alloc: scale the number of pages that are batch freed
mm/page_alloc: limit the number of pages on PCP lists when reclaim is active
mm/page_alloc: introduce vm.percpu_pagelist_high_fraction
Dong Aisheng <aisheng.dong@nxp.com>:
mm: drop SECTION_SHIFT in code comments
mm/page_alloc: improve memmap_pages dbg msg
Liu Shixin <liushixin2@huawei.com>:
mm/page_alloc: fix counting of managed_pages
Mel Gorman <mgorman@techsingularity.net>:
Patch series "Allow high order pages to be stored on PCP", v2:
mm/page_alloc: move free_the_page
Mike Rapoport <rppt@linux.ibm.com>:
Patch series "Remove DISCONTIGMEM memory model", v3:
alpha: remove DISCONTIGMEM and NUMA
arc: update comment about HIGHMEM implementation
arc: remove support for DISCONTIGMEM
m68k: remove support for DISCONTIGMEM
mm: remove CONFIG_DISCONTIGMEM
arch, mm: remove stale mentions of DISCONIGMEM
docs: remove description of DISCONTIGMEM
mm: replace CONFIG_NEED_MULTIPLE_NODES with CONFIG_NUMA
mm: replace CONFIG_FLAT_NODE_MEM_MAP with CONFIG_FLATMEM
Mel Gorman <mgorman@techsingularity.net>:
mm/page_alloc: allow high-order pages to be stored on the per-cpu lists
mm/page_alloc: split pcp->high across all online CPUs for cpuless nodes
Subsystem: mm/memory-failure
Naoya Horiguchi <naoya.horiguchi@nec.com>:
mm,hwpoison: send SIGBUS with error virutal address
mm,hwpoison: make get_hwpoison_page() call get_any_page()
Documentation/admin-guide/kernel-parameters.txt | 6
Documentation/admin-guide/lockup-watchdogs.rst | 4
Documentation/admin-guide/sysctl/kernel.rst | 10
Documentation/admin-guide/sysctl/vm.rst | 52 -
Documentation/dev-tools/kasan.rst | 9
Documentation/vm/memory-model.rst | 45
arch/alpha/Kconfig | 22
arch/alpha/include/asm/machvec.h | 6
arch/alpha/include/asm/mmzone.h | 100 --
arch/alpha/include/asm/pgtable.h | 4
arch/alpha/include/asm/topology.h | 39
arch/alpha/kernel/core_marvel.c | 53 -
arch/alpha/kernel/core_wildfire.c | 29
arch/alpha/kernel/pci_iommu.c | 29
arch/alpha/kernel/proto.h | 8
arch/alpha/kernel/setup.c | 16
arch/alpha/kernel/sys_marvel.c | 5
arch/alpha/kernel/sys_wildfire.c | 5
arch/alpha/mm/Makefile | 2
arch/alpha/mm/init.c | 3
arch/alpha/mm/numa.c | 223 ----
arch/arc/Kconfig | 13
arch/arc/include/asm/mmzone.h | 40
arch/arc/kernel/troubleshoot.c | 8
arch/arc/mm/init.c | 21
arch/arm/include/asm/tlbflush.h | 13
arch/arm/mm/tlb-v6.S | 2
arch/arm/mm/tlb-v7.S | 2
arch/arm64/Kconfig | 2
arch/arm64/kvm/mmu.c | 2
arch/h8300/kernel/setup.c | 2
arch/ia64/Kconfig | 2
arch/ia64/include/asm/pal.h | 2
arch/ia64/include/asm/spinlock.h | 2
arch/ia64/include/asm/uv/uv_hub.h | 2
arch/ia64/kernel/efi_stub.S | 2
arch/ia64/kernel/mca_drv.c | 2
arch/ia64/kernel/topology.c | 5
arch/ia64/mm/numa.c | 5
arch/m68k/Kconfig.cpu | 10
arch/m68k/include/asm/mmzone.h | 10
arch/m68k/include/asm/page.h | 2
arch/m68k/include/asm/page_mm.h | 35
arch/m68k/include/asm/tlbflush.h | 2
arch/m68k/kernel/sys_m68k.c | 4
arch/m68k/mm/init.c | 20
arch/mips/Kconfig | 2
arch/mips/include/asm/mmzone.h | 8
arch/mips/include/asm/page.h | 2
arch/mips/kernel/traps.c | 4
arch/mips/mm/init.c | 7
arch/nds32/include/asm/memory.h | 6
arch/openrisc/include/asm/tlbflush.h | 2
arch/powerpc/Kconfig | 2
arch/powerpc/include/asm/mmzone.h | 4
arch/powerpc/kernel/setup_64.c | 2
arch/powerpc/kernel/smp.c | 2
arch/powerpc/kexec/core.c | 4
arch/powerpc/kvm/book3s_hv.c | 4
arch/powerpc/kvm/book3s_hv_uvmem.c | 2
arch/powerpc/mm/Makefile | 2
arch/powerpc/mm/mem.c | 4
arch/riscv/Kconfig | 2
arch/s390/Kconfig | 2
arch/s390/include/asm/pgtable.h | 2
arch/sh/include/asm/mmzone.h | 4
arch/sh/kernel/topology.c | 2
arch/sh/mm/Kconfig | 2
arch/sh/mm/init.c | 2
arch/sparc/Kconfig | 2
arch/sparc/include/asm/mmzone.h | 4
arch/sparc/kernel/smp_64.c | 2
arch/sparc/mm/init_64.c | 12
arch/x86/Kconfig | 2
arch/x86/ia32/ia32_aout.c | 4
arch/x86/kernel/cpu/mce/core.c | 13
arch/x86/kernel/cpu/sgx/encl.h | 4
arch/x86/kernel/setup_percpu.c | 6
arch/x86/mm/init_32.c | 4
arch/xtensa/include/asm/page.h | 4
arch/xtensa/include/asm/tlbflush.h | 4
drivers/base/node.c | 18
drivers/block/loop.c | 270 ++++-
drivers/block/loop.h | 15
drivers/dax/device.c | 2
drivers/gpu/drm/amd/amdgpu/amdgpu_ttm.c | 4
drivers/gpu/drm/i915/gem/selftests/i915_gem_mman.c | 2
drivers/media/common/videobuf2/frame_vector.c | 2
drivers/misc/sgi-gru/grufault.c | 4
drivers/vfio/vfio_iommu_type1.c | 2
drivers/virtio/virtio_balloon.c | 17
fs/adfs/inode.c | 1
fs/affs/file.c | 2
fs/bfs/file.c | 1
fs/binfmt_aout.c | 4
fs/binfmt_elf.c | 2
fs/binfmt_elf_fdpic.c | 11
fs/binfmt_flat.c | 2
fs/block_dev.c | 1
fs/buffer.c | 25
fs/configfs/inode.c | 8
fs/dax.c | 3
fs/ecryptfs/mmap.c | 13
fs/exfat/inode.c | 1
fs/ext2/inode.c | 4
fs/ext4/inode.c | 2
fs/fat/inode.c | 1
fs/fs-writeback.c | 366 +++++---
fs/fuse/dax.c | 3
fs/gfs2/aops.c | 2
fs/gfs2/meta_io.c | 2
fs/hfs/inode.c | 2
fs/hfsplus/inode.c | 2
fs/hpfs/file.c | 1
fs/iomap/buffered-io.c | 27
fs/jfs/inode.c | 1
fs/kernfs/inode.c | 8
fs/libfs.c | 44
fs/minix/inode.c | 1
fs/nilfs2/mdt.c | 1
fs/ntfs/inode.c | 2
fs/ocfs2/aops.c | 4
fs/ocfs2/cluster/heartbeat.c | 7
fs/ocfs2/cluster/nodemanager.c | 2
fs/ocfs2/dlm/dlmmaster.c | 2
fs/ocfs2/filecheck.c | 6
fs/ocfs2/stackglue.c | 8
fs/omfs/file.c | 1
fs/proc/task_mmu.c | 2
fs/ramfs/inode.c | 9
fs/squashfs/block.c | 5
fs/squashfs/squashfs_fs_sb.h | 1
fs/squashfs/super.c | 86 +
fs/sysv/itree.c | 1
fs/udf/file.c | 1
fs/udf/inode.c | 1
fs/ufs/inode.c | 1
fs/xfs/xfs_aops.c | 4
fs/zonefs/super.c | 4
include/asm-generic/memory_model.h | 37
include/asm-generic/pgtable-nop4d.h | 1
include/asm-generic/topology.h | 2
include/kunit/test.h | 5
include/linux/backing-dev-defs.h | 20
include/linux/cpuhotplug.h | 2
include/linux/fs.h | 6
include/linux/gfp.h | 13
include/linux/iomap.h | 1
include/linux/kasan.h | 7
include/linux/kernel.h | 2
include/linux/kthread.h | 2
include/linux/memblock.h | 6
include/linux/memcontrol.h | 60 -
include/linux/mm.h | 53 -
include/linux/mm_types.h | 10
include/linux/mman.h | 2
include/linux/mmdebug.h | 3
include/linux/mmzone.h | 96 +-
include/linux/page-flags.h | 10
include/linux/page_owner.h | 6
include/linux/page_ref.h | 4
include/linux/page_reporting.h | 3
include/linux/pageblock-flags.h | 2
include/linux/pagemap.h | 4
include/linux/pgtable.h | 22
include/linux/printk.h | 5
include/linux/sched/coredump.h | 8
include/linux/slab.h | 59 +
include/linux/swap.h | 19
include/linux/swapops.h | 5
include/linux/vmstat.h | 69 -
include/linux/writeback.h | 1
include/trace/events/cma.h | 4
include/trace/events/filemap.h | 2
include/trace/events/kmem.h | 12
include/trace/events/page_pool.h | 4
include/trace/events/pagemap.h | 4
include/trace/events/vmscan.h | 2
kernel/cgroup/cgroup.c | 1
kernel/crash_core.c | 4
kernel/events/core.c | 2
kernel/events/uprobes.c | 4
kernel/fork.c | 1
kernel/kthread.c | 19
kernel/sysctl.c | 16
kernel/watchdog.c | 12
lib/Kconfig.debug | 15
lib/Kconfig.kasan | 16
lib/Makefile | 1
lib/dump_stack.c | 20
lib/kunit/test.c | 18
lib/slub_kunit.c | 152 +++
lib/test_hmm.c | 5
lib/test_kasan.c | 11
lib/vsprintf.c | 2
mm/Kconfig | 38
mm/backing-dev.c | 66 +
mm/compaction.c | 2
mm/debug.c | 27
mm/debug_vm_pgtable.c | 63 +
mm/dmapool.c | 5
mm/filemap.c | 2
mm/gup.c | 81 +
mm/hugetlb.c | 2
mm/internal.h | 9
mm/kasan/Makefile | 4
mm/kasan/common.c | 6
mm/kasan/generic.c | 3
mm/kasan/hw_tags.c | 22
mm/kasan/init.c | 6
mm/kasan/kasan.h | 12
mm/kasan/report.c | 6
mm/kasan/report_hw_tags.c | 5
mm/kasan/report_sw_tags.c | 45
mm/kasan/report_tags.c | 51 +
mm/kasan/shadow.c | 6
mm/kasan/sw_tags.c | 45
mm/kasan/tags.c | 59 +
mm/kfence/kfence_test.c | 5
mm/kmemleak.c | 18
mm/ksm.c | 6
mm/memblock.c | 8
mm/memcontrol.c | 385 ++++++--
mm/memory-failure.c | 344 +++++--
mm/memory.c | 22
mm/memory_hotplug.c | 6
mm/mempolicy.c | 4
mm/migrate.c | 4
mm/mmap.c | 54 -
mm/mmap_lock.c | 33
mm/mprotect.c | 52 +
mm/mremap.c | 5
mm/nommu.c | 2
mm/page-writeback.c | 89 +
mm/page_alloc.c | 950 +++++++++++++--------
mm/page_ext.c | 2
mm/page_owner.c | 2
mm/page_reporting.c | 19
mm/page_reporting.h | 5
mm/pagewalk.c | 58 +
mm/shmem.c | 18
mm/slab.h | 24
mm/slab_common.c | 60 -
mm/slub.c | 420 +++++----
mm/sparse.c | 2
mm/swap.c | 4
mm/swap_slots.c | 2
mm/swap_state.c | 20
mm/swapfile.c | 177 +--
mm/vmalloc.c | 181 ++--
mm/vmscan.c | 43
mm/vmstat.c | 282 ++----
mm/workingset.c | 2
net/ipv4/tcp.c | 4
scripts/kconfig/streamline_config.pl | 76 -
scripts/link-vmlinux.sh | 4
scripts/spelling.txt | 16
tools/testing/selftests/vm/gup_test.c | 96 +-
tools/vm/page_owner_sort.c | 4
virt/kvm/kvm_main.c | 2
260 files changed, 3989 insertions(+), 2996 deletions(-)
^ permalink raw reply [flat|nested] 232+ messages in thread
* incoming
@ 2021-07-01 1:46 Andrew Morton
2021-07-03 0:28 ` incoming Linus Torvalds
0 siblings, 1 reply; 232+ messages in thread
From: Andrew Morton @ 2021-07-01 1:46 UTC (permalink / raw)
To: Linus Torvalds; +Cc: linux-mm, mm-commits
This is the rest of the -mm tree, less 66 patches which are dependent on
things which are (or were recently) in linux-next. I'll trickle that
material over next week.
192 patches, based on 7cf3dead1ad70c72edb03e2d98e1f3dcd332cdb2 plus the
June 28 sendings.
Subsystems affected by this patch series:
mm/hugetlb
mm/userfaultfd
mm/vmscan
mm/kconfig
mm/proc
mm/z3fold
mm/zbud
mm/ras
mm/mempolicy
mm/memblock
mm/migration
mm/thp
mm/nommu
mm/kconfig
mm/madvise
mm/memory-hotplug
mm/zswap
mm/zsmalloc
mm/zram
mm/cleanups
mm/kfence
mm/hmm
procfs
sysctl
misc
core-kernel
lib
lz4
checkpatch
init
kprobes
nilfs2
hfs
signals
exec
kcov
selftests
compress/decompress
ipc
Subsystem: mm/hugetlb
Muchun Song <songmuchun@bytedance.com>:
Patch series "Free some vmemmap pages of HugeTLB page", v23:
mm: memory_hotplug: factor out bootmem core functions to bootmem_info.c
mm: hugetlb: introduce a new config HUGETLB_PAGE_FREE_VMEMMAP
mm: hugetlb: gather discrete indexes of tail page
mm: hugetlb: free the vmemmap pages associated with each HugeTLB page
mm: hugetlb: defer freeing of HugeTLB pages
mm: hugetlb: alloc the vmemmap pages associated with each HugeTLB page
mm: hugetlb: add a kernel parameter hugetlb_free_vmemmap
mm: memory_hotplug: disable memmap_on_memory when hugetlb_free_vmemmap enabled
mm: hugetlb: introduce nr_free_vmemmap_pages in the struct hstate
Shixin Liu <liushixin2@huawei.com>:
mm/debug_vm_pgtable: move {pmd/pud}_huge_tests out of CONFIG_TRANSPARENT_HUGEPAGE
mm/debug_vm_pgtable: remove redundant pfn_{pmd/pte}() and fix one comment mistake
Miaohe Lin <linmiaohe@huawei.com>:
Patch series "Cleanup and fixup for huge_memory:, v3:
mm/huge_memory.c: remove dedicated macro HPAGE_CACHE_INDEX_MASK
mm/huge_memory.c: use page->deferred_list
mm/huge_memory.c: add missing read-only THP checking in transparent_hugepage_enabled()
mm/huge_memory.c: remove unnecessary tlb_remove_page_size() for huge zero pmd
mm/huge_memory.c: don't discard hugepage if other processes are mapping it
Christophe Leroy <christophe.leroy@csgroup.eu>:
Patch series "Subject: [PATCH v2 0/5] Implement huge VMAP and VMALLOC on powerpc 8xx", v2:
mm/hugetlb: change parameters of arch_make_huge_pte()
mm/pgtable: add stubs for {pmd/pub}_{set/clear}_huge
mm/vmalloc: enable mapping of huge pages at pte level in vmap
mm/vmalloc: enable mapping of huge pages at pte level in vmalloc
powerpc/8xx: add support for huge pages on VMAP and VMALLOC
Nanyong Sun <sunnanyong@huawei.com>:
khugepaged: selftests: remove debug_cow
Mina Almasry <almasrymina@google.com>:
mm, hugetlb: fix racy resv_huge_pages underflow on UFFDIO_COPY
Muchun Song <songmuchun@bytedance.com>:
Patch series "Split huge PMD mapping of vmemmap pages", v4:
mm: sparsemem: split the huge PMD mapping of vmemmap pages
mm: sparsemem: use huge PMD mapping for vmemmap pages
mm: hugetlb: introduce CONFIG_HUGETLB_PAGE_FREE_VMEMMAP_DEFAULT_ON
Mike Kravetz <mike.kravetz@oracle.com>:
Patch series "Fix prep_compound_gigantic_page ref count adjustment":
hugetlb: remove prep_compound_huge_page cleanup
hugetlb: address ref count racing in prep_compound_gigantic_page
Naoya Horiguchi <naoya.horiguchi@nec.com>:
mm/hwpoison: disable pcp for page_handle_poison()
Subsystem: mm/userfaultfd
Peter Xu <peterx@redhat.com>:
Patch series "userfaultfd/selftests: A few cleanups", v2:
userfaultfd/selftests: use user mode only
userfaultfd/selftests: remove the time() check on delayed uffd
userfaultfd/selftests: dropping VERIFY check in locking_thread
userfaultfd/selftests: only dump counts if mode enabled
userfaultfd/selftests: unify error handling
Patch series "mm/uffd: Misc fix for uffd-wp and one more test":
mm/thp: simplify copying of huge zero page pmd when fork
mm/userfaultfd: fix uffd-wp special cases for fork()
mm/userfaultfd: fail uffd-wp registration if not supported
mm/pagemap: export uffd-wp protection information
userfaultfd/selftests: add pagemap uffd-wp test
Axel Rasmussen <axelrasmussen@google.com>:
Patch series "userfaultfd: add minor fault handling for shmem", v6:
userfaultfd/shmem: combine shmem_{mcopy_atomic,mfill_zeropage}_pte
userfaultfd/shmem: support minor fault registration for shmem
userfaultfd/shmem: support UFFDIO_CONTINUE for shmem
userfaultfd/shmem: advertise shmem minor fault support
userfaultfd/shmem: modify shmem_mfill_atomic_pte to use install_pte()
userfaultfd/selftests: use memfd_create for shmem test type
userfaultfd/selftests: create alias mappings in the shmem test
userfaultfd/selftests: reinitialize test context in each test
userfaultfd/selftests: exercise minor fault handling shmem support
Subsystem: mm/vmscan
Yu Zhao <yuzhao@google.com>:
mm/vmscan.c: fix potential deadlock in reclaim_pages()
include/trace/events/vmscan.h: remove mm_vmscan_inactive_list_is_low
Miaohe Lin <linmiaohe@huawei.com>:
mm: workingset: define macro WORKINGSET_SHIFT
Subsystem: mm/kconfig
Kefeng Wang <wangkefeng.wang@huawei.com>:
mm/kconfig: move HOLES_IN_ZONE into mm
Subsystem: mm/proc
Mike Rapoport <rppt@linux.ibm.com>:
docs: proc.rst: meminfo: briefly describe gaps in memory accounting
David Hildenbrand <david@redhat.com>:
Patch series "fs/proc/kcore: don't read offline sections, logically offline pages and hwpoisoned pages", v3:
fs/proc/kcore: drop KCORE_REMAP and KCORE_OTHER
fs/proc/kcore: pfn_is_ram check only applies to KCORE_RAM
fs/proc/kcore: don't read offline sections, logically offline pages and hwpoisoned pages
mm: introduce page_offline_(begin|end|freeze|thaw) to synchronize setting PageOffline()
virtio-mem: use page_offline_(start|end) when setting PageOffline()
fs/proc/kcore: use page_offline_(freeze|thaw)
Subsystem: mm/z3fold
Miaohe Lin <linmiaohe@huawei.com>:
Patch series "Cleanup and fixup for z3fold":
mm/z3fold: define macro NCHUNKS as TOTAL_CHUNKS - ZHDR_CHUNKS
mm/z3fold: avoid possible underflow in z3fold_alloc()
mm/z3fold: remove magic number in z3fold_create_pool()
mm/z3fold: remove unused function handle_to_z3fold_header()
mm/z3fold: fix potential memory leak in z3fold_destroy_pool()
mm/z3fold: use release_z3fold_page_locked() to release locked z3fold page
Subsystem: mm/zbud
Miaohe Lin <linmiaohe@huawei.com>:
Patch series "Cleanups for zbud", v2:
mm/zbud: reuse unbuddied[0] as buddied in zbud_pool
mm/zbud: don't export any zbud API
Subsystem: mm/ras
YueHaibing <yuehaibing@huawei.com>:
mm/compaction: use DEVICE_ATTR_WO macro
Liu Xiang <liu.xiang@zlingsmart.com>:
mm: compaction: remove duplicate !list_empty(&sublist) check
Wonhyuk Yang <vvghjk1234@gmail.com>:
mm/compaction: fix 'limit' in fast_isolate_freepages
Subsystem: mm/mempolicy
Feng Tang <feng.tang@intel.com>:
Patch series "mm/mempolicy: some fix and semantics cleanup", v4:
mm/mempolicy: cleanup nodemask intersection check for oom
mm/mempolicy: don't handle MPOL_LOCAL like a fake MPOL_PREFERRED policy
mm/mempolicy: unify the parameter sanity check for mbind and set_mempolicy
Yang Shi <shy828301@gmail.com>:
mm: mempolicy: don't have to split pmd for huge zero page
Ben Widawsky <ben.widawsky@intel.com>:
mm/mempolicy: use unified 'nodes' for bind/interleave/prefer policies
Subsystem: mm/memblock
Mike Rapoport <rppt@linux.ibm.com>:
Patch series "arm64: drop pfn_valid_within() and simplify pfn_valid()", v4:
include/linux/mmzone.h: add documentation for pfn_valid()
memblock: update initialization of reserved pages
arm64: decouple check whether pfn is in linear map from pfn_valid()
arm64: drop pfn_valid_within() and simplify pfn_valid()
Anshuman Khandual <anshuman.khandual@arm.com>:
arm64/mm: drop HAVE_ARCH_PFN_VALID
Subsystem: mm/migration
Muchun Song <songmuchun@bytedance.com>:
mm: migrate: fix missing update page_private to hugetlb_page_subpool
Subsystem: mm/thp
Collin Fijalkovich <cfijalkovich@google.com>:
mm, thp: relax the VM_DENYWRITE constraint on file-backed THPs
Yang Shi <shy828301@gmail.com>:
mm: memory: add orig_pmd to struct vm_fault
mm: memory: make numa_migrate_prep() non-static
mm: thp: refactor NUMA fault handling
mm: migrate: account THP NUMA migration counters correctly
mm: migrate: don't split THP for misplaced NUMA page
mm: migrate: check mapcount for THP instead of refcount
mm: thp: skip make PMD PROT_NONE if THP migration is not supported
Anshuman Khandual <anshuman.khandual@arm.com>:
mm/thp: make ARCH_ENABLE_SPLIT_PMD_PTLOCK dependent on PGTABLE_LEVELS > 2
Yang Shi <shy828301@gmail.com>:
mm: rmap: make try_to_unmap() void function
Hugh Dickins <hughd@google.com>:
mm/thp: remap_page() is only needed on anonymous THP
mm: hwpoison_user_mappings() try_to_unmap() with TTU_SYNC
"Matthew Wilcox (Oracle)" <willy@infradead.org>:
mm/thp: fix strncpy warning
Subsystem: mm/nommu
Chen Li <chenli@uniontech.com>:
nommu: remove __GFP_HIGHMEM in vmalloc/vzalloc
Liam Howlett <liam.howlett@oracle.com>:
mm/nommu: unexport do_munmap()
Subsystem: mm/kconfig
Kefeng Wang <wangkefeng.wang@huawei.com>:
mm: generalize ZONE_[DMA|DMA32]
Subsystem: mm/madvise
David Hildenbrand <david@redhat.com>:
Patch series "mm/madvise: introduce MADV_POPULATE_(READ|WRITE) to prefault page tables", v2:
mm: make variable names for populate_vma_page_range() consistent
mm/madvise: introduce MADV_POPULATE_(READ|WRITE) to prefault page tables
MAINTAINERS: add tools/testing/selftests/vm/ to MEMORY MANAGEMENT
selftests/vm: add protection_keys_32 / protection_keys_64 to gitignore
selftests/vm: add test for MADV_POPULATE_(READ|WRITE)
Subsystem: mm/memory-hotplug
Liam Mark <lmark@codeaurora.org>:
mm/memory_hotplug: rate limit page migration warnings
Oscar Salvador <osalvador@suse.de>:
mm,memory_hotplug: drop unneeded locking
Subsystem: mm/zswap
Miaohe Lin <linmiaohe@huawei.com>:
Patch series "Cleanup and fixup for zswap":
mm/zswap.c: remove unused function zswap_debugfs_exit()
mm/zswap.c: avoid unnecessary copy-in at map time
mm/zswap.c: fix two bugs in zswap_writeback_entry()
Subsystem: mm/zsmalloc
Zhaoyang Huang <zhaoyang.huang@unisoc.com>:
mm: zram: amend SLAB_RECLAIM_ACCOUNT on zspage_cachep
Miaohe Lin <linmiaohe@huawei.com>:
Patch series "Cleanup for zsmalloc":
mm/zsmalloc.c: remove confusing code in obj_free()
mm/zsmalloc.c: improve readability for async_free_zspage()
Subsystem: mm/zram
Yue Hu <huyue2@yulong.com>:
zram: move backing_dev under macro CONFIG_ZRAM_WRITEBACK
Subsystem: mm/cleanups
Hyeonggon Yoo <42.hyeyoo@gmail.com>:
mm: fix typos and grammar error in comments
Anshuman Khandual <anshuman.khandual@arm.com>:
mm: define default value for FIRST_USER_ADDRESS
Zhen Lei <thunder.leizhen@huawei.com>:
mm: fix spelling mistakes
Mel Gorman <mgorman@techsingularity.net>:
Patch series "Clean W=1 build warnings for mm/":
mm/vmscan: remove kerneldoc-like comment from isolate_lru_pages
mm/vmalloc: include header for prototype of set_iounmap_nonlazy
mm/page_alloc: make should_fail_alloc_page() static
mm/mapping_dirty_helpers: remove double Note in kerneldoc
mm/memcontrol.c: fix kerneldoc comment for mem_cgroup_calculate_protection
mm/memory_hotplug: fix kerneldoc comment for __try_online_node
mm/memory_hotplug: fix kerneldoc comment for __remove_memory
mm/zbud: add kerneldoc fields for zbud_pool
mm/z3fold: add kerneldoc fields for z3fold_pool
mm/swap: make swap_address_space an inline function
mm/mmap_lock: remove dead code for !CONFIG_TRACING configurations
mm/page_alloc: move prototype for find_suitable_fallback
mm/swap: make NODE_DATA an inline function on CONFIG_FLATMEM
Anshuman Khandual <anshuman.khandual@arm.com>:
mm/thp: define default pmd_pgtable()
Subsystem: mm/kfence
Marco Elver <elver@google.com>:
kfence: unconditionally use unbound work queue
Subsystem: mm/hmm
Alistair Popple <apopple@nvidia.com>:
Patch series "Add support for SVM atomics in Nouveau", v11:
mm: remove special swap entry functions
mm/swapops: rework swap entry manipulation code
mm/rmap: split try_to_munlock from try_to_unmap
mm/rmap: split migration into its own function
mm: rename migrate_pgmap_owner
mm/memory.c: allow different return codes for copy_nonpresent_pte()
mm: device exclusive memory access
mm: selftests for exclusive device memory
nouveau/svm: refactor nouveau_range_fault
nouveau/svm: implement atomic SVM access
Subsystem: procfs
Marcelo Henrique Cerri <marcelo.cerri@canonical.com>:
proc: Avoid mixing integer types in mem_rw()
ZHOUFENG <zhoufeng.zf@bytedance.com>:
fs/proc/kcore.c: add mmap interface
Kalesh Singh <kaleshsingh@google.com>:
procfs: allow reading fdinfo with PTRACE_MODE_READ
procfs/dmabuf: add inode number to /proc/*/fdinfo
Subsystem: sysctl
Jiapeng Chong <jiapeng.chong@linux.alibaba.com>:
sysctl: remove redundant assignment to first
Subsystem: misc
Andy Shevchenko <andriy.shevchenko@linux.intel.com>:
drm: include only needed headers in ascii85.h
Subsystem: core-kernel
Andy Shevchenko <andriy.shevchenko@linux.intel.com>:
kernel.h: split out panic and oops helpers
Subsystem: lib
Zhen Lei <thunder.leizhen@huawei.com>:
lib: decompress_bunzip2: remove an unneeded semicolon
Andy Shevchenko <andriy.shevchenko@linux.intel.com>:
Patch series "lib/string_helpers: get rid of ugly *_escape_mem_ascii()", v3:
lib/string_helpers: switch to use BIT() macro
lib/string_helpers: move ESCAPE_NP check inside 'else' branch in a loop
lib/string_helpers: drop indentation level in string_escape_mem()
lib/string_helpers: introduce ESCAPE_NA for escaping non-ASCII
lib/string_helpers: introduce ESCAPE_NAP to escape non-ASCII and non-printable
lib/string_helpers: allow to append additional characters to be escaped
lib/test-string_helpers: print flags in hexadecimal format
lib/test-string_helpers: get rid of trailing comma in terminators
lib/test-string_helpers: add test cases for new features
MAINTAINERS: add myself as designated reviewer for generic string library
seq_file: introduce seq_escape_mem()
seq_file: add seq_escape_str() as replica of string_escape_str()
seq_file: convert seq_escape() to use seq_escape_str()
nfsd: avoid non-flexible API in seq_quote_mem()
seq_file: drop unused *_escape_mem_ascii()
Trent Piepho <tpiepho@gmail.com>:
lib/math/rational.c: fix divide by zero
lib/math/rational: add Kunit test cases
Zhen Lei <thunder.leizhen@huawei.com>:
lib/decompressors: fix spelling mistakes
lib/mpi: fix spelling mistakes
Alexey Dobriyan <adobriyan@gmail.com>:
lib: memscan() fixlet
lib: uninline simple_strtoull()
Matteo Croce <mcroce@microsoft.com>:
lib/test_string.c: allow module removal
Andy Shevchenko <andriy.shevchenko@linux.intel.com>:
kernel.h: split out kstrtox() and simple_strtox() to a separate header
Subsystem: lz4
Rajat Asthana <thisisrast7@gmail.com>:
lz4_decompress: declare LZ4_decompress_safe_withPrefix64k static
Dimitri John Ledkov <dimitri.ledkov@canonical.com>:
lib/decompress_unlz4.c: correctly handle zero-padding around initrds.
Subsystem: checkpatch
Guenter Roeck <linux@roeck-us.net>:
checkpatch: scripts/spdxcheck.py now requires python3
Joe Perches <joe@perches.com>:
checkpatch: improve the indented label test
Guenter Roeck <linux@roeck-us.net>:
checkpatch: do not complain about positive return values starting with EPOLL
Subsystem: init
Andrew Halaney <ahalaney@redhat.com>:
init: print out unknown kernel parameters
Subsystem: kprobes
Barry Song <song.bao.hua@hisilicon.com>:
kprobes: remove duplicated strong free_insn_page in x86 and s390
Subsystem: nilfs2
Colin Ian King <colin.king@canonical.com>:
nilfs2: remove redundant continue statement in a while-loop
Subsystem: hfs
Zhen Lei <thunder.leizhen@huawei.com>:
hfsplus: remove unnecessary oom message
Chung-Chiang Cheng <shepjeng@gmail.com>:
hfsplus: report create_date to kstat.btime
Subsystem: signals
Al Viro <viro@zeniv.linux.org.uk>:
x86: signal: don't do sas_ss_reset() until we are certain that sigframe won't be abandoned
Subsystem: exec
Alexey Dobriyan <adobriyan@gmail.com>:
exec: remove checks in __register_bimfmt()
Subsystem: kcov
Marco Elver <elver@google.com>:
kcov: add __no_sanitize_coverage to fix noinstr for all architectures
Subsystem: selftests
Dave Hansen <dave.hansen@linux.intel.com>:
Patch series "selftests/vm/pkeys: Bug fixes and a new test":
selftests/vm/pkeys: fix alloc_random_pkey() to make it really, really random
selftests/vm/pkeys: handle negative sys_pkey_alloc() return code
selftests/vm/pkeys: refill shadow register after implicit kernel write
selftests/vm/pkeys: exercise x86 XSAVE init state
Subsystem: compress/decompress
Yu Kuai <yukuai3@huawei.com>:
lib/decompressors: remove set but not used variabled 'level'
Subsystem: ipc
Vasily Averin <vvs@virtuozzo.com>:
Patch series "ipc: allocations cleanup", v2:
ipc sem: use kvmalloc for sem_undo allocation
ipc: use kmalloc for msg_queue and shmid_kernel
Manfred Spraul <manfred@colorfullife.com>:
ipc/sem.c: use READ_ONCE()/WRITE_ONCE() for use_global_lock
ipc/util.c: use binary search for max_idx
Documentation/admin-guide/kernel-parameters.txt | 35
Documentation/admin-guide/mm/hugetlbpage.rst | 11
Documentation/admin-guide/mm/memory-hotplug.rst | 13
Documentation/admin-guide/mm/pagemap.rst | 2
Documentation/admin-guide/mm/userfaultfd.rst | 3
Documentation/core-api/kernel-api.rst | 7
Documentation/filesystems/proc.rst | 48
Documentation/vm/hmm.rst | 19
Documentation/vm/unevictable-lru.rst | 33
MAINTAINERS | 10
arch/alpha/Kconfig | 5
arch/alpha/include/asm/pgalloc.h | 1
arch/alpha/include/asm/pgtable.h | 1
arch/alpha/include/uapi/asm/mman.h | 3
arch/alpha/kernel/setup.c | 2
arch/arc/include/asm/pgalloc.h | 2
arch/arc/include/asm/pgtable.h | 8
arch/arm/Kconfig | 3
arch/arm/include/asm/pgalloc.h | 1
arch/arm64/Kconfig | 15
arch/arm64/include/asm/hugetlb.h | 3
arch/arm64/include/asm/memory.h | 2
arch/arm64/include/asm/page.h | 4
arch/arm64/include/asm/pgalloc.h | 1
arch/arm64/include/asm/pgtable.h | 2
arch/arm64/kernel/setup.c | 1
arch/arm64/kvm/mmu.c | 2
arch/arm64/mm/hugetlbpage.c | 5
arch/arm64/mm/init.c | 51
arch/arm64/mm/ioremap.c | 4
arch/arm64/mm/mmu.c | 22
arch/csky/include/asm/pgalloc.h | 2
arch/csky/include/asm/pgtable.h | 1
arch/hexagon/include/asm/pgtable.h | 4
arch/ia64/Kconfig | 7
arch/ia64/include/asm/pal.h | 1
arch/ia64/include/asm/pgalloc.h | 1
arch/ia64/include/asm/pgtable.h | 1
arch/m68k/Kconfig | 5
arch/m68k/include/asm/mcf_pgalloc.h | 2
arch/m68k/include/asm/mcf_pgtable.h | 2
arch/m68k/include/asm/motorola_pgalloc.h | 1
arch/m68k/include/asm/motorola_pgtable.h | 2
arch/m68k/include/asm/pgtable_mm.h | 1
arch/m68k/include/asm/sun3_pgalloc.h | 1
arch/microblaze/Kconfig | 4
arch/microblaze/include/asm/pgalloc.h | 2
arch/microblaze/include/asm/pgtable.h | 2
arch/mips/Kconfig | 10
arch/mips/include/asm/pgalloc.h | 1
arch/mips/include/asm/pgtable-32.h | 1
arch/mips/include/asm/pgtable-64.h | 1
arch/mips/include/uapi/asm/mman.h | 3
arch/mips/kernel/relocate.c | 1
arch/mips/sgi-ip22/ip22-reset.c | 1
arch/mips/sgi-ip32/ip32-reset.c | 1
arch/nds32/include/asm/pgalloc.h | 5
arch/nios2/include/asm/pgalloc.h | 1
arch/nios2/include/asm/pgtable.h | 2
arch/openrisc/include/asm/pgalloc.h | 2
arch/openrisc/include/asm/pgtable.h | 1
arch/parisc/include/asm/pgalloc.h | 1
arch/parisc/include/asm/pgtable.h | 2
arch/parisc/include/uapi/asm/mman.h | 3
arch/parisc/kernel/pdc_chassis.c | 1
arch/powerpc/Kconfig | 6
arch/powerpc/include/asm/book3s/pgtable.h | 1
arch/powerpc/include/asm/nohash/32/hugetlb-8xx.h | 5
arch/powerpc/include/asm/nohash/32/mmu-8xx.h | 43
arch/powerpc/include/asm/nohash/32/pgtable.h | 1
arch/powerpc/include/asm/nohash/64/pgtable.h | 2
arch/powerpc/include/asm/pgalloc.h | 5
arch/powerpc/include/asm/pgtable.h | 6
arch/powerpc/kernel/setup-common.c | 1
arch/powerpc/platforms/Kconfig.cputype | 1
arch/riscv/Kconfig | 5
arch/riscv/include/asm/pgalloc.h | 2
arch/riscv/include/asm/pgtable.h | 2
arch/s390/Kconfig | 6
arch/s390/include/asm/pgalloc.h | 3
arch/s390/include/asm/pgtable.h | 5
arch/s390/kernel/ipl.c | 1
arch/s390/kernel/kprobes.c | 5
arch/s390/mm/pgtable.c | 2
arch/sh/include/asm/pgalloc.h | 1
arch/sh/include/asm/pgtable.h | 2
arch/sparc/Kconfig | 5
arch/sparc/include/asm/pgalloc_32.h | 1
arch/sparc/include/asm/pgalloc_64.h | 1
arch/sparc/include/asm/pgtable_32.h | 3
arch/sparc/include/asm/pgtable_64.h | 8
arch/sparc/kernel/sstate.c | 1
arch/sparc/mm/hugetlbpage.c | 6
arch/sparc/mm/init_64.c | 1
arch/um/drivers/mconsole_kern.c | 1
arch/um/include/asm/pgalloc.h | 1
arch/um/include/asm/pgtable-2level.h | 1
arch/um/include/asm/pgtable-3level.h | 1
arch/um/kernel/um_arch.c | 1
arch/x86/Kconfig | 17
arch/x86/include/asm/desc.h | 1
arch/x86/include/asm/pgalloc.h | 2
arch/x86/include/asm/pgtable_types.h | 2
arch/x86/kernel/cpu/mshyperv.c | 1
arch/x86/kernel/kprobes/core.c | 6
arch/x86/kernel/setup.c | 1
arch/x86/mm/init_64.c | 21
arch/x86/mm/pgtable.c | 34
arch/x86/purgatory/purgatory.c | 2
arch/x86/xen/enlighten.c | 1
arch/xtensa/include/asm/pgalloc.h | 2
arch/xtensa/include/asm/pgtable.h | 1
arch/xtensa/include/uapi/asm/mman.h | 3
arch/xtensa/platforms/iss/setup.c | 1
drivers/block/zram/zram_drv.h | 2
drivers/bus/brcmstb_gisb.c | 1
drivers/char/ipmi/ipmi_msghandler.c | 1
drivers/clk/analogbits/wrpll-cln28hpc.c | 4
drivers/edac/altera_edac.c | 1
drivers/firmware/google/gsmi.c | 1
drivers/gpu/drm/nouveau/include/nvif/if000c.h | 1
drivers/gpu/drm/nouveau/nouveau_svm.c | 162 ++-
drivers/gpu/drm/nouveau/nvkm/subdev/mmu/vmm.h | 1
drivers/gpu/drm/nouveau/nvkm/subdev/mmu/vmmgp100.c | 6
drivers/hv/vmbus_drv.c | 1
drivers/hwtracing/coresight/coresight-cpu-debug.c | 1
drivers/leds/trigger/ledtrig-activity.c | 1
drivers/leds/trigger/ledtrig-heartbeat.c | 1
drivers/leds/trigger/ledtrig-panic.c | 1
drivers/misc/bcm-vk/bcm_vk_dev.c | 1
drivers/misc/ibmasm/heartbeat.c | 1
drivers/misc/pvpanic/pvpanic.c | 1
drivers/net/ipa/ipa_smp2p.c | 1
drivers/parisc/power.c | 1
drivers/power/reset/ltc2952-poweroff.c | 1
drivers/remoteproc/remoteproc_core.c | 1
drivers/s390/char/con3215.c | 1
drivers/s390/char/con3270.c | 1
drivers/s390/char/sclp.c | 1
drivers/s390/char/sclp_con.c | 1
drivers/s390/char/sclp_vt220.c | 1
drivers/s390/char/zcore.c | 1
drivers/soc/bcm/brcmstb/pm/pm-arm.c | 1
drivers/staging/olpc_dcon/olpc_dcon.c | 1
drivers/video/fbdev/hyperv_fb.c | 1
drivers/virtio/virtio_mem.c | 2
fs/Kconfig | 15
fs/exec.c | 3
fs/hfsplus/inode.c | 5
fs/hfsplus/xattr.c | 1
fs/nfsd/nfs4state.c | 2
fs/nilfs2/btree.c | 1
fs/open.c | 13
fs/proc/base.c | 6
fs/proc/fd.c | 20
fs/proc/kcore.c | 136 ++
fs/proc/task_mmu.c | 34
fs/seq_file.c | 43
fs/userfaultfd.c | 15
include/asm-generic/bug.h | 3
include/linux/ascii85.h | 3
include/linux/bootmem_info.h | 68 +
include/linux/compat.h | 2
include/linux/compiler-clang.h | 17
include/linux/compiler-gcc.h | 6
include/linux/compiler_types.h | 2
include/linux/huge_mm.h | 74 -
include/linux/hugetlb.h | 80 +
include/linux/hugetlb_cgroup.h | 19
include/linux/kcore.h | 3
include/linux/kernel.h | 227 ----
include/linux/kprobes.h | 1
include/linux/kstrtox.h | 155 ++
include/linux/memblock.h | 4
include/linux/memory_hotplug.h | 27
include/linux/mempolicy.h | 9
include/linux/memremap.h | 2
include/linux/migrate.h | 27
include/linux/mm.h | 18
include/linux/mm_types.h | 2
include/linux/mmu_notifier.h | 26
include/linux/mmzone.h | 27
include/linux/mpi.h | 4
include/linux/page-flags.h | 22
include/linux/panic.h | 98 +
include/linux/panic_notifier.h | 12
include/linux/pgtable.h | 44
include/linux/rmap.h | 13
include/linux/seq_file.h | 10
include/linux/shmem_fs.h | 19
include/linux/signal.h | 2
include/linux/string.h | 7
include/linux/string_helpers.h | 31
include/linux/sunrpc/cache.h | 1
include/linux/swap.h | 19
include/linux/swapops.h | 171 +--
include/linux/thread_info.h | 1
include/linux/userfaultfd_k.h | 5
include/linux/vmalloc.h | 15
include/linux/zbud.h | 23
include/trace/events/vmscan.h | 41
include/uapi/asm-generic/mman-common.h | 3
include/uapi/linux/mempolicy.h | 1
include/uapi/linux/userfaultfd.h | 7
init/main.c | 42
ipc/msg.c | 6
ipc/sem.c | 25
ipc/shm.c | 6
ipc/util.c | 44
ipc/util.h | 3
kernel/hung_task.c | 1
kernel/kexec_core.c | 1
kernel/kprobes.c | 2
kernel/panic.c | 1
kernel/rcu/tree.c | 2
kernel/signal.c | 14
kernel/sysctl.c | 4
kernel/trace/trace.c | 1
lib/Kconfig.debug | 12
lib/decompress_bunzip2.c | 6
lib/decompress_unlz4.c | 8
lib/decompress_unlzo.c | 3
lib/decompress_unxz.c | 2
lib/decompress_unzstd.c | 4
lib/kstrtox.c | 5
lib/lz4/lz4_decompress.c | 2
lib/math/Makefile | 1
lib/math/rational-test.c | 56 +
lib/math/rational.c | 16
lib/mpi/longlong.h | 4
lib/mpi/mpicoder.c | 6
lib/mpi/mpiutil.c | 2
lib/parser.c | 1
lib/string.c | 2
lib/string_helpers.c | 142 +-
lib/test-string_helpers.c | 157 ++-
lib/test_hmm.c | 127 ++
lib/test_hmm_uapi.h | 2
lib/test_string.c | 5
lib/vsprintf.c | 1
lib/xz/xz_dec_bcj.c | 2
lib/xz/xz_dec_lzma2.c | 8
lib/zlib_inflate/inffast.c | 2
lib/zstd/huf.h | 2
mm/Kconfig | 16
mm/Makefile | 2
mm/bootmem_info.c | 127 ++
mm/compaction.c | 20
mm/debug_vm_pgtable.c | 109 --
mm/gup.c | 58 +
mm/hmm.c | 12
mm/huge_memory.c | 269 ++---
mm/hugetlb.c | 369 +++++--
mm/hugetlb_vmemmap.c | 332 ++++++
mm/hugetlb_vmemmap.h | 53 -
mm/internal.h | 29
mm/kfence/core.c | 4
mm/khugepaged.c | 20
mm/madvise.c | 66 +
mm/mapping_dirty_helpers.c | 2
mm/memblock.c | 28
mm/memcontrol.c | 4
mm/memory-failure.c | 38
mm/memory.c | 239 +++-
mm/memory_hotplug.c | 161 ---
mm/mempolicy.c | 323 ++----
mm/migrate.c | 268 +----
mm/mlock.c | 12
mm/mmap_lock.c | 59 -
mm/mprotect.c | 18
mm/nommu.c | 5
mm/oom_kill.c | 2
mm/page_alloc.c | 5
mm/page_vma_mapped.c | 15
mm/rmap.c | 644 +++++++++---
mm/shmem.c | 125 --
mm/sparse-vmemmap.c | 432 +++++++-
mm/sparse.c | 1
mm/swap.c | 2
mm/swapfile.c | 2
mm/userfaultfd.c | 249 ++--
mm/util.c | 40
mm/vmalloc.c | 37
mm/vmscan.c | 20
mm/workingset.c | 10
mm/z3fold.c | 39
mm/zbud.c | 235 ++--
mm/zsmalloc.c | 5
mm/zswap.c | 26
scripts/checkpatch.pl | 16
tools/testing/selftests/vm/.gitignore | 3
tools/testing/selftests/vm/Makefile | 5
tools/testing/selftests/vm/hmm-tests.c | 158 +++
tools/testing/selftests/vm/khugepaged.c | 4
tools/testing/selftests/vm/madv_populate.c | 342 ++++++
tools/testing/selftests/vm/pkey-x86.h | 1
tools/testing/selftests/vm/protection_keys.c | 85 +
tools/testing/selftests/vm/run_vmtests.sh | 16
tools/testing/selftests/vm/userfaultfd.c | 1094 ++++++++++-----------
299 files changed, 6277 insertions(+), 3183 deletions(-)
^ permalink raw reply [flat|nested] 232+ messages in thread
* Re: incoming
2021-07-01 1:46 incoming Andrew Morton
@ 2021-07-03 0:28 ` Linus Torvalds
2021-07-03 1:06 ` incoming Linus Torvalds
0 siblings, 1 reply; 232+ messages in thread
From: Linus Torvalds @ 2021-07-03 0:28 UTC (permalink / raw)
To: Andrew Morton; +Cc: Linux-MM, mm-commits
On Wed, Jun 30, 2021 at 6:46 PM Andrew Morton <akpm@linux-foundation.org> wrote:
>
> This is the rest of the -mm tree, less 66 patches which are dependent on
> things which are (or were recently) in linux-next. I'll trickle that
> material over next week.
I haven't bisected this yet, but with the current -git I'm getting
watchdog: BUG: soft lockup - CPU#41 stuck for 49s!
and the common call chain seems to be in flush_tlb_mm_range ->
on_each_cpu_cond_mask.
Commit e058a84bfddc42ba356a2316f2cf1141974625c9 is good, and looking
at the pulls and merges I've done since, this -mm series looks like
the obvious culprit.
I'll go start bisection, but I thought I'd give a heads-up in case
somebody else has seen TLB-flush-related lockups and already figured
out the guilty party..
Linus
^ permalink raw reply [flat|nested] 232+ messages in thread
* Re: incoming
2021-07-03 0:28 ` incoming Linus Torvalds
@ 2021-07-03 1:06 ` Linus Torvalds
0 siblings, 0 replies; 232+ messages in thread
From: Linus Torvalds @ 2021-07-03 1:06 UTC (permalink / raw)
To: Andrew Morton; +Cc: Linux-MM, mm-commits
On Fri, Jul 2, 2021 at 5:28 PM Linus Torvalds
<torvalds@linux-foundation.org> wrote:
>
> Commit e058a84bfddc42ba356a2316f2cf1141974625c9 is good, and looking
> at the pulls and merges I've done since, this -mm series looks like
> the obvious culprit.
No, unless my bisection is wrong, the -mm branch is innocent, and was
discarded from the suspects on the very first bisection trial.
So never mind.
Linus
^ permalink raw reply [flat|nested] 232+ messages in thread
* incoming
@ 2021-07-08 0:59 Andrew Morton
0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2021-07-08 0:59 UTC (permalink / raw)
To: Linus Torvalds; +Cc: linux-mm, mm-commits
54 patches, based on a931dd33d370896a683236bba67c0d6f3d01144d.
Subsystems affected by this patch series:
lib
mm/slub
mm/secretmem
mm/cleanups
mm/init
debug
mm/pagemap
mm/mremap
Subsystem: lib
Zhen Lei <thunder.leizhen@huawei.com>:
lib/test: fix spelling mistakes
lib: fix spelling mistakes
lib: fix spelling mistakes in header files
Subsystem: mm/slub
Nathan Chancellor <nathan@kernel.org>:
Patch series "hexagon: Fix build error with CONFIG_STACKDEPOT and select CONFIG_ARCH_WANT_LD_ORPHAN_WARN":
hexagon: handle {,SOFT}IRQENTRY_TEXT in linker script
hexagon: use common DISCARDS macro
hexagon: select ARCH_WANT_LD_ORPHAN_WARN
Oliver Glitta <glittao@gmail.com>:
mm/slub: use stackdepot to save stack trace in objects
Subsystem: mm/secretmem
Mike Rapoport <rppt@linux.ibm.com>:
Patch series "mm: introduce memfd_secret system call to create "secret" memory areas", v20:
mmap: make mlock_future_check() global
riscv/Kconfig: make direct map manipulation options depend on MMU
set_memory: allow querying whether set_direct_map_*() is actually enabled
mm: introduce memfd_secret system call to create "secret" memory areas
PM: hibernate: disable when there are active secretmem users
arch, mm: wire up memfd_secret system call where relevant
secretmem: test: add basic selftest for memfd_secret(2)
Subsystem: mm/cleanups
Zhen Lei <thunder.leizhen@huawei.com>:
mm: fix spelling mistakes in header files
Subsystem: mm/init
Kefeng Wang <wangkefeng.wang@huawei.com>:
Patch series "init_mm: cleanup ARCH's text/data/brk setup code", v3:
mm: add setup_initial_init_mm() helper
arc: convert to setup_initial_init_mm()
arm: convert to setup_initial_init_mm()
arm64: convert to setup_initial_init_mm()
csky: convert to setup_initial_init_mm()
h8300: convert to setup_initial_init_mm()
m68k: convert to setup_initial_init_mm()
nds32: convert to setup_initial_init_mm()
nios2: convert to setup_initial_init_mm()
openrisc: convert to setup_initial_init_mm()
powerpc: convert to setup_initial_init_mm()
riscv: convert to setup_initial_init_mm()
s390: convert to setup_initial_init_mm()
sh: convert to setup_initial_init_mm()
x86: convert to setup_initial_init_mm()
Subsystem: debug
Stephen Boyd <swboyd@chromium.org>:
Patch series "Add build ID to stacktraces", v6:
buildid: only consider GNU notes for build ID parsing
buildid: add API to parse build ID out of buffer
buildid: stash away kernels build ID on init
dump_stack: add vmlinux build ID to stack traces
module: add printk formats to add module build ID to stacktraces
arm64: stacktrace: use %pSb for backtrace printing
x86/dumpstack: use %pSb/%pBb for backtrace printing
scripts/decode_stacktrace.sh: support debuginfod
scripts/decode_stacktrace.sh: silence stderr messages from addr2line/nm
scripts/decode_stacktrace.sh: indicate 'auto' can be used for base path
buildid: mark some arguments const
buildid: fix kernel-doc notation
kdump: use vmlinux_build_id to simplify
Subsystem: mm/pagemap
"Aneesh Kumar K.V" <aneesh.kumar@linux.ibm.com>:
mm: rename pud_page_vaddr to pud_pgtable and make it return pmd_t *
mm: rename p4d_page_vaddr to p4d_pgtable and make it return pud_t *
Subsystem: mm/mremap
"Aneesh Kumar K.V" <aneesh.kumar@linux.ibm.com>:
Patch series "mrermap fixes", v2:
selftest/mremap_test: update the test to handle pagesize other than 4K
selftest/mremap_test: avoid crash with static build
mm/mremap: convert huge PUD move to separate helper
mm/mremap: don't enable optimized PUD move if page table levels is 2
mm/mremap: use pmd/pud_poplulate to update page table entries
mm/mremap: hold the rmap lock in write mode when moving page table entries.
Patch series "Speedup mremap on ppc64", v8:
mm/mremap: allow arch runtime override
powerpc/book3s64/mm: update flush_tlb_range to flush page walk cache
powerpc/mm: enable HAVE_MOVE_PMD support
Documentation/core-api/printk-formats.rst | 11
arch/alpha/include/asm/pgtable.h | 8
arch/arc/mm/init.c | 5
arch/arm/include/asm/pgtable-3level.h | 2
arch/arm/kernel/setup.c | 5
arch/arm64/include/asm/Kbuild | 1
arch/arm64/include/asm/cacheflush.h | 6
arch/arm64/include/asm/kfence.h | 2
arch/arm64/include/asm/pgtable.h | 8
arch/arm64/include/asm/set_memory.h | 17 +
arch/arm64/include/uapi/asm/unistd.h | 1
arch/arm64/kernel/machine_kexec.c | 1
arch/arm64/kernel/setup.c | 5
arch/arm64/kernel/stacktrace.c | 2
arch/arm64/mm/mmu.c | 7
arch/arm64/mm/pageattr.c | 13
arch/csky/kernel/setup.c | 5
arch/h8300/kernel/setup.c | 5
arch/hexagon/Kconfig | 1
arch/hexagon/kernel/vmlinux.lds.S | 9
arch/ia64/include/asm/pgtable.h | 4
arch/m68k/include/asm/motorola_pgtable.h | 2
arch/m68k/kernel/setup_mm.c | 5
arch/m68k/kernel/setup_no.c | 5
arch/mips/include/asm/pgtable-64.h | 8
arch/nds32/kernel/setup.c | 5
arch/nios2/kernel/setup.c | 5
arch/openrisc/kernel/setup.c | 5
arch/parisc/include/asm/pgtable.h | 4
arch/powerpc/include/asm/book3s/64/pgtable.h | 11
arch/powerpc/include/asm/book3s/64/tlbflush-radix.h | 2
arch/powerpc/include/asm/nohash/64/pgtable-4k.h | 6
arch/powerpc/include/asm/nohash/64/pgtable.h | 6
arch/powerpc/include/asm/tlb.h | 6
arch/powerpc/kernel/setup-common.c | 5
arch/powerpc/mm/book3s64/radix_hugetlbpage.c | 8
arch/powerpc/mm/book3s64/radix_pgtable.c | 6
arch/powerpc/mm/book3s64/radix_tlb.c | 44 +-
arch/powerpc/mm/pgtable_64.c | 4
arch/powerpc/platforms/Kconfig.cputype | 2
arch/riscv/Kconfig | 4
arch/riscv/include/asm/pgtable-64.h | 4
arch/riscv/include/asm/unistd.h | 1
arch/riscv/kernel/setup.c | 5
arch/s390/kernel/setup.c | 5
arch/sh/include/asm/pgtable-3level.h | 4
arch/sh/kernel/setup.c | 5
arch/sparc/include/asm/pgtable_32.h | 6
arch/sparc/include/asm/pgtable_64.h | 10
arch/um/include/asm/pgtable-3level.h | 2
arch/x86/entry/syscalls/syscall_32.tbl | 1
arch/x86/entry/syscalls/syscall_64.tbl | 1
arch/x86/include/asm/pgtable.h | 8
arch/x86/kernel/dumpstack.c | 2
arch/x86/kernel/setup.c | 5
arch/x86/mm/init_64.c | 4
arch/x86/mm/pat/set_memory.c | 4
arch/x86/mm/pgtable.c | 2
include/asm-generic/pgtable-nop4d.h | 2
include/asm-generic/pgtable-nopmd.h | 2
include/asm-generic/pgtable-nopud.h | 4
include/linux/bootconfig.h | 4
include/linux/buildid.h | 10
include/linux/compaction.h | 4
include/linux/cpumask.h | 2
include/linux/crash_core.h | 12
include/linux/debugobjects.h | 2
include/linux/hmm.h | 2
include/linux/hugetlb.h | 6
include/linux/kallsyms.h | 21 +
include/linux/list_lru.h | 4
include/linux/lru_cache.h | 8
include/linux/mm.h | 3
include/linux/mmu_notifier.h | 8
include/linux/module.h | 9
include/linux/nodemask.h | 6
include/linux/percpu-defs.h | 2
include/linux/percpu-refcount.h | 2
include/linux/pgtable.h | 4
include/linux/scatterlist.h | 2
include/linux/secretmem.h | 54 +++
include/linux/set_memory.h | 12
include/linux/shrinker.h | 2
include/linux/syscalls.h | 1
include/linux/vmalloc.h | 4
include/uapi/asm-generic/unistd.h | 7
include/uapi/linux/magic.h | 1
init/Kconfig | 1
init/main.c | 2
kernel/crash_core.c | 50 ---
kernel/kallsyms.c | 104 +++++--
kernel/module.c | 42 ++
kernel/power/hibernate.c | 5
kernel/sys_ni.c | 2
lib/Kconfig.debug | 17 -
lib/asn1_encoder.c | 2
lib/buildid.c | 80 ++++-
lib/devres.c | 2
lib/dump_stack.c | 13
lib/dynamic_debug.c | 2
lib/fonts/font_pearl_8x8.c | 2
lib/kfifo.c | 2
lib/list_sort.c | 2
lib/nlattr.c | 4
lib/oid_registry.c | 2
lib/pldmfw/pldmfw.c | 2
lib/reed_solomon/test_rslib.c | 2
lib/refcount.c | 2
lib/rhashtable.c | 2
lib/sbitmap.c | 2
lib/scatterlist.c | 4
lib/seq_buf.c | 2
lib/sort.c | 2
lib/stackdepot.c | 2
lib/test_bitops.c | 2
lib/test_bpf.c | 2
lib/test_kasan.c | 2
lib/test_kmod.c | 6
lib/test_scanf.c | 2
lib/vsprintf.c | 10
mm/Kconfig | 4
mm/Makefile | 1
mm/gup.c | 12
mm/init-mm.c | 9
mm/internal.h | 3
mm/mlock.c | 3
mm/mmap.c | 5
mm/mremap.c | 108 ++++++-
mm/secretmem.c | 254 +++++++++++++++++
mm/slub.c | 79 +++--
scripts/checksyscalls.sh | 4
scripts/decode_stacktrace.sh | 89 +++++-
tools/testing/selftests/vm/.gitignore | 1
tools/testing/selftests/vm/Makefile | 3
tools/testing/selftests/vm/memfd_secret.c | 296 ++++++++++++++++++++
tools/testing/selftests/vm/mremap_test.c | 116 ++++---
tools/testing/selftests/vm/run_vmtests.sh | 17 +
137 files changed, 1470 insertions(+), 442 deletions(-)
^ permalink raw reply [flat|nested] 232+ messages in thread
* incoming
@ 2021-07-15 4:26 Andrew Morton
0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2021-07-15 4:26 UTC (permalink / raw)
To: Linus Torvalds; +Cc: linux-mm, mm-commits
13 patches, based on 40226a3d96ef8ab8980f032681c8bfd46d63874e.
Subsystems affected by this patch series:
mm/kasan
mm/pagealloc
mm/rmap
mm/hmm
hfs
mm/hugetlb
Subsystem: mm/kasan
Marco Elver <elver@google.com>:
mm: move helper to check slub_debug_enabled
Yee Lee <yee.lee@mediatek.com>:
kasan: add memzero init for unaligned size at DEBUG
Marco Elver <elver@google.com>:
kasan: fix build by including kernel.h
Subsystem: mm/pagealloc
Matteo Croce <mcroce@microsoft.com>:
Revert "mm/page_alloc: make should_fail_alloc_page() static"
Mel Gorman <mgorman@techsingularity.net>:
mm/page_alloc: avoid page allocator recursion with pagesets.lock held
Yanfei Xu <yanfei.xu@windriver.com>:
mm/page_alloc: correct return value when failing at preparing
Chuck Lever <chuck.lever@oracle.com>:
mm/page_alloc: further fix __alloc_pages_bulk() return value
Subsystem: mm/rmap
Christoph Hellwig <hch@lst.de>:
mm: fix the try_to_unmap prototype for !CONFIG_MMU
Subsystem: mm/hmm
Alistair Popple <apopple@nvidia.com>:
lib/test_hmm: remove set but unused page variable
Subsystem: hfs
Desmond Cheong Zhi Xi <desmondcheongzx@gmail.com>:
Patch series "hfs: fix various errors", v2:
hfs: add missing clean-up in hfs_fill_super
hfs: fix high memory mapping in hfs_bnode_read
hfs: add lock nesting notation to hfs_find_init
Subsystem: mm/hugetlb
Joao Martins <joao.m.martins@oracle.com>:
mm/hugetlb: fix refs calculation from unaligned @vaddr
fs/hfs/bfind.c | 14 +++++++++++++-
fs/hfs/bnode.c | 25 ++++++++++++++++++++-----
fs/hfs/btree.h | 7 +++++++
fs/hfs/super.c | 10 +++++-----
include/linux/kasan.h | 1 +
include/linux/rmap.h | 4 +++-
lib/test_hmm.c | 2 --
mm/hugetlb.c | 5 +++--
mm/kasan/kasan.h | 12 ++++++++++++
mm/page_alloc.c | 30 ++++++++++++++++++++++--------
mm/slab.h | 15 +++++++++++----
mm/slub.c | 14 --------------
12 files changed, 97 insertions(+), 42 deletions(-)
^ permalink raw reply [flat|nested] 232+ messages in thread
* incoming
@ 2021-07-23 22:49 Andrew Morton
0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2021-07-23 22:49 UTC (permalink / raw)
To: Linus Torvalds; +Cc: linux-mm, mm-commits
15 patches, based on 704f4cba43d4ed31ef4beb422313f1263d87bc55.
Subsystems affected by this patch series:
mm/userfaultfd
mm/kfence
mm/highmem
mm/pagealloc
mm/memblock
mm/pagecache
mm/secretmem
mm/pagemap
mm/hugetlbfs
Subsystem: mm/userfaultfd
Peter Collingbourne <pcc@google.com>:
Patch series "userfaultfd: do not untag user pointers", v5:
userfaultfd: do not untag user pointers
selftest: use mmap instead of posix_memalign to allocate memory
Subsystem: mm/kfence
Weizhao Ouyang <o451686892@gmail.com>:
kfence: defer kfence_test_init to ensure that kunit debugfs is created
Alexander Potapenko <glider@google.com>:
kfence: move the size check to the beginning of __kfence_alloc()
kfence: skip all GFP_ZONEMASK allocations
Subsystem: mm/highmem
Christoph Hellwig <hch@lst.de>:
mm: call flush_dcache_page() in memcpy_to_page() and memzero_page()
mm: use kmap_local_page in memzero_page
Subsystem: mm/pagealloc
Sergei Trofimovich <slyfox@gentoo.org>:
mm: page_alloc: fix page_poison=1 / INIT_ON_ALLOC_DEFAULT_ON interaction
Subsystem: mm/memblock
Mike Rapoport <rppt@linux.ibm.com>:
memblock: make for_each_mem_range() traverse MEMBLOCK_HOTPLUG regions
Subsystem: mm/pagecache
Roman Gushchin <guro@fb.com>:
writeback, cgroup: remove wb from offline list before releasing refcnt
writeback, cgroup: do not reparent dax inodes
Subsystem: mm/secretmem
Mike Rapoport <rppt@linux.ibm.com>:
mm/secretmem: wire up ->set_page_dirty
Subsystem: mm/pagemap
Muchun Song <songmuchun@bytedance.com>:
mm: mmap_lock: fix disabling preemption directly
Qi Zheng <zhengqi.arch@bytedance.com>:
mm: fix the deadlock in finish_fault()
Subsystem: mm/hugetlbfs
Mike Kravetz <mike.kravetz@oracle.com>:
hugetlbfs: fix mount mode command line processing
Documentation/arm64/tagged-address-abi.rst | 26 ++++++++++++++++++--------
fs/fs-writeback.c | 3 +++
fs/hugetlbfs/inode.c | 2 +-
fs/userfaultfd.c | 26 ++++++++++++--------------
include/linux/highmem.h | 6 ++++--
include/linux/memblock.h | 4 ++--
mm/backing-dev.c | 2 +-
mm/kfence/core.c | 19 ++++++++++++++++---
mm/kfence/kfence_test.c | 2 +-
mm/memblock.c | 3 ++-
mm/memory.c | 11 ++++++++++-
mm/mmap_lock.c | 4 ++--
mm/page_alloc.c | 29 ++++++++++++++++-------------
mm/secretmem.c | 1 +
tools/testing/selftests/vm/userfaultfd.c | 6 ++++--
15 files changed, 93 insertions(+), 51 deletions(-)
^ permalink raw reply [flat|nested] 232+ messages in thread
* incoming
@ 2021-07-29 21:52 Andrew Morton
0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2021-07-29 21:52 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm
7 patches, based on 7e96bf476270aecea66740a083e51b38c1371cd2.
Subsystems affected by this patch series:
lib
ocfs2
mm/memcg
mm/migration
mm/slub
mm/memcg
Subsystem: lib
Matteo Croce <mcroce@microsoft.com>:
lib/test_string.c: move string selftest in the Runtime Testing menu
Subsystem: ocfs2
Junxiao Bi <junxiao.bi@oracle.com>:
ocfs2: fix zero out valid data
ocfs2: issue zeroout to EOF blocks
Subsystem: mm/memcg
Johannes Weiner <hannes@cmpxchg.org>:
mm: memcontrol: fix blocking rstat function called from atomic cgroup1 thresholding code
Subsystem: mm/migration
"Aneesh Kumar K.V" <aneesh.kumar@linux.ibm.com>:
mm/migrate: fix NR_ISOLATED corruption on 64-bit
Subsystem: mm/slub
Shakeel Butt <shakeelb@google.com>:
slub: fix unreclaimable slab stat for bulk free
Subsystem: mm/memcg
Wang Hai <wanghai38@huawei.com>:
mm/memcg: fix NULL pointer dereference in memcg_slab_free_hook()
fs/ocfs2/file.c | 103 ++++++++++++++++++++++++++++++++----------------------
lib/Kconfig | 3 -
lib/Kconfig.debug | 3 +
mm/memcontrol.c | 3 +
mm/migrate.c | 2 -
mm/slab.h | 2 -
mm/slub.c | 22 ++++++-----
7 files changed, 81 insertions(+), 57 deletions(-)
^ permalink raw reply [flat|nested] 232+ messages in thread
* incoming
@ 2021-08-13 23:53 Andrew Morton
0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2021-08-13 23:53 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm
7 patches, based on f8e6dfc64f6135d1b6c5215c14cd30b9b60a0008.
Subsystems affected by this patch series:
mm/kasan
mm/slub
mm/madvise
mm/memcg
lib
Subsystem: mm/kasan
Kuan-Ying Lee <Kuan-Ying.Lee@mediatek.com>:
Patch series "kasan, slub: reset tag when printing address", v3:
kasan, kmemleak: reset tags when scanning block
kasan, slub: reset tag when printing address
Subsystem: mm/slub
Shakeel Butt <shakeelb@google.com>:
slub: fix kmalloc_pagealloc_invalid_free unit test
Vlastimil Babka <vbabka@suse.cz>:
mm: slub: fix slub_debug disabling for list of slabs
Subsystem: mm/madvise
David Hildenbrand <david@redhat.com>:
mm/madvise: report SIGBUS as -EFAULT for MADV_POPULATE_(READ|WRITE)
Subsystem: mm/memcg
Waiman Long <longman@redhat.com>:
mm/memcg: fix incorrect flushing of lruvec data in obj_stock
Subsystem: lib
Liang Wang <wangliang101@huawei.com>:
lib: use PFN_PHYS() in devmem_is_allowed()
lib/devmem_is_allowed.c | 2 +-
mm/gup.c | 7 +++++--
mm/kmemleak.c | 6 +++---
mm/madvise.c | 4 +++-
mm/memcontrol.c | 6 ++++--
mm/slub.c | 25 ++++++++++++++-----------
6 files changed, 30 insertions(+), 20 deletions(-)
^ permalink raw reply [flat|nested] 232+ messages in thread
* incoming
@ 2021-08-20 2:03 Andrew Morton
0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2021-08-20 2:03 UTC (permalink / raw)
To: Linus Torvalds; +Cc: linux-mm, mm-commits
10 patches, based on 614cb2751d3150850d459bee596c397f344a7936.
Subsystems affected by this patch series:
mm/shmem
mm/pagealloc
mm/tracing
MAINTAINERS
mm/memcg
mm/memory-failure
mm/vmscan
mm/kfence
mm/hugetlb
Subsystem: mm/shmem
Yang Shi <shy828301@gmail.com>:
Revert "mm/shmem: fix shmem_swapin() race with swapoff"
Revert "mm: swap: check if swap backing device is congested or not"
Subsystem: mm/pagealloc
Doug Berger <opendmb@gmail.com>:
mm/page_alloc: don't corrupt pcppage_migratetype
Subsystem: mm/tracing
Mike Rapoport <rppt@linux.ibm.com>:
mmflags.h: add missing __GFP_ZEROTAGS and __GFP_SKIP_KASAN_POISON names
Subsystem: MAINTAINERS
Nathan Chancellor <nathan@kernel.org>:
MAINTAINERS: update ClangBuiltLinux IRC chat
Subsystem: mm/memcg
Johannes Weiner <hannes@cmpxchg.org>:
mm: memcontrol: fix occasional OOMs due to proportional memory.low reclaim
Subsystem: mm/memory-failure
Naoya Horiguchi <naoya.horiguchi@nec.com>:
mm/hwpoison: retry with shake_page() for unhandlable pages
Subsystem: mm/vmscan
Johannes Weiner <hannes@cmpxchg.org>:
mm: vmscan: fix missing psi annotation for node_reclaim()
Subsystem: mm/kfence
Marco Elver <elver@google.com>:
kfence: fix is_kfence_address() for addresses below KFENCE_POOL_SIZE
Subsystem: mm/hugetlb
Mike Kravetz <mike.kravetz@oracle.com>:
hugetlb: don't pass page cache pages to restore_reserve_on_error
MAINTAINERS | 2 +-
include/linux/kfence.h | 7 ++++---
include/linux/memcontrol.h | 29 +++++++++++++++--------------
include/trace/events/mmflags.h | 4 +++-
mm/hugetlb.c | 19 ++++++++++++++-----
mm/memory-failure.c | 12 +++++++++---
mm/page_alloc.c | 25 ++++++++++++-------------
mm/shmem.c | 14 +-------------
mm/swap_state.c | 7 -------
mm/vmscan.c | 30 ++++++++++++++++++++++--------
10 files changed, 81 insertions(+), 68 deletions(-)
^ permalink raw reply [flat|nested] 232+ messages in thread
* incoming
@ 2021-08-25 19:17 Andrew Morton
0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2021-08-25 19:17 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm
2 patches, based on 6e764bcd1cf72a2846c0e53d3975a09b242c04c9.
Subsystems affected by this patch series:
mm/memory-hotplug
MAINTAINERS
Subsystem: mm/memory-hotplug
Miaohe Lin <linmiaohe@huawei.com>:
mm/memory_hotplug: fix potential permanent lru cache disable
Subsystem: MAINTAINERS
Namjae Jeon <namjae.jeon@samsung.com>:
MAINTAINERS: exfat: update my email address
MAINTAINERS | 2 +-
mm/memory_hotplug.c | 1 +
2 files changed, 2 insertions(+), 1 deletion(-)
^ permalink raw reply [flat|nested] 232+ messages in thread
* incoming
@ 2021-09-02 21:48 Andrew Morton
2021-09-02 21:49 ` incoming Andrew Morton
0 siblings, 1 reply; 232+ messages in thread
From: Andrew Morton @ 2021-09-02 21:48 UTC (permalink / raw)
To: Linus Torvalds; +Cc: linux-mm, mm-commits
212 patches, based on 4a3bb4200a5958d76cc26ebe4db4257efa56812b.
Subsystems affected by this patch series:
ia64
ocfs2
block
mm/slub
mm/debug
mm/pagecache
mm/gup
mm/swap
mm/shmem
mm/memcg
mm/selftests
mm/pagemap
mm/mremap
mm/bootmem
mm/sparsemem
mm/vmalloc
mm/kasan
mm/pagealloc
mm/memory-failure
mm/hugetlb
mm/userfaultfd
mm/vmscan
mm/compaction
mm/mempolicy
mm/memblock
mm/oom-kill
mm/migration
mm/ksm
mm/percpu
mm/vmstat
mm/madvise
Subsystem: ia64
Jason Wang <wangborong@cdjrlc.com>:
ia64: fix typo in a comment
Geert Uytterhoeven <geert+renesas@glider.be>:
Patch series "ia64: Miscellaneous fixes and cleanups":
ia64: fix #endif comment for reserve_elfcorehdr()
ia64: make reserve_elfcorehdr() static
ia64: make num_rsvd_regions static
Subsystem: ocfs2
Dan Carpenter <dan.carpenter@oracle.com>:
ocfs2: remove an unnecessary condition
Tuo Li <islituo@gmail.com>:
ocfs2: quota_local: fix possible uninitialized-variable access in ocfs2_local_read_info()
Gang He <ghe@suse.com>:
ocfs2: ocfs2_downconvert_lock failure results in deadlock
Subsystem: block
kernel test robot <lkp@intel.com>:
arch/csky/kernel/probes/kprobes.c: fix bugon.cocci warnings
Subsystem: mm/slub
Vlastimil Babka <vbabka@suse.cz>:
Patch series "SLUB: reduce irq disabled scope and make it RT compatible", v4:
mm, slub: don't call flush_all() from slab_debug_trace_open()
mm, slub: allocate private object map for debugfs listings
mm, slub: allocate private object map for validate_slab_cache()
mm, slub: don't disable irq for debug_check_no_locks_freed()
mm, slub: remove redundant unfreeze_partials() from put_cpu_partial()
mm, slub: unify cmpxchg_double_slab() and __cmpxchg_double_slab()
mm, slub: extract get_partial() from new_slab_objects()
mm, slub: dissolve new_slab_objects() into ___slab_alloc()
mm, slub: return slab page from get_partial() and set c->page afterwards
mm, slub: restructure new page checks in ___slab_alloc()
mm, slub: simplify kmem_cache_cpu and tid setup
mm, slub: move disabling/enabling irqs to ___slab_alloc()
mm, slub: do initial checks in ___slab_alloc() with irqs enabled
mm, slub: move disabling irqs closer to get_partial() in ___slab_alloc()
mm, slub: restore irqs around calling new_slab()
mm, slub: validate slab from partial list or page allocator before making it cpu slab
mm, slub: check new pages with restored irqs
mm, slub: stop disabling irqs around get_partial()
mm, slub: move reset of c->page and freelist out of deactivate_slab()
mm, slub: make locking in deactivate_slab() irq-safe
mm, slub: call deactivate_slab() without disabling irqs
mm, slub: move irq control into unfreeze_partials()
mm, slub: discard slabs in unfreeze_partials() without irqs disabled
mm, slub: detach whole partial list at once in unfreeze_partials()
mm, slub: separate detaching of partial list in unfreeze_partials() from unfreezing
mm, slub: only disable irq with spin_lock in __unfreeze_partials()
mm, slub: don't disable irqs in slub_cpu_dead()
mm, slab: make flush_slab() possible to call with irqs enabled
Sebastian Andrzej Siewior <bigeasy@linutronix.de>:
mm: slub: move flush_cpu_slab() invocations __free_slab() invocations out of IRQ context
mm: slub: make object_map_lock a raw_spinlock_t
Vlastimil Babka <vbabka@suse.cz>:
mm, slub: optionally save/restore irqs in slab_[un]lock()/
mm, slub: make slab_lock() disable irqs with PREEMPT_RT
mm, slub: protect put_cpu_partial() with disabled irqs instead of cmpxchg
mm, slub: use migrate_disable() on PREEMPT_RT
mm, slub: convert kmem_cpu_slab protection to local_lock
Subsystem: mm/debug
Gavin Shan <gshan@redhat.com>:
Patch series "mm/debug_vm_pgtable: Enhancements", v6:
mm/debug_vm_pgtable: introduce struct pgtable_debug_args
mm/debug_vm_pgtable: use struct pgtable_debug_args in basic tests
mm/debug_vm_pgtable: use struct pgtable_debug_args in leaf and savewrite tests
mm/debug_vm_pgtable: use struct pgtable_debug_args in protnone and devmap tests
mm/debug_vm_pgtable: use struct pgtable_debug_args in soft_dirty and swap tests
mm/debug_vm_pgtable: use struct pgtable_debug_args in migration and thp tests
mm/debug_vm_pgtable: use struct pgtable_debug_args in PTE modifying tests
mm/debug_vm_pgtable: use struct pgtable_debug_args in PMD modifying tests
mm/debug_vm_pgtable: use struct pgtable_debug_args in PUD modifying tests
mm/debug_vm_pgtable: use struct pgtable_debug_args in PGD and P4D modifying tests
mm/debug_vm_pgtable: remove unused code
mm/debug_vm_pgtable: fix corrupted page flag
"Matthew Wilcox (Oracle)" <willy@infradead.org>:
mm: report a more useful address for reclaim acquisition
liuhailong <liuhailong@oppo.com>:
mm: add kernel_misc_reclaimable in show_free_areas
Subsystem: mm/pagecache
Jan Kara <jack@suse.cz>:
Patch series "writeback: Fix bandwidth estimates", v4:
writeback: track number of inodes under writeback
writeback: reliably update bandwidth estimation
writeback: fix bandwidth estimate for spiky workload
writeback: rename domain_update_bandwidth()
writeback: use READ_ONCE for unlocked reads of writeback stats
Johannes Weiner <hannes@cmpxchg.org>:
mm: remove irqsave/restore locking from contexts with irqs enabled
fs: drop_caches: fix skipping over shadow cache inodes
fs: inode: count invalidated shadow pages in pginodesteal
Shakeel Butt <shakeelb@google.com>:
writeback: memcg: simplify cgroup_writeback_by_id
Jing Yangyang <jing.yangyang@zte.com.cn>:
include/linux/buffer_head.h: fix boolreturn.cocci warnings
Subsystem: mm/gup
Miaohe Lin <linmiaohe@huawei.com>:
Patch series "Cleanups and fixup for gup":
mm: gup: remove set but unused local variable major
mm: gup: remove unneed local variable orig_refs
mm: gup: remove useless BUG_ON in __get_user_pages()
mm: gup: fix potential pgmap refcnt leak in __gup_device_huge()
mm: gup: use helper PAGE_ALIGNED in populate_vma_page_range()
John Hubbard <jhubbard@nvidia.com>:
Patch series "A few gup refactorings and documentation updates", v3:
mm/gup: documentation corrections for gup/pup
mm/gup: small refactoring: simplify try_grab_page()
mm/gup: remove try_get_page(), call try_get_compound_head() directly
Subsystem: mm/swap
Hugh Dickins <hughd@google.com>:
fs, mm: fix race in unlinking swapfile
John Hubbard <jhubbard@nvidia.com>:
mm: delete unused get_kernel_page()
Subsystem: mm/shmem
Sebastian Andrzej Siewior <bigeasy@linutronix.de>:
shmem: use raw_spinlock_t for ->stat_lock
Miaohe Lin <linmiaohe@huawei.com>:
Patch series "Cleanups for shmem":
shmem: remove unneeded variable ret
shmem: remove unneeded header file
shmem: remove unneeded function forward declaration
shmem: include header file to declare swap_info
Hugh Dickins <hughd@google.com>:
Patch series "huge tmpfs: shmem_is_huge() fixes and cleanups":
huge tmpfs: fix fallocate(vanilla) advance over huge pages
huge tmpfs: fix split_huge_page() after FALLOC_FL_KEEP_SIZE
huge tmpfs: remove shrinklist addition from shmem_setattr()
huge tmpfs: revert shmem's use of transhuge_vma_enabled()
huge tmpfs: move shmem_huge_enabled() upwards
huge tmpfs: SGP_NOALLOC to stop collapse_file() on race
huge tmpfs: shmem_is_huge(vma, inode, index)
huge tmpfs: decide stat.st_blksize by shmem_is_huge()
shmem: shmem_writepage() split unlikely i915 THP
Subsystem: mm/memcg
Suren Baghdasaryan <surenb@google.com>:
mm, memcg: add mem_cgroup_disabled checks in vmpressure and swap-related functions
mm, memcg: inline mem_cgroup_{charge/uncharge} to improve disabled memcg config
mm, memcg: inline swap-related functions to improve disabled memcg config
Vasily Averin <vvs@virtuozzo.com>:
memcg: enable accounting for pids in nested pid namespaces
Shakeel Butt <shakeelb@google.com>:
memcg: switch lruvec stats to rstat
memcg: infrastructure to flush memcg stats
Yutian Yang <nglaive@gmail.com>:
memcg: charge fs_context and legacy_fs_context
Vasily Averin <vvs@virtuozzo.com>:
Patch series "memcg accounting from OpenVZ", v7:
memcg: enable accounting for mnt_cache entries
memcg: enable accounting for pollfd and select bits arrays
memcg: enable accounting for file lock caches
memcg: enable accounting for fasync_cache
memcg: enable accounting for new namesapces and struct nsproxy
memcg: enable accounting of ipc resources
memcg: enable accounting for signals
memcg: enable accounting for posix_timers_cache slab
memcg: enable accounting for ldt_struct objects
Shakeel Butt <shakeelb@google.com>:
memcg: cleanup racy sum avoidance code
Vasily Averin <vvs@virtuozzo.com>:
memcg: replace in_interrupt() by !in_task() in active_memcg()
Baolin Wang <baolin.wang@linux.alibaba.com>:
mm: memcontrol: set the correct memcg swappiness restriction
Miaohe Lin <linmiaohe@huawei.com>:
mm, memcg: remove unused functions
mm, memcg: save some atomic ops when flush is already true
Michal Hocko <mhocko@suse.com>:
memcg: fix up drain_local_stock comment
Shakeel Butt <shakeelb@google.com>:
memcg: make memcg->event_list_lock irqsafe
Subsystem: mm/selftests
Po-Hsu Lin <po-hsu.lin@canonical.com>:
selftests/vm: use kselftest skip code for skipped tests
Colin Ian King <colin.king@canonical.com>:
selftests: Fix spelling mistake "cann't" -> "cannot"
Subsystem: mm/pagemap
Nicholas Piggin <npiggin@gmail.com>:
Patch series "shoot lazy tlbs", v4:
lazy tlb: introduce lazy mm refcount helper functions
lazy tlb: allow lazy tlb mm refcounting to be configurable
lazy tlb: shoot lazies, a non-refcounting lazy tlb option
powerpc/64s: enable MMU_LAZY_TLB_SHOOTDOWN
Christoph Hellwig <hch@lst.de>:
Patch series "_kernel_dcache_page fixes and removal":
mmc: JZ4740: remove the flush_kernel_dcache_page call in jz4740_mmc_read_data
mmc: mmc_spi: replace flush_kernel_dcache_page with flush_dcache_page
scatterlist: replace flush_kernel_dcache_page with flush_dcache_page
mm: remove flush_kernel_dcache_page
Huang Ying <ying.huang@intel.com>:
mm,do_huge_pmd_numa_page: remove unnecessary TLB flushing code
Greg Kroah-Hartman <gregkh@linuxfoundation.org>:
mm: change fault_in_pages_* to have an unsigned size parameter
Luigi Rizzo <lrizzo@google.com>:
mm/pagemap: add mmap_assert_locked() annotations to find_vma*()
"Liam R. Howlett" <Liam.Howlett@Oracle.com>:
remap_file_pages: Use vma_lookup() instead of find_vma()
Subsystem: mm/mremap
Chen Wandun <chenwandun@huawei.com>:
mm/mremap: fix memory account on do_munmap() failure
Subsystem: mm/bootmem
Muchun Song <songmuchun@bytedance.com>:
mm/bootmem_info.c: mark __init on register_page_bootmem_info_section
Subsystem: mm/sparsemem
Ohhoon Kwon <ohoono.kwon@samsung.com>:
Patch series "mm: sparse: remove __section_nr() function", v4:
mm: sparse: pass section_nr to section_mark_present
mm: sparse: pass section_nr to find_memory_block
mm: sparse: remove __section_nr() function
Naoya Horiguchi <naoya.horiguchi@nec.com>:
mm/sparse: set SECTION_NID_SHIFT to 6
Matthew Wilcox <willy@infradead.org>:
include/linux/mmzone.h: avoid a warning in sparse memory support
Miles Chen <miles.chen@mediatek.com>:
mm/sparse: clarify pgdat_to_phys
Subsystem: mm/vmalloc
"Uladzislau Rezki (Sony)" <urezki@gmail.com>:
mm/vmalloc: use batched page requests in bulk-allocator
mm/vmalloc: remove gfpflags_allow_blocking() check
lib/test_vmalloc.c: add a new 'nr_pages' parameter
Chen Wandun <chenwandun@huawei.com>:
mm/vmalloc: fix wrong behavior in vread
Subsystem: mm/kasan
Woody Lin <woodylin@google.com>:
mm/kasan: move kasan.fault to mm/kasan/report.c
Andrey Konovalov <andreyknvl@gmail.com>:
Patch series "kasan: test: avoid crashing the kernel with HW_TAGS", v2:
kasan: test: rework kmalloc_oob_right
kasan: test: avoid writing invalid memory
kasan: test: avoid corrupting memory via memset
kasan: test: disable kmalloc_memmove_invalid_size for HW_TAGS
kasan: test: only do kmalloc_uaf_memset for generic mode
kasan: test: clean up ksize_uaf
kasan: test: avoid corrupting memory in copy_user_test
kasan: test: avoid corrupting memory in kasan_rcu_uaf
Subsystem: mm/pagealloc
Mike Rapoport <rppt@linux.ibm.com>:
Patch series "mm: ensure consistency of memory map poisoning":
mm/page_alloc: always initialize memory map for the holes
microblaze: simplify pte_alloc_one_kernel()
mm: introduce memmap_alloc() to unify memory map allocation
memblock: stop poisoning raw allocations
Nico Pache <npache@redhat.com>:
mm/page_alloc.c: fix 'zone_id' may be used uninitialized in this function warning
Mike Rapoport <rppt@linux.ibm.com>:
mm/page_alloc: make alloc_node_mem_map() __init rather than __ref
Vasily Averin <vvs@virtuozzo.com>:
mm/page_alloc.c: use in_task()
"George G. Davis" <davis.george@siemens.com>:
mm/page_isolation: tracing: trace all test_pages_isolated failures
Subsystem: mm/memory-failure
Miaohe Lin <linmiaohe@huawei.com>:
Patch series "Cleanups and fixup for hwpoison":
mm/hwpoison: remove unneeded variable unmap_success
mm/hwpoison: fix potential pte_unmap_unlock pte error
mm/hwpoison: change argument struct page **hpagep to *hpage
mm/hwpoison: fix some obsolete comments
Yang Shi <shy828301@gmail.com>:
mm: hwpoison: don't drop slab caches for offlining non-LRU page
doc: hwpoison: correct the support for hugepage
mm: hwpoison: dump page for unhandlable page
Michael Wang <yun.wang@linux.alibaba.com>:
mm: fix panic caused by __page_handle_poison()
Subsystem: mm/hugetlb
Mike Kravetz <mike.kravetz@oracle.com>:
hugetlb: simplify prep_compound_gigantic_page ref count racing code
hugetlb: drop ref count earlier after page allocation
hugetlb: before freeing hugetlb page set dtor to appropriate value
hugetlb: fix hugetlb cgroup refcounting during vma split
Subsystem: mm/userfaultfd
Nadav Amit <namit@vmware.com>:
Patch series "userfaultfd: minor bug fixes":
userfaultfd: change mmap_changing to atomic
userfaultfd: prevent concurrent API initialization
selftests/vm/userfaultfd: wake after copy failure
Subsystem: mm/vmscan
Dave Hansen <dave.hansen@linux.intel.com>:
Patch series "Migrate Pages in lieu of discard", v11:
mm/numa: automatically generate node migration order
mm/migrate: update node demotion order on hotplug events
Yang Shi <yang.shi@linux.alibaba.com>:
mm/migrate: enable returning precise migrate_pages() success count
Dave Hansen <dave.hansen@linux.intel.com>:
mm/migrate: demote pages during reclaim
Yang Shi <yang.shi@linux.alibaba.com>:
mm/vmscan: add page demotion counter
Dave Hansen <dave.hansen@linux.intel.com>:
mm/vmscan: add helper for querying ability to age anonymous pages
Keith Busch <kbusch@kernel.org>:
mm/vmscan: Consider anonymous pages without swap
Dave Hansen <dave.hansen@linux.intel.com>:
mm/vmscan: never demote for memcg reclaim
Huang Ying <ying.huang@intel.com>:
mm/migrate: add sysfs interface to enable reclaim migration
Hui Su <suhui@zeku.com>:
mm/vmpressure: replace vmpressure_to_css() with vmpressure_to_memcg()
Miaohe Lin <linmiaohe@huawei.com>:
Patch series "Cleanups for vmscan", v2:
mm/vmscan: remove the PageDirty check after MADV_FREE pages are page_ref_freezed
mm/vmscan: remove misleading setting to sc->priority
mm/vmscan: remove unneeded return value of kswapd_run()
mm/vmscan: add 'else' to remove check_pending label
Vlastimil Babka <vbabka@suse.cz>:
mm, vmscan: guarantee drop_slab_node() termination
Subsystem: mm/compaction
Charan Teja Reddy <charante@codeaurora.org>:
mm: compaction: optimize proactive compaction deferrals
mm: compaction: support triggering of proactive compaction by user
Subsystem: mm/mempolicy
Baolin Wang <baolin.wang@linux.alibaba.com>:
mm/mempolicy: use readable NUMA_NO_NODE macro instead of magic number
Dave Hansen <dave.hansen@linux.intel.com>:
Patch series "Introduce multi-preference mempolicy", v7:
mm/mempolicy: add MPOL_PREFERRED_MANY for multiple preferred nodes
Feng Tang <feng.tang@intel.com>:
mm/memplicy: add page allocation function for MPOL_PREFERRED_MANY policy
Ben Widawsky <ben.widawsky@intel.com>:
mm/hugetlb: add support for mempolicy MPOL_PREFERRED_MANY
mm/mempolicy: advertise new MPOL_PREFERRED_MANY
Feng Tang <feng.tang@intel.com>:
mm/mempolicy: unify the create() func for bind/interleave/prefer-many policies
Vasily Averin <vvs@virtuozzo.com>:
mm/mempolicy.c: use in_task() in mempolicy_slab_node()
Subsystem: mm/memblock
Mike Rapoport <rppt@linux.ibm.com>:
memblock: make memblock_find_in_range method private
Subsystem: mm/oom-kill
Suren Baghdasaryan <surenb@google.com>:
mm: introduce process_mrelease system call
mm: wire up syscall process_mrelease
Subsystem: mm/migration
Randy Dunlap <rdunlap@infradead.org>:
mm/migrate: correct kernel-doc notation
Subsystem: mm/ksm
Zhansaya Bagdauletkyzy <zhansayabagdaulet@gmail.com>:
Patch series "add KSM selftests":
selftests: vm: add KSM merge test
selftests: vm: add KSM unmerge test
selftests: vm: add KSM zero page merging test
selftests: vm: add KSM merging across nodes test
mm: KSM: fix data type
Patch series "add KSM performance tests", v3:
selftests: vm: add KSM merging time test
selftests: vm: add COW time test for KSM pages
Subsystem: mm/percpu
Jing Xiangfeng <jingxiangfeng@huawei.com>:
mm/percpu,c: remove obsolete comments of pcpu_chunk_populated()
Subsystem: mm/vmstat
Miaohe Lin <linmiaohe@huawei.com>:
Patch series "Cleanup for vmstat":
mm/vmstat: correct some wrong comments
mm/vmstat: simplify the array size calculation
mm/vmstat: remove unneeded return value
Subsystem: mm/madvise
zhangkui <zhangkui@oppo.com>:
mm/madvise: add MADV_WILLNEED to process_madvise()
Documentation/ABI/testing/sysfs-kernel-mm-numa | 24
Documentation/admin-guide/mm/numa_memory_policy.rst | 15
Documentation/admin-guide/sysctl/vm.rst | 3
Documentation/core-api/cachetlb.rst | 86 -
Documentation/dev-tools/kasan.rst | 13
Documentation/translations/zh_CN/core-api/cachetlb.rst | 9
Documentation/vm/hwpoison.rst | 1
arch/Kconfig | 28
arch/alpha/kernel/syscalls/syscall.tbl | 2
arch/arm/include/asm/cacheflush.h | 4
arch/arm/kernel/setup.c | 20
arch/arm/mach-rpc/ecard.c | 2
arch/arm/mm/flush.c | 33
arch/arm/mm/nommu.c | 6
arch/arm/tools/syscall.tbl | 2
arch/arm64/include/asm/unistd.h | 2
arch/arm64/include/asm/unistd32.h | 2
arch/arm64/kvm/hyp/reserved_mem.c | 9
arch/arm64/mm/init.c | 38
arch/csky/abiv1/cacheflush.c | 11
arch/csky/abiv1/inc/abi/cacheflush.h | 4
arch/csky/kernel/probes/kprobes.c | 3
arch/ia64/include/asm/meminit.h | 2
arch/ia64/kernel/acpi.c | 2
arch/ia64/kernel/setup.c | 55
arch/ia64/kernel/syscalls/syscall.tbl | 2
arch/m68k/kernel/syscalls/syscall.tbl | 2
arch/microblaze/include/asm/page.h | 3
arch/microblaze/include/asm/pgtable.h | 2
arch/microblaze/kernel/syscalls/syscall.tbl | 2
arch/microblaze/mm/init.c | 12
arch/microblaze/mm/pgtable.c | 17
arch/mips/include/asm/cacheflush.h | 8
arch/mips/kernel/setup.c | 14
arch/mips/kernel/syscalls/syscall_n32.tbl | 2
arch/mips/kernel/syscalls/syscall_n64.tbl | 2
arch/mips/kernel/syscalls/syscall_o32.tbl | 2
arch/nds32/include/asm/cacheflush.h | 3
arch/nds32/mm/cacheflush.c | 9
arch/parisc/include/asm/cacheflush.h | 8
arch/parisc/kernel/cache.c | 3
arch/parisc/kernel/syscalls/syscall.tbl | 2
arch/powerpc/Kconfig | 1
arch/powerpc/kernel/smp.c | 2
arch/powerpc/kernel/syscalls/syscall.tbl | 2
arch/powerpc/mm/book3s64/radix_tlb.c | 4
arch/powerpc/platforms/pseries/hotplug-memory.c | 4
arch/riscv/mm/init.c | 44
arch/s390/kernel/setup.c | 9
arch/s390/kernel/syscalls/syscall.tbl | 2
arch/s390/mm/fault.c | 2
arch/sh/include/asm/cacheflush.h | 8
arch/sh/kernel/syscalls/syscall.tbl | 2
arch/sparc/kernel/syscalls/syscall.tbl | 2
arch/x86/entry/syscalls/syscall_32.tbl | 1
arch/x86/entry/syscalls/syscall_64.tbl | 1
arch/x86/kernel/aperture_64.c | 5
arch/x86/kernel/ldt.c | 6
arch/x86/mm/init.c | 23
arch/x86/mm/numa.c | 5
arch/x86/mm/numa_emulation.c | 5
arch/x86/realmode/init.c | 2
arch/xtensa/kernel/syscalls/syscall.tbl | 2
block/blk-map.c | 2
drivers/acpi/tables.c | 5
drivers/base/arch_numa.c | 5
drivers/base/memory.c | 4
drivers/mmc/host/jz4740_mmc.c | 4
drivers/mmc/host/mmc_spi.c | 2
drivers/of/of_reserved_mem.c | 12
fs/drop_caches.c | 3
fs/exec.c | 12
fs/fcntl.c | 3
fs/fs-writeback.c | 28
fs/fs_context.c | 4
fs/inode.c | 2
fs/locks.c | 6
fs/namei.c | 8
fs/namespace.c | 7
fs/ocfs2/dlmglue.c | 14
fs/ocfs2/quota_global.c | 1
fs/ocfs2/quota_local.c | 2
fs/pipe.c | 2
fs/select.c | 4
fs/userfaultfd.c | 116 -
include/linux/backing-dev-defs.h | 2
include/linux/backing-dev.h | 19
include/linux/buffer_head.h | 2
include/linux/compaction.h | 2
include/linux/highmem.h | 5
include/linux/hugetlb_cgroup.h | 12
include/linux/memblock.h | 2
include/linux/memcontrol.h | 118 +
include/linux/memory.h | 2
include/linux/mempolicy.h | 16
include/linux/migrate.h | 14
include/linux/mm.h | 17
include/linux/mmzone.h | 4
include/linux/page-flags.h | 9
include/linux/pagemap.h | 4
include/linux/sched/mm.h | 35
include/linux/shmem_fs.h | 25
include/linux/slub_def.h | 6
include/linux/swap.h | 28
include/linux/syscalls.h | 1
include/linux/userfaultfd_k.h | 8
include/linux/vm_event_item.h | 2
include/linux/vmpressure.h | 2
include/linux/writeback.h | 4
include/trace/events/migrate.h | 3
include/uapi/asm-generic/unistd.h | 4
include/uapi/linux/mempolicy.h | 1
ipc/msg.c | 2
ipc/namespace.c | 2
ipc/sem.c | 9
ipc/shm.c | 2
kernel/cgroup/namespace.c | 2
kernel/cpu.c | 2
kernel/exit.c | 2
kernel/fork.c | 51
kernel/kthread.c | 21
kernel/nsproxy.c | 2
kernel/pid_namespace.c | 5
kernel/sched/core.c | 37
kernel/sched/sched.h | 4
kernel/signal.c | 2
kernel/sys_ni.c | 1
kernel/sysctl.c | 2
kernel/time/namespace.c | 4
kernel/time/posix-timers.c | 4
kernel/user_namespace.c | 2
lib/scatterlist.c | 5
lib/test_kasan.c | 80 -
lib/test_kasan_module.c | 20
lib/test_vmalloc.c | 5
mm/backing-dev.c | 11
mm/bootmem_info.c | 4
mm/compaction.c | 69 -
mm/debug_vm_pgtable.c | 982 +++++++++------
mm/filemap.c | 15
mm/gup.c | 109 -
mm/huge_memory.c | 32
mm/hugetlb.c | 173 ++
mm/hwpoison-inject.c | 2
mm/internal.h | 9
mm/kasan/hw_tags.c | 43
mm/kasan/kasan.h | 1
mm/kasan/report.c | 29
mm/khugepaged.c | 2
mm/ksm.c | 8
mm/madvise.c | 1
mm/memblock.c | 22
mm/memcontrol.c | 234 +--
mm/memory-failure.c | 53
mm/memory_hotplug.c | 2
mm/mempolicy.c | 207 ++-
mm/migrate.c | 319 ++++
mm/mmap.c | 7
mm/mremap.c | 2
mm/oom_kill.c | 70 +
mm/page-writeback.c | 133 +-
mm/page_alloc.c | 62
mm/page_isolation.c | 13
mm/percpu.c | 3
mm/shmem.c | 309 ++--
mm/slab_common.c | 2
mm/slub.c | 1085 ++++++++++-------
mm/sparse.c | 46
mm/swap.c | 22
mm/swapfile.c | 14
mm/truncate.c | 28
mm/userfaultfd.c | 15
mm/vmalloc.c | 79 -
mm/vmpressure.c | 10
mm/vmscan.c | 220 ++-
mm/vmstat.c | 25
security/tomoyo/domain.c | 13
tools/testing/scatterlist/linux/mm.h | 1
tools/testing/selftests/vm/.gitignore | 1
tools/testing/selftests/vm/Makefile | 3
tools/testing/selftests/vm/charge_reserved_hugetlb.sh | 5
tools/testing/selftests/vm/hugetlb_reparenting_test.sh | 5
tools/testing/selftests/vm/ksm_tests.c | 696 ++++++++++
tools/testing/selftests/vm/mlock-random-test.c | 2
tools/testing/selftests/vm/run_vmtests.sh | 98 +
tools/testing/selftests/vm/userfaultfd.c | 13
186 files changed, 4488 insertions(+), 2281 deletions(-)
^ permalink raw reply [flat|nested] 232+ messages in thread
* Re: incoming
2021-09-02 21:48 incoming Andrew Morton
@ 2021-09-02 21:49 ` Andrew Morton
0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2021-09-02 21:49 UTC (permalink / raw)
To: Linus Torvalds, linux-mm, mm-commits
On Thu, 2 Sep 2021 14:48:20 -0700 Andrew Morton <akpm@linux-foundation.org> wrote:
> 212 patches, based on 4a3bb4200a5958d76cc26ebe4db4257efa56812b.
Make that "based on 7d2a07b769330c34b4deabeed939325c77a7ec2f".
^ permalink raw reply [flat|nested] 232+ messages in thread
* incoming
@ 2021-09-08 2:52 Andrew Morton
2021-09-08 8:57 ` incoming Vlastimil Babka
0 siblings, 1 reply; 232+ messages in thread
From: Andrew Morton @ 2021-09-08 2:52 UTC (permalink / raw)
To: Linus Torvalds; +Cc: linux-mm, mm-commits
147 patches, based on 7d2a07b769330c34b4deabeed939325c77a7ec2f.
Subsystems affected by this patch series:
mm/slub
mm/memory-hotplug
mm/rmap
mm/ioremap
mm/highmem
mm/cleanups
mm/secretmem
mm/kfence
mm/damon
alpha
percpu
procfs
misc
core-kernel
MAINTAINERS
lib
bitops
checkpatch
epoll
init
nilfs2
coredump
fork
pids
criu
kconfig
selftests
ipc
mm/vmscan
scripts
Subsystem: mm/slub
Vlastimil Babka <vbabka@suse.cz>:
Patch series "SLUB: reduce irq disabled scope and make it RT compatible", v6:
mm, slub: don't call flush_all() from slab_debug_trace_open()
mm, slub: allocate private object map for debugfs listings
mm, slub: allocate private object map for validate_slab_cache()
mm, slub: don't disable irq for debug_check_no_locks_freed()
mm, slub: remove redundant unfreeze_partials() from put_cpu_partial()
mm, slub: extract get_partial() from new_slab_objects()
mm, slub: dissolve new_slab_objects() into ___slab_alloc()
mm, slub: return slab page from get_partial() and set c->page afterwards
mm, slub: restructure new page checks in ___slab_alloc()
mm, slub: simplify kmem_cache_cpu and tid setup
mm, slub: move disabling/enabling irqs to ___slab_alloc()
mm, slub: do initial checks in ___slab_alloc() with irqs enabled
mm, slub: move disabling irqs closer to get_partial() in ___slab_alloc()
mm, slub: restore irqs around calling new_slab()
mm, slub: validate slab from partial list or page allocator before making it cpu slab
mm, slub: check new pages with restored irqs
mm, slub: stop disabling irqs around get_partial()
mm, slub: move reset of c->page and freelist out of deactivate_slab()
mm, slub: make locking in deactivate_slab() irq-safe
mm, slub: call deactivate_slab() without disabling irqs
mm, slub: move irq control into unfreeze_partials()
mm, slub: discard slabs in unfreeze_partials() without irqs disabled
mm, slub: detach whole partial list at once in unfreeze_partials()
mm, slub: separate detaching of partial list in unfreeze_partials() from unfreezing
mm, slub: only disable irq with spin_lock in __unfreeze_partials()
mm, slub: don't disable irqs in slub_cpu_dead()
mm, slab: split out the cpu offline variant of flush_slab()
Sebastian Andrzej Siewior <bigeasy@linutronix.de>:
mm: slub: move flush_cpu_slab() invocations __free_slab() invocations out of IRQ context
mm: slub: make object_map_lock a raw_spinlock_t
Vlastimil Babka <vbabka@suse.cz>:
mm, slub: make slab_lock() disable irqs with PREEMPT_RT
mm, slub: protect put_cpu_partial() with disabled irqs instead of cmpxchg
mm, slub: use migrate_disable() on PREEMPT_RT
mm, slub: convert kmem_cpu_slab protection to local_lock
Subsystem: mm/memory-hotplug
David Hildenbrand <david@redhat.com>:
Patch series "memory-hotplug.rst: complete admin-guide overhaul", v3:
memory-hotplug.rst: remove locking details from admin-guide
memory-hotplug.rst: complete admin-guide overhaul
Mike Rapoport <rppt@linux.ibm.com>:
Patch series "mm: remove pfn_valid_within() and CONFIG_HOLES_IN_ZONE":
mm: remove pfn_valid_within() and CONFIG_HOLES_IN_ZONE
mm: memory_hotplug: cleanup after removal of pfn_valid_within()
David Hildenbrand <david@redhat.com>:
Patch series "mm/memory_hotplug: preparatory patches for new online policy and memory":
mm/memory_hotplug: use "unsigned long" for PFN in zone_for_pfn_range()
mm/memory_hotplug: remove nid parameter from arch_remove_memory()
mm/memory_hotplug: remove nid parameter from remove_memory() and friends
ACPI: memhotplug: memory resources cannot be enabled yet
Patch series "mm/memory_hotplug: "auto-movable" online policy and memory groups", v3:
mm: track present early pages per zone
mm/memory_hotplug: introduce "auto-movable" online policy
drivers/base/memory: introduce "memory groups" to logically group memory blocks
mm/memory_hotplug: track present pages in memory groups
ACPI: memhotplug: use a single static memory group for a single memory device
dax/kmem: use a single static memory group for a single probed unit
virtio-mem: use a single dynamic memory group for a single virtio-mem device
mm/memory_hotplug: memory group aware "auto-movable" online policy
mm/memory_hotplug: improved dynamic memory group aware "auto-movable" online policy
Miaohe Lin <linmiaohe@huawei.com>:
Patch series "Cleanup and fixups for memory hotplug":
mm/memory_hotplug: use helper zone_is_zone_device() to simplify the code
Subsystem: mm/rmap
Muchun Song <songmuchun@bytedance.com>:
mm: remove redundant compound_head() calling
Subsystem: mm/ioremap
Christoph Hellwig <hch@lst.de>:
riscv: only select GENERIC_IOREMAP if MMU support is enabled
Patch series "small ioremap cleanups":
mm: move ioremap_page_range to vmalloc.c
mm: don't allow executable ioremap mappings
Weizhao Ouyang <o451686892@gmail.com>:
mm/early_ioremap.c: remove redundant early_ioremap_shutdown()
Subsystem: mm/highmem
Sebastian Andrzej Siewior <bigeasy@linutronix.de>:
highmem: don't disable preemption on RT in kmap_atomic()
Subsystem: mm/cleanups
Changbin Du <changbin.du@gmail.com>:
mm: in_irq() cleanup
Muchun Song <songmuchun@bytedance.com>:
mm: introduce PAGEFLAGS_MASK to replace ((1UL << NR_PAGEFLAGS) - 1)
Subsystem: mm/secretmem
Jordy Zomer <jordy@jordyzomer.github.io>:
mm/secretmem: use refcount_t instead of atomic_t
Subsystem: mm/kfence
Marco Elver <elver@google.com>:
kfence: show cpu and timestamp in alloc/free info
kfence: test: fail fast if disabled at boot
Subsystem: mm/damon
SeongJae Park <sjpark@amazon.de>:
Patch series "Introduce Data Access MONitor (DAMON)", v34:
mm: introduce Data Access MONitor (DAMON)
mm/damon/core: implement region-based sampling
mm/damon: adaptively adjust regions
mm/idle_page_tracking: make PG_idle reusable
mm/damon: implement primitives for the virtual memory address spaces
mm/damon: add a tracepoint
mm/damon: implement a debugfs-based user space interface
mm/damon/dbgfs: export kdamond pid to the user space
mm/damon/dbgfs: support multiple contexts
Documentation: add documents for DAMON
mm/damon: add kunit tests
mm/damon: add user space selftests
MAINTAINERS: update for DAMON
Subsystem: alpha
Randy Dunlap <rdunlap@infradead.org>:
alpha: agp: make empty macros use do-while-0 style
alpha: pci-sysfs: fix all kernel-doc warnings
Subsystem: percpu
Greg Kroah-Hartman <gregkh@linuxfoundation.org>:
percpu: remove export of pcpu_base_addr
Subsystem: procfs
Feng Zhou <zhoufeng.zf@bytedance.com>:
fs/proc/kcore.c: add mmap interface
Christoph Hellwig <hch@lst.de>:
proc: stop using seq_get_buf in proc_task_name
Ohhoon Kwon <ohoono.kwon@samsung.com>:
connector: send event on write to /proc/[pid]/comm
Subsystem: misc
Colin Ian King <colin.king@canonical.com>:
arch: Kconfig: fix spelling mistake "seperate" -> "separate"
Andy Shevchenko <andriy.shevchenko@linux.intel.com>:
include/linux/once.h: fix trivia typo Not -> Note
Daniel Lezcano <daniel.lezcano@linaro.org>:
Patch series "Add Hz macros", v3:
units: change from 'L' to 'UL'
units: add the HZ macros
thermal/drivers/devfreq_cooling: use HZ macros
devfreq: use HZ macros
iio/drivers/as73211: use HZ macros
hwmon/drivers/mr75203: use HZ macros
iio/drivers/hid-sensor: use HZ macros
i2c/drivers/ov02q10: use HZ macros
mtd/drivers/nand: use HZ macros
phy/drivers/stm32: use HZ macros
Subsystem: core-kernel
Yang Yang <yang.yang29@zte.com.cn>:
kernel/acct.c: use dedicated helper to access rlimit values
Pavel Skripkin <paskripkin@gmail.com>:
profiling: fix shift-out-of-bounds bugs
Subsystem: MAINTAINERS
Nathan Chancellor <nathan@kernel.org>:
MAINTAINERS: update ClangBuiltLinux mailing list
Documentation/llvm: update mailing list
Documentation/llvm: update IRC location
Subsystem: lib
Geert Uytterhoeven <geert@linux-m68k.org>:
Patch series "math: RATIONAL and RATIONAL_KUNIT_TEST improvements":
math: make RATIONAL tristate
math: RATIONAL_KUNIT_TEST should depend on RATIONAL instead of selecting it
Matteo Croce <mcroce@microsoft.com>:
Patch series "lib/string: optimized mem* functions", v2:
lib/string: optimized memcpy
lib/string: optimized memmove
lib/string: optimized memset
Daniel Latypov <dlatypov@google.com>:
lib/test: convert test_sort.c to use KUnit
Randy Dunlap <rdunlap@infradead.org>:
lib/dump_stack: correct kernel-doc notation
lib/iov_iter.c: fix kernel-doc warnings
Subsystem: bitops
Yury Norov <yury.norov@gmail.com>:
Patch series "Resend bitmap patches":
bitops: protect find_first_{,zero}_bit properly
bitops: move find_bit_*_le functions from le.h to find.h
include: move find.h from asm_generic to linux
arch: remove GENERIC_FIND_FIRST_BIT entirely
lib: add find_first_and_bit()
cpumask: use find_first_and_bit()
all: replace find_next{,_zero}_bit with find_first{,_zero}_bit where appropriate
tools: sync tools/bitmap with mother linux
cpumask: replace cpumask_next_* with cpumask_first_* where appropriate
include/linux: move for_each_bit() macros from bitops.h to find.h
find: micro-optimize for_each_{set,clear}_bit()
bitops: replace for_each_*_bit_from() with for_each_*_bit() where appropriate
Andy Shevchenko <andriy.shevchenko@linux.intel.com>:
tools: rename bitmap_alloc() to bitmap_zalloc()
Yury Norov <yury.norov@gmail.com>:
mm/percpu: micro-optimize pcpu_is_populated()
bitmap: unify find_bit operations
lib: bitmap: add performance test for bitmap_print_to_pagebuf
vsprintf: rework bitmap_list_string
Subsystem: checkpatch
Joe Perches <joe@perches.com>:
checkpatch: support wide strings
Mimi Zohar <zohar@linux.ibm.com>:
checkpatch: make email address check case insensitive
Joe Perches <joe@perches.com>:
checkpatch: improve GIT_COMMIT_ID test
Subsystem: epoll
Nicholas Piggin <npiggin@gmail.com>:
fs/epoll: use a per-cpu counter for user's watches count
Subsystem: init
Rasmus Villemoes <linux@rasmusvillemoes.dk>:
init: move usermodehelper_enable() to populate_rootfs()
Kefeng Wang <wangkefeng.wang@huawei.com>:
trap: cleanup trap_init()
Subsystem: nilfs2
Nanyong Sun <sunnanyong@huawei.com>:
Patch series "nilfs2: fix incorrect usage of kobject":
nilfs2: fix memory leak in nilfs_sysfs_create_device_group
nilfs2: fix NULL pointer in nilfs_##name##_attr_release
nilfs2: fix memory leak in nilfs_sysfs_create_##name##_group
nilfs2: fix memory leak in nilfs_sysfs_delete_##name##_group
nilfs2: fix memory leak in nilfs_sysfs_create_snapshot_group
nilfs2: fix memory leak in nilfs_sysfs_delete_snapshot_group
Zhen Lei <thunder.leizhen@huawei.com>:
nilfs2: use refcount_dec_and_lock() to fix potential UAF
Subsystem: coredump
David Oberhollenzer <david.oberhollenzer@sigma-star.at>:
fs/coredump.c: log if a core dump is aborted due to changed file permissions
QiuXi <qiuxi1@huawei.com>:
coredump: fix memleak in dump_vma_snapshot()
Subsystem: fork
Christoph Hellwig <hch@lst.de>:
kernel/fork.c: unexport get_{mm,task}_exe_file
Subsystem: pids
Takahiro Itazuri <itazur@amazon.com>:
pid: cleanup the stale comment mentioning pidmap_init().
Subsystem: criu
Cyrill Gorcunov <gorcunov@gmail.com>:
prctl: allow to setup brk for et_dyn executables
Subsystem: kconfig
Zenghui Yu <yuzenghui@huawei.com>:
configs: remove the obsolete CONFIG_INPUT_POLLDEV
Lukas Bulwahn <lukas.bulwahn@gmail.com>:
Kconfig.debug: drop selecting non-existing HARDLOCKUP_DETECTOR_ARCH
Subsystem: selftests
Greg Thelen <gthelen@google.com>:
selftests/memfd: remove unused variable
Subsystem: ipc
Rafael Aquini <aquini@redhat.com>:
ipc: replace costly bailout check in sysvipc_find_ipc()
Subsystem: mm/vmscan
Randy Dunlap <rdunlap@infradead.org>:
mm/workingset: correct kernel-doc notations
Subsystem: scripts
Randy Dunlap <rdunlap@infradead.org>:
scripts: check_extable: fix typo in user error message
a/Documentation/admin-guide/mm/damon/index.rst | 15
a/Documentation/admin-guide/mm/damon/start.rst | 114 +
a/Documentation/admin-guide/mm/damon/usage.rst | 112 +
a/Documentation/admin-guide/mm/index.rst | 1
a/Documentation/admin-guide/mm/memory-hotplug.rst | 842 ++++++-----
a/Documentation/dev-tools/kfence.rst | 98 -
a/Documentation/kbuild/llvm.rst | 5
a/Documentation/vm/damon/api.rst | 20
a/Documentation/vm/damon/design.rst | 166 ++
a/Documentation/vm/damon/faq.rst | 51
a/Documentation/vm/damon/index.rst | 30
a/Documentation/vm/index.rst | 1
a/MAINTAINERS | 17
a/arch/Kconfig | 2
a/arch/alpha/include/asm/agp.h | 4
a/arch/alpha/include/asm/bitops.h | 2
a/arch/alpha/kernel/pci-sysfs.c | 12
a/arch/arc/Kconfig | 1
a/arch/arc/include/asm/bitops.h | 1
a/arch/arc/kernel/traps.c | 5
a/arch/arm/configs/dove_defconfig | 1
a/arch/arm/configs/pxa_defconfig | 1
a/arch/arm/include/asm/bitops.h | 1
a/arch/arm/kernel/traps.c | 5
a/arch/arm64/Kconfig | 1
a/arch/arm64/include/asm/bitops.h | 1
a/arch/arm64/mm/mmu.c | 3
a/arch/csky/include/asm/bitops.h | 1
a/arch/h8300/include/asm/bitops.h | 1
a/arch/h8300/kernel/traps.c | 4
a/arch/hexagon/include/asm/bitops.h | 1
a/arch/hexagon/kernel/traps.c | 4
a/arch/ia64/include/asm/bitops.h | 2
a/arch/ia64/mm/init.c | 3
a/arch/m68k/include/asm/bitops.h | 2
a/arch/mips/Kconfig | 1
a/arch/mips/configs/lemote2f_defconfig | 1
a/arch/mips/configs/pic32mzda_defconfig | 1
a/arch/mips/configs/rt305x_defconfig | 1
a/arch/mips/configs/xway_defconfig | 1
a/arch/mips/include/asm/bitops.h | 1
a/arch/nds32/kernel/traps.c | 5
a/arch/nios2/kernel/traps.c | 5
a/arch/openrisc/include/asm/bitops.h | 1
a/arch/openrisc/kernel/traps.c | 5
a/arch/parisc/configs/generic-32bit_defconfig | 1
a/arch/parisc/include/asm/bitops.h | 2
a/arch/parisc/kernel/traps.c | 4
a/arch/powerpc/include/asm/bitops.h | 2
a/arch/powerpc/include/asm/cputhreads.h | 2
a/arch/powerpc/kernel/traps.c | 5
a/arch/powerpc/mm/mem.c | 3
a/arch/powerpc/platforms/pasemi/dma_lib.c | 4
a/arch/powerpc/platforms/pseries/hotplug-memory.c | 9
a/arch/riscv/Kconfig | 2
a/arch/riscv/include/asm/bitops.h | 1
a/arch/riscv/kernel/traps.c | 5
a/arch/s390/Kconfig | 1
a/arch/s390/include/asm/bitops.h | 1
a/arch/s390/kvm/kvm-s390.c | 2
a/arch/s390/mm/init.c | 3
a/arch/sh/include/asm/bitops.h | 1
a/arch/sh/mm/init.c | 3
a/arch/sparc/include/asm/bitops_32.h | 1
a/arch/sparc/include/asm/bitops_64.h | 2
a/arch/um/kernel/trap.c | 4
a/arch/x86/Kconfig | 1
a/arch/x86/configs/i386_defconfig | 1
a/arch/x86/configs/x86_64_defconfig | 1
a/arch/x86/include/asm/bitops.h | 2
a/arch/x86/kernel/apic/vector.c | 4
a/arch/x86/mm/init_32.c | 3
a/arch/x86/mm/init_64.c | 3
a/arch/x86/um/Kconfig | 1
a/arch/xtensa/include/asm/bitops.h | 1
a/block/blk-mq.c | 2
a/drivers/acpi/acpi_memhotplug.c | 46
a/drivers/base/memory.c | 231 ++-
a/drivers/base/node.c | 2
a/drivers/block/rnbd/rnbd-clt.c | 2
a/drivers/dax/kmem.c | 43
a/drivers/devfreq/devfreq.c | 2
a/drivers/dma/ti/edma.c | 2
a/drivers/gpu/drm/etnaviv/etnaviv_gpu.c | 4
a/drivers/hwmon/ltc2992.c | 3
a/drivers/hwmon/mr75203.c | 2
a/drivers/iio/adc/ad7124.c | 2
a/drivers/iio/common/hid-sensors/hid-sensor-attributes.c | 3
a/drivers/iio/light/as73211.c | 3
a/drivers/infiniband/hw/irdma/hw.c | 16
a/drivers/media/cec/core/cec-core.c | 2
a/drivers/media/i2c/ov02a10.c | 2
a/drivers/media/mc/mc-devnode.c | 2
a/drivers/mmc/host/renesas_sdhi_core.c | 2
a/drivers/mtd/nand/raw/intel-nand-controller.c | 2
a/drivers/net/virtio_net.c | 2
a/drivers/pci/controller/dwc/pci-dra7xx.c | 2
a/drivers/phy/st/phy-stm32-usbphyc.c | 2
a/drivers/scsi/lpfc/lpfc_sli.c | 10
a/drivers/soc/fsl/qbman/bman_portal.c | 2
a/drivers/soc/fsl/qbman/qman_portal.c | 2
a/drivers/soc/ti/k3-ringacc.c | 4
a/drivers/thermal/devfreq_cooling.c | 2
a/drivers/tty/n_tty.c | 2
a/drivers/virt/acrn/ioreq.c | 3
a/drivers/virtio/virtio_mem.c | 26
a/fs/coredump.c | 15
a/fs/eventpoll.c | 18
a/fs/f2fs/segment.c | 8
a/fs/nilfs2/sysfs.c | 26
a/fs/nilfs2/the_nilfs.c | 9
a/fs/ocfs2/cluster/heartbeat.c | 2
a/fs/ocfs2/dlm/dlmdomain.c | 4
a/fs/ocfs2/dlm/dlmmaster.c | 18
a/fs/ocfs2/dlm/dlmrecovery.c | 2
a/fs/ocfs2/dlm/dlmthread.c | 2
a/fs/proc/array.c | 18
a/fs/proc/base.c | 5
a/fs/proc/kcore.c | 73
a/include/asm-generic/bitops.h | 1
a/include/asm-generic/bitops/find.h | 198 --
a/include/asm-generic/bitops/le.h | 64
a/include/asm-generic/early_ioremap.h | 6
a/include/linux/bitmap.h | 34
a/include/linux/bitops.h | 34
a/include/linux/cpumask.h | 46
a/include/linux/damon.h | 290 +++
a/include/linux/find.h | 134 +
a/include/linux/highmem-internal.h | 27
a/include/linux/memory.h | 55
a/include/linux/memory_hotplug.h | 40
a/include/linux/mmzone.h | 19
a/include/linux/once.h | 2
a/include/linux/page-flags.h | 17
a/include/linux/page_ext.h | 2
a/include/linux/page_idle.h | 6
a/include/linux/pagemap.h | 7
a/include/linux/sched/user.h | 3
a/include/linux/slub_def.h | 6
a/include/linux/threads.h | 2
a/include/linux/units.h | 10
a/include/linux/vmalloc.h | 3
a/include/trace/events/damon.h | 43
a/include/trace/events/mmflags.h | 2
a/include/trace/events/page_ref.h | 4
a/init/initramfs.c | 2
a/init/main.c | 3
a/init/noinitramfs.c | 2
a/ipc/util.c | 16
a/kernel/acct.c | 2
a/kernel/fork.c | 2
a/kernel/profile.c | 21
a/kernel/sys.c | 7
a/kernel/time/clocksource.c | 4
a/kernel/user.c | 25
a/lib/Kconfig | 3
a/lib/Kconfig.debug | 9
a/lib/dump_stack.c | 3
a/lib/find_bit.c | 21
a/lib/find_bit_benchmark.c | 21
a/lib/genalloc.c | 2
a/lib/iov_iter.c | 8
a/lib/math/Kconfig | 2
a/lib/math/rational.c | 3
a/lib/string.c | 130 +
a/lib/test_bitmap.c | 37
a/lib/test_printf.c | 2
a/lib/test_sort.c | 40
a/lib/vsprintf.c | 26
a/mm/Kconfig | 15
a/mm/Makefile | 4
a/mm/compaction.c | 20
a/mm/damon/Kconfig | 68
a/mm/damon/Makefile | 5
a/mm/damon/core-test.h | 253 +++
a/mm/damon/core.c | 748 ++++++++++
a/mm/damon/dbgfs-test.h | 126 +
a/mm/damon/dbgfs.c | 631 ++++++++
a/mm/damon/vaddr-test.h | 329 ++++
a/mm/damon/vaddr.c | 672 +++++++++
a/mm/early_ioremap.c | 5
a/mm/highmem.c | 2
a/mm/ioremap.c | 25
a/mm/kfence/core.c | 3
a/mm/kfence/kfence.h | 2
a/mm/kfence/kfence_test.c | 3
a/mm/kfence/report.c | 19
a/mm/kmemleak.c | 2
a/mm/memory_hotplug.c | 396 ++++-
a/mm/memremap.c | 5
a/mm/page_alloc.c | 27
a/mm/page_ext.c | 12
a/mm/page_idle.c | 10
a/mm/page_isolation.c | 7
a/mm/page_owner.c | 14
a/mm/percpu.c | 36
a/mm/rmap.c | 6
a/mm/secretmem.c | 9
a/mm/slab_common.c | 2
a/mm/slub.c | 1023 +++++++++-----
a/mm/vmalloc.c | 24
a/mm/workingset.c | 2
a/net/ncsi/ncsi-manage.c | 4
a/scripts/check_extable.sh | 2
a/scripts/checkpatch.pl | 93 -
a/tools/include/linux/bitmap.h | 4
a/tools/perf/bench/find-bit-bench.c | 2
a/tools/perf/builtin-c2c.c | 6
a/tools/perf/builtin-record.c | 2
a/tools/perf/tests/bitmap.c | 2
a/tools/perf/tests/mem2node.c | 2
a/tools/perf/util/affinity.c | 4
a/tools/perf/util/header.c | 4
a/tools/perf/util/metricgroup.c | 2
a/tools/perf/util/mmap.c | 4
a/tools/testing/selftests/damon/Makefile | 7
a/tools/testing/selftests/damon/_chk_dependency.sh | 28
a/tools/testing/selftests/damon/debugfs_attrs.sh | 75 +
a/tools/testing/selftests/kvm/dirty_log_perf_test.c | 2
a/tools/testing/selftests/kvm/dirty_log_test.c | 4
a/tools/testing/selftests/kvm/x86_64/vmx_dirty_log_test.c | 2
a/tools/testing/selftests/memfd/memfd_test.c | 2
b/MAINTAINERS | 2
b/tools/include/asm-generic/bitops.h | 1
b/tools/include/linux/bitmap.h | 7
b/tools/include/linux/find.h | 81 +
b/tools/lib/find_bit.c | 20
227 files changed, 6695 insertions(+), 1875 deletions(-)
^ permalink raw reply [flat|nested] 232+ messages in thread
* Re: incoming
2021-09-08 2:52 incoming Andrew Morton
@ 2021-09-08 8:57 ` Vlastimil Babka
0 siblings, 0 replies; 232+ messages in thread
From: Vlastimil Babka @ 2021-09-08 8:57 UTC (permalink / raw)
To: Andrew Morton, Linus Torvalds
Cc: linux-mm, mm-commits, Mike Galbraith, Mel Gorman
On 9/8/21 04:52, Andrew Morton wrote:
> Subsystem: mm/slub
>
> Vlastimil Babka <vbabka@suse.cz>:
> Patch series "SLUB: reduce irq disabled scope and make it RT compatible", v6:
> mm, slub: don't call flush_all() from slab_debug_trace_open()
> mm, slub: allocate private object map for debugfs listings
> mm, slub: allocate private object map for validate_slab_cache()
> mm, slub: don't disable irq for debug_check_no_locks_freed()
> mm, slub: remove redundant unfreeze_partials() from put_cpu_partial()
> mm, slub: extract get_partial() from new_slab_objects()
> mm, slub: dissolve new_slab_objects() into ___slab_alloc()
> mm, slub: return slab page from get_partial() and set c->page afterwards
> mm, slub: restructure new page checks in ___slab_alloc()
> mm, slub: simplify kmem_cache_cpu and tid setup
> mm, slub: move disabling/enabling irqs to ___slab_alloc()
> mm, slub: do initial checks in ___slab_alloc() with irqs enabled
> mm, slub: move disabling irqs closer to get_partial() in ___slab_alloc()
> mm, slub: restore irqs around calling new_slab()
> mm, slub: validate slab from partial list or page allocator before making it cpu slab
> mm, slub: check new pages with restored irqs
> mm, slub: stop disabling irqs around get_partial()
> mm, slub: move reset of c->page and freelist out of deactivate_slab()
> mm, slub: make locking in deactivate_slab() irq-safe
> mm, slub: call deactivate_slab() without disabling irqs
> mm, slub: move irq control into unfreeze_partials()
> mm, slub: discard slabs in unfreeze_partials() without irqs disabled
> mm, slub: detach whole partial list at once in unfreeze_partials()
> mm, slub: separate detaching of partial list in unfreeze_partials() from unfreezing
> mm, slub: only disable irq with spin_lock in __unfreeze_partials()
> mm, slub: don't disable irqs in slub_cpu_dead()
> mm, slab: split out the cpu offline variant of flush_slab()
>
> Sebastian Andrzej Siewior <bigeasy@linutronix.de>:
> mm: slub: move flush_cpu_slab() invocations __free_slab() invocations out of IRQ context
> mm: slub: make object_map_lock a raw_spinlock_t
>
> Vlastimil Babka <vbabka@suse.cz>:
> mm, slub: make slab_lock() disable irqs with PREEMPT_RT
> mm, slub: protect put_cpu_partial() with disabled irqs instead of cmpxchg
> mm, slub: use migrate_disable() on PREEMPT_RT
> mm, slub: convert kmem_cpu_slab protection to local_lock
For my own piece of mind, I've checked that this part (patches 1 to 33)
are identical to the v6 posting [1] and git version [2] that Mel and
Mike tested (replies to [1]).
[1] https://lore.kernel.org/all/20210904105003.11688-1-vbabka@suse.cz/
[2] git://git.kernel.org/pub/scm/linux/kernel/git/vbabka/linux.git
tags/mm-slub-5.15-rc1
^ permalink raw reply [flat|nested] 232+ messages in thread
* incoming
@ 2021-09-08 22:17 Andrew Morton
0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2021-09-08 22:17 UTC (permalink / raw)
To: Linus Torvalds; +Cc: linux-mm, mm-commits
This is the post-linux-next material, so it is based upon latest
upstream to catch the now-merged dependencies.
10 patches, based on 2d338201d5311bcd79d42f66df4cecbcbc5f4f2c.
Subsystems affected by this patch series:
mm/vmstat
mm/migration
compat
Subsystem: mm/vmstat
Ingo Molnar <mingo@elte.hu>:
mm/vmstat: protect per cpu variables with preempt disable on RT
Subsystem: mm/migration
Baolin Wang <baolin.wang@linux.alibaba.com>:
mm: migrate: introduce a local variable to get the number of pages
mm: migrate: fix the incorrect function name in comments
mm: migrate: change to use bool type for 'page_was_mapped'
Subsystem: compat
Arnd Bergmann <arnd@arndb.de>:
Patch series "compat: remove compat_alloc_user_space", v5:
kexec: move locking into do_kexec_load
kexec: avoid compat_alloc_user_space
mm: simplify compat_sys_move_pages
mm: simplify compat numa syscalls
compat: remove some compat entry points
arch: remove compat_alloc_user_space
arch/arm64/include/asm/compat.h | 5
arch/arm64/include/asm/uaccess.h | 11 -
arch/arm64/include/asm/unistd32.h | 10 -
arch/arm64/lib/Makefile | 2
arch/arm64/lib/copy_in_user.S | 77 ----------
arch/mips/cavium-octeon/octeon-memcpy.S | 2
arch/mips/include/asm/compat.h | 8 -
arch/mips/include/asm/uaccess.h | 26 ---
arch/mips/kernel/syscalls/syscall_n32.tbl | 10 -
arch/mips/kernel/syscalls/syscall_o32.tbl | 10 -
arch/mips/lib/memcpy.S | 11 -
arch/parisc/include/asm/compat.h | 6
arch/parisc/include/asm/uaccess.h | 2
arch/parisc/kernel/syscalls/syscall.tbl | 8 -
arch/parisc/lib/memcpy.c | 9 -
arch/powerpc/include/asm/compat.h | 16 --
arch/powerpc/kernel/syscalls/syscall.tbl | 10 -
arch/s390/include/asm/compat.h | 10 -
arch/s390/include/asm/uaccess.h | 3
arch/s390/kernel/syscalls/syscall.tbl | 10 -
arch/s390/lib/uaccess.c | 63 --------
arch/sparc/include/asm/compat.h | 19 --
arch/sparc/kernel/process_64.c | 2
arch/sparc/kernel/signal32.c | 12 -
arch/sparc/kernel/signal_64.c | 8 -
arch/sparc/kernel/syscalls/syscall.tbl | 10 -
arch/x86/entry/syscalls/syscall_32.tbl | 4
arch/x86/entry/syscalls/syscall_64.tbl | 2
arch/x86/include/asm/compat.h | 13 -
arch/x86/include/asm/uaccess_64.h | 7
include/linux/compat.h | 39 +----
include/linux/uaccess.h | 10 -
include/uapi/asm-generic/unistd.h | 10 -
kernel/compat.c | 21 --
kernel/kexec.c | 105 +++++---------
kernel/sys_ni.c | 5
mm/mempolicy.c | 213 +++++++-----------------------
mm/migrate.c | 69 +++++----
mm/vmstat.c | 48 ++++++
39 files changed, 243 insertions(+), 663 deletions(-)
^ permalink raw reply [flat|nested] 232+ messages in thread
* incoming
@ 2021-09-09 1:08 Andrew Morton
0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2021-09-09 1:08 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm
A bunch of hotfixes, mostly cc:stable.
8 patches, based on 2d338201d5311bcd79d42f66df4cecbcbc5f4f2c.
Subsystems affected by this patch series:
mm/hmm
mm/hugetlb
mm/vmscan
mm/pagealloc
mm/pagemap
mm/kmemleak
mm/mempolicy
mm/memblock
Subsystem: mm/hmm
Li Zhijian <lizhijian@cn.fujitsu.com>:
mm/hmm: bypass devmap pte when all pfn requested flags are fulfilled
Subsystem: mm/hugetlb
Liu Zixian <liuzixian4@huawei.com>:
mm/hugetlb: initialize hugetlb_usage in mm_init
Subsystem: mm/vmscan
Rik van Riel <riel@surriel.com>:
mm,vmscan: fix divide by zero in get_scan_count
Subsystem: mm/pagealloc
Miaohe Lin <linmiaohe@huawei.com>:
mm/page_alloc.c: avoid accessing uninitialized pcp page migratetype
Subsystem: mm/pagemap
Liam Howlett <liam.howlett@oracle.com>:
mmap_lock: change trace and locking order
Subsystem: mm/kmemleak
Naohiro Aota <naohiro.aota@wdc.com>:
mm/kmemleak: allow __GFP_NOLOCKDEP passed to kmemleak's gfp
Subsystem: mm/mempolicy
yanghui <yanghui.def@bytedance.com>:
mm/mempolicy: fix a race between offset_il_node and mpol_rebind_task
Subsystem: mm/memblock
Mike Rapoport <rppt@linux.ibm.com>:
nds32/setup: remove unused memblock_region variable in setup_memory()
arch/nds32/kernel/setup.c | 1 -
include/linux/hugetlb.h | 9 +++++++++
include/linux/mmap_lock.h | 8 ++++----
kernel/fork.c | 1 +
mm/hmm.c | 5 ++++-
mm/kmemleak.c | 3 ++-
mm/mempolicy.c | 17 +++++++++++++----
mm/page_alloc.c | 4 +++-
mm/vmscan.c | 2 +-
9 files changed, 37 insertions(+), 13 deletions(-)
^ permalink raw reply [flat|nested] 232+ messages in thread
* incoming
@ 2021-09-10 3:09 Andrew Morton
2021-09-10 17:11 ` incoming Kees Cook
0 siblings, 1 reply; 232+ messages in thread
From: Andrew Morton @ 2021-09-10 3:09 UTC (permalink / raw)
To: Linus Torvalds; +Cc: linux-mm, mm-commits
More post linux-next material.
9 patches, based on f154c806676ad7153c6e161f30c53a44855329d6.
Subsystems affected by this patch series:
mm/slab-generic
rapidio
mm/debug
Subsystem: mm/slab-generic
"Matthew Wilcox (Oracle)" <willy@infradead.org>:
mm: move kvmalloc-related functions to slab.h
Subsystem: rapidio
Kees Cook <keescook@chromium.org>:
rapidio: avoid bogus __alloc_size warning
Subsystem: mm/debug
Kees Cook <keescook@chromium.org>:
Patch series "Add __alloc_size() for better bounds checking", v2:
Compiler Attributes: add __alloc_size() for better bounds checking
checkpatch: add __alloc_size() to known $Attribute
slab: clean up function declarations
slab: add __alloc_size attributes for better bounds checking
mm/page_alloc: add __alloc_size attributes for better bounds checking
percpu: add __alloc_size attributes for better bounds checking
mm/vmalloc: add __alloc_size attributes for better bounds checking
Makefile | 15 +++
drivers/of/kexec.c | 1
drivers/rapidio/devices/rio_mport_cdev.c | 9 +-
include/linux/compiler_attributes.h | 6 +
include/linux/gfp.h | 2
include/linux/mm.h | 34 --------
include/linux/percpu.h | 3
include/linux/slab.h | 122 ++++++++++++++++++++++---------
include/linux/vmalloc.h | 11 ++
scripts/checkpatch.pl | 3
10 files changed, 132 insertions(+), 74 deletions(-)
^ permalink raw reply [flat|nested] 232+ messages in thread
* Re: incoming
2021-09-10 3:09 incoming Andrew Morton
@ 2021-09-10 17:11 ` Kees Cook
2021-09-10 20:13 ` incoming Kees Cook
0 siblings, 1 reply; 232+ messages in thread
From: Kees Cook @ 2021-09-10 17:11 UTC (permalink / raw)
To: Linus Torvalds, Andrew Morton; +Cc: linux-mm, mm-commits
On Thu, Sep 09, 2021 at 08:09:48PM -0700, Andrew Morton wrote:
>
> More post linux-next material.
>
> 9 patches, based on f154c806676ad7153c6e161f30c53a44855329d6.
>
> Subsystems affected by this patch series:
>
> mm/slab-generic
> rapidio
> mm/debug
>
> Subsystem: mm/slab-generic
>
> "Matthew Wilcox (Oracle)" <willy@infradead.org>:
> mm: move kvmalloc-related functions to slab.h
>
> Subsystem: rapidio
>
> Kees Cook <keescook@chromium.org>:
> rapidio: avoid bogus __alloc_size warning
>
> Subsystem: mm/debug
>
> Kees Cook <keescook@chromium.org>:
> Patch series "Add __alloc_size() for better bounds checking", v2:
> Compiler Attributes: add __alloc_size() for better bounds checking
> checkpatch: add __alloc_size() to known $Attribute
> slab: clean up function declarations
> slab: add __alloc_size attributes for better bounds checking
> mm/page_alloc: add __alloc_size attributes for better bounds checking
> percpu: add __alloc_size attributes for better bounds checking
> mm/vmalloc: add __alloc_size attributes for better bounds checking
Hi,
FYI, in overnight build testing I found yet another corner case in
GCC's handling of the __alloc_size attribute. It's the gift that keeps
on giving. The fix is here:
https://lore.kernel.org/lkml/20210910165851.3296624-1-keescook@chromium.org/
>
> Makefile | 15 +++
> drivers/of/kexec.c | 1
> drivers/rapidio/devices/rio_mport_cdev.c | 9 +-
> include/linux/compiler_attributes.h | 6 +
> include/linux/gfp.h | 2
> include/linux/mm.h | 34 --------
> include/linux/percpu.h | 3
> include/linux/slab.h | 122 ++++++++++++++++++++++---------
> include/linux/vmalloc.h | 11 ++
> scripts/checkpatch.pl | 3
> 10 files changed, 132 insertions(+), 74 deletions(-)
>
--
Kees Cook
^ permalink raw reply [flat|nested] 232+ messages in thread
* Re: incoming
2021-09-10 17:11 ` incoming Kees Cook
@ 2021-09-10 20:13 ` Kees Cook
0 siblings, 0 replies; 232+ messages in thread
From: Kees Cook @ 2021-09-10 20:13 UTC (permalink / raw)
To: linux-kernel; +Cc: Linus Torvalds, Andrew Morton, linux-mm, mm-commits
On Fri, Sep 10, 2021 at 10:11:53AM -0700, Kees Cook wrote:
> On Thu, Sep 09, 2021 at 08:09:48PM -0700, Andrew Morton wrote:
> >
> > More post linux-next material.
> >
> > 9 patches, based on f154c806676ad7153c6e161f30c53a44855329d6.
> >
> > Subsystems affected by this patch series:
> >
> > mm/slab-generic
> > rapidio
> > mm/debug
> >
> > Subsystem: mm/slab-generic
> >
> > "Matthew Wilcox (Oracle)" <willy@infradead.org>:
> > mm: move kvmalloc-related functions to slab.h
> >
> > Subsystem: rapidio
> >
> > Kees Cook <keescook@chromium.org>:
> > rapidio: avoid bogus __alloc_size warning
> >
> > Subsystem: mm/debug
> >
> > Kees Cook <keescook@chromium.org>:
> > Patch series "Add __alloc_size() for better bounds checking", v2:
> > Compiler Attributes: add __alloc_size() for better bounds checking
> > checkpatch: add __alloc_size() to known $Attribute
> > slab: clean up function declarations
> > slab: add __alloc_size attributes for better bounds checking
> > mm/page_alloc: add __alloc_size attributes for better bounds checking
> > percpu: add __alloc_size attributes for better bounds checking
> > mm/vmalloc: add __alloc_size attributes for better bounds checking
>
> Hi,
>
> FYI, in overnight build testing I found yet another corner case in
> GCC's handling of the __alloc_size attribute. It's the gift that keeps
> on giving. The fix is here:
>
> https://lore.kernel.org/lkml/20210910165851.3296624-1-keescook@chromium.org/
I'm so glad it's Friday. Here's the v2 fix... *sigh*
https://lore.kernel.org/lkml/20210910201132.3809437-1-keescook@chromium.org/
-Kees
>
> >
> > Makefile | 15 +++
> > drivers/of/kexec.c | 1
> > drivers/rapidio/devices/rio_mport_cdev.c | 9 +-
> > include/linux/compiler_attributes.h | 6 +
> > include/linux/gfp.h | 2
> > include/linux/mm.h | 34 --------
> > include/linux/percpu.h | 3
> > include/linux/slab.h | 122 ++++++++++++++++++++++---------
> > include/linux/vmalloc.h | 11 ++
> > scripts/checkpatch.pl | 3
> > 10 files changed, 132 insertions(+), 74 deletions(-)
> >
>
> --
> Kees Cook
--
Kees Cook
^ permalink raw reply [flat|nested] 232+ messages in thread
* incoming
@ 2021-09-24 22:42 Andrew Morton
0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2021-09-24 22:42 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm
16 patches, based on 7d42e98182586f57f376406d033f05fe135edb75.
Subsystems affected by this patch series:
mm/memory-failure
mm/kasan
mm/damon
xtensa
mm/shmem
ocfs2
scripts
mm/tools
lib
mm/pagecache
mm/debug
sh
mm/kasan
mm/memory-failure
mm/pagemap
Subsystem: mm/memory-failure
Naoya Horiguchi <naoya.horiguchi@nec.com>:
mm, hwpoison: add is_free_buddy_page() in HWPoisonHandlable()
Subsystem: mm/kasan
Marco Elver <elver@google.com>:
kasan: fix Kconfig check of CC_HAS_WORKING_NOSANITIZE_ADDRESS
Subsystem: mm/damon
Adam Borowski <kilobyte@angband.pl>:
mm/damon: don't use strnlen() with known-bogus source length
Subsystem: xtensa
Guenter Roeck <linux@roeck-us.net>:
xtensa: increase size of gcc stack frame check
Subsystem: mm/shmem
Liu Yuntao <liuyuntao10@huawei.com>:
mm/shmem.c: fix judgment error in shmem_is_huge()
Subsystem: ocfs2
Wengang Wang <wen.gang.wang@oracle.com>:
ocfs2: drop acl cache for directories too
Subsystem: scripts
Miles Chen <miles.chen@mediatek.com>:
scripts/sorttable: riscv: fix undeclared identifier 'EM_RISCV' error
Subsystem: mm/tools
Changbin Du <changbin.du@gmail.com>:
tools/vm/page-types: remove dependency on opt_file for idle page tracking
Subsystem: lib
Paul Menzel <pmenzel@molgen.mpg.de>:
lib/zlib_inflate/inffast: check config in C to avoid unused function warning
Subsystem: mm/pagecache
Minchan Kim <minchan@kernel.org>:
mm: fs: invalidate bh_lrus for only cold path
Subsystem: mm/debug
Weizhao Ouyang <o451686892@gmail.com>:
mm/debug: sync up MR_CONTIG_RANGE and MR_LONGTERM_PIN
mm/debug: sync up latest migrate_reason to migrate_reason_names
Subsystem: sh
Geert Uytterhoeven <geert+renesas@glider.be>:
sh: pgtable-3level: fix cast to pointer from integer of different size
Subsystem: mm/kasan
Nathan Chancellor <nathan@kernel.org>:
kasan: always respect CONFIG_KASAN_STACK
Subsystem: mm/memory-failure
Qi Zheng <zhengqi.arch@bytedance.com>:
mm/memory_failure: fix the missing pte_unmap() call
Subsystem: mm/pagemap
Chen Jun <chenjun102@huawei.com>:
mm: fix uninitialized use in overcommit_policy_handler
arch/sh/include/asm/pgtable-3level.h | 2 +-
fs/buffer.c | 8 ++++++--
fs/ocfs2/dlmglue.c | 3 ++-
include/linux/buffer_head.h | 4 ++--
include/linux/migrate.h | 6 +++++-
lib/Kconfig.debug | 2 +-
lib/Kconfig.kasan | 2 ++
lib/zlib_inflate/inffast.c | 13 ++++++-------
mm/damon/dbgfs-test.h | 16 ++++++++--------
mm/debug.c | 4 +++-
mm/memory-failure.c | 12 ++++++------
mm/shmem.c | 4 ++--
mm/swap.c | 19 ++++++++++++++++---
mm/util.c | 4 ++--
scripts/Makefile.kasan | 3 ++-
scripts/sorttable.c | 4 ++++
tools/vm/page-types.c | 2 +-
17 files changed, 69 insertions(+), 39 deletions(-)
^ permalink raw reply [flat|nested] 232+ messages in thread
* incoming
@ 2021-10-18 22:14 Andrew Morton
0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2021-10-18 22:14 UTC (permalink / raw)
To: Linus Torvalds; +Cc: linux-mm, mm-commits
19 patches, based on 519d81956ee277b4419c723adfb154603c2565ba.
Subsystems affected by this patch series:
mm/userfaultfd
mm/migration
ocfs2
mm/memblock
mm/mempolicy
mm/slub
binfmt
vfs
mm/secretmem
mm/thp
misc
Subsystem: mm/userfaultfd
Peter Xu <peterx@redhat.com>:
mm/userfaultfd: selftests: fix memory corruption with thp enabled
Nadav Amit <namit@vmware.com>:
userfaultfd: fix a race between writeprotect and exit_mmap()
Subsystem: mm/migration
Dave Hansen <dave.hansen@linux.intel.com>:
Patch series "mm/migrate: 5.15 fixes for automatic demotion", v2:
mm/migrate: optimize hotplug-time demotion order updates
mm/migrate: add CPU hotplug to demotion #ifdef
Huang Ying <ying.huang@intel.com>:
mm/migrate: fix CPUHP state to update node demotion order
Subsystem: ocfs2
Jan Kara <jack@suse.cz>:
ocfs2: fix data corruption after conversion from inline format
Valentin Vidic <vvidic@valentin-vidic.from.hr>:
ocfs2: mount fails with buffer overflow in strlen
Subsystem: mm/memblock
Peng Fan <peng.fan@nxp.com>:
memblock: check memory total_size
Subsystem: mm/mempolicy
Eric Dumazet <edumazet@google.com>:
mm/mempolicy: do not allow illegal MPOL_F_NUMA_BALANCING | MPOL_LOCAL in mbind()
Subsystem: mm/slub
Miaohe Lin <linmiaohe@huawei.com>:
Patch series "Fixups for slub":
mm, slub: fix two bugs in slab_debug_trace_open()
mm, slub: fix mismatch between reconstructed freelist depth and cnt
mm, slub: fix potential memoryleak in kmem_cache_open()
mm, slub: fix potential use-after-free in slab_debugfs_fops
mm, slub: fix incorrect memcg slab count for bulk free
Subsystem: binfmt
Lukas Bulwahn <lukas.bulwahn@gmail.com>:
elfcore: correct reference to CONFIG_UML
Subsystem: vfs
"Matthew Wilcox (Oracle)" <willy@infradead.org>:
vfs: check fd has read access in kernel_read_file_from_fd()
Subsystem: mm/secretmem
Sean Christopherson <seanjc@google.com>:
mm/secretmem: fix NULL page->mapping dereference in page_is_secretmem()
Subsystem: mm/thp
Marek Szyprowski <m.szyprowski@samsung.com>:
mm/thp: decrease nr_thps in file's mapping on THP split
Subsystem: misc
Andrej Shadura <andrew.shadura@collabora.co.uk>:
mailmap: add Andrej Shadura
.mailmap | 2 +
fs/kernel_read_file.c | 2 -
fs/ocfs2/alloc.c | 46 ++++++-----------------
fs/ocfs2/super.c | 14 +++++--
fs/userfaultfd.c | 12 ++++--
include/linux/cpuhotplug.h | 4 ++
include/linux/elfcore.h | 2 -
include/linux/memory.h | 5 ++
include/linux/secretmem.h | 2 -
mm/huge_memory.c | 6 ++-
mm/memblock.c | 2 -
mm/mempolicy.c | 16 ++------
mm/migrate.c | 62 ++++++++++++++++++-------------
mm/page_ext.c | 4 --
mm/slab.c | 4 +-
mm/slub.c | 31 ++++++++++++---
tools/testing/selftests/vm/userfaultfd.c | 23 ++++++++++-
17 files changed, 138 insertions(+), 99 deletions(-)
^ permalink raw reply [flat|nested] 232+ messages in thread
* incoming
@ 2021-10-28 21:35 Andrew Morton
0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2021-10-28 21:35 UTC (permalink / raw)
To: Linus Torvalds; +Cc: linux-mm, mm-commits
11 patches, based on 411a44c24a561e449b592ff631b7ae321f1eb559.
Subsystems affected by this patch series:
mm/memcg
mm/memory-failure
mm/oom-kill
ocfs2
mm/secretmem
mm/vmalloc
mm/hugetlb
mm/damon
mm/tools
Subsystem: mm/memcg
Shakeel Butt <shakeelb@google.com>:
memcg: page_alloc: skip bulk allocator for __GFP_ACCOUNT
Subsystem: mm/memory-failure
Yang Shi <shy828301@gmail.com>:
mm: hwpoison: remove the unnecessary THP check
mm: filemap: check if THP has hwpoisoned subpage for PMD page fault
Subsystem: mm/oom-kill
Suren Baghdasaryan <surenb@google.com>:
mm/oom_kill.c: prevent a race between process_mrelease and exit_mmap
Subsystem: ocfs2
Gautham Ananthakrishna <gautham.ananthakrishna@oracle.com>:
ocfs2: fix race between searching chunks and release journal_head from buffer_head
Subsystem: mm/secretmem
Kees Cook <keescook@chromium.org>:
mm/secretmem: avoid letting secretmem_users drop to zero
Subsystem: mm/vmalloc
Chen Wandun <chenwandun@huawei.com>:
mm/vmalloc: fix numa spreading for large hash tables
Subsystem: mm/hugetlb
Rongwei Wang <rongwei.wang@linux.alibaba.com>:
mm, thp: bail out early in collapse_file for writeback page
Yang Shi <shy828301@gmail.com>:
mm: khugepaged: skip huge page collapse for special files
Subsystem: mm/damon
SeongJae Park <sj@kernel.org>:
mm/damon/core-test: fix wrong expectations for 'damon_split_regions_of()'
Subsystem: mm/tools
David Yang <davidcomponentone@gmail.com>:
tools/testing/selftests/vm/split_huge_page_test.c: fix application of sizeof to pointer
fs/ocfs2/suballoc.c | 22 ++++++++++-------
include/linux/page-flags.h | 23 ++++++++++++++++++
mm/damon/core-test.h | 4 +--
mm/huge_memory.c | 2 +
mm/khugepaged.c | 26 +++++++++++++-------
mm/memory-failure.c | 28 +++++++++++-----------
mm/memory.c | 9 +++++++
mm/oom_kill.c | 23 +++++++++---------
mm/page_alloc.c | 8 +++++-
mm/secretmem.c | 2 -
mm/vmalloc.c | 15 +++++++----
tools/testing/selftests/vm/split_huge_page_test.c | 2 -
12 files changed, 110 insertions(+), 54 deletions(-)
^ permalink raw reply [flat|nested] 232+ messages in thread
* incoming
@ 2021-11-05 20:34 Andrew Morton
0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2021-11-05 20:34 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm
262 patches, based on 8bb7eca972ad531c9b149c0a51ab43a417385813
Subsystems affected by this patch series:
scripts
ocfs2
vfs
mm/slab-generic
mm/slab
mm/slub
mm/kconfig
mm/dax
mm/kasan
mm/debug
mm/pagecache
mm/gup
mm/swap
mm/memcg
mm/pagemap
mm/mprotect
mm/mremap
mm/iomap
mm/tracing
mm/vmalloc
mm/pagealloc
mm/memory-failure
mm/hugetlb
mm/userfaultfd
mm/vmscan
mm/tools
mm/memblock
mm/oom-kill
mm/hugetlbfs
mm/migration
mm/thp
mm/readahead
mm/nommu
mm/ksm
mm/vmstat
mm/madvise
mm/memory-hotplug
mm/rmap
mm/zsmalloc
mm/highmem
mm/zram
mm/cleanups
mm/kfence
mm/damon
Subsystem: scripts
Colin Ian King <colin.king@canonical.com>:
scripts/spelling.txt: add more spellings to spelling.txt
Sven Eckelmann <sven@narfation.org>:
scripts/spelling.txt: fix "mistake" version of "synchronization"
weidonghui <weidonghui@allwinnertech.com>:
scripts/decodecode: fix faulting instruction no print when opps.file is DOS format
Subsystem: ocfs2
Chenyuan Mi <cymi20@fudan.edu.cn>:
ocfs2: fix handle refcount leak in two exception handling paths
Valentin Vidic <vvidic@valentin-vidic.from.hr>:
ocfs2: cleanup journal init and shutdown
Colin Ian King <colin.king@canonical.com>:
ocfs2/dlm: remove redundant assignment of variable ret
Jan Kara <jack@suse.cz>:
Patch series "ocfs2: Truncate data corruption fix":
ocfs2: fix data corruption on truncate
ocfs2: do not zero pages beyond i_size
Subsystem: vfs
Arnd Bergmann <arnd@arndb.de>:
fs/posix_acl.c: avoid -Wempty-body warning
Jia He <justin.he@arm.com>:
d_path: fix Kernel doc validator complaining
Subsystem: mm/slab-generic
"Matthew Wilcox (Oracle)" <willy@infradead.org>:
mm: move kvmalloc-related functions to slab.h
Subsystem: mm/slab
Shi Lei <shi_lei@massclouds.com>:
mm/slab.c: remove useless lines in enable_cpucache()
Subsystem: mm/slub
Kefeng Wang <wangkefeng.wang@huawei.com>:
slub: add back check for free nonslab objects
Vlastimil Babka <vbabka@suse.cz>:
mm, slub: change percpu partial accounting from objects to pages
mm/slub: increase default cpu partial list sizes
Hyeonggon Yoo <42.hyeyoo@gmail.com>:
mm, slub: use prefetchw instead of prefetch
Subsystem: mm/kconfig
Sebastian Andrzej Siewior <bigeasy@linutronix.de>:
mm: disable NUMA_BALANCING_DEFAULT_ENABLED and TRANSPARENT_HUGEPAGE on PREEMPT_RT
Subsystem: mm/dax
Christoph Hellwig <hch@lst.de>:
mm: don't include <linux/dax.h> in <linux/mempolicy.h>
Subsystem: mm/kasan
Marco Elver <elver@google.com>:
Patch series "stackdepot, kasan, workqueue: Avoid expanding stackdepot slabs when holding raw_spin_lock", v2:
lib/stackdepot: include gfp.h
lib/stackdepot: remove unused function argument
lib/stackdepot: introduce __stack_depot_save()
kasan: common: provide can_alloc in kasan_save_stack()
kasan: generic: introduce kasan_record_aux_stack_noalloc()
workqueue, kasan: avoid alloc_pages() when recording stack
"Matthew Wilcox (Oracle)" <willy@infradead.org>:
kasan: fix tag for large allocations when using CONFIG_SLAB
Peter Collingbourne <pcc@google.com>:
kasan: test: add memcpy test that avoids out-of-bounds write
Subsystem: mm/debug
Peter Xu <peterx@redhat.com>:
Patch series "mm/smaps: Fixes and optimizations on shmem swap handling":
mm/smaps: fix shmem pte hole swap calculation
mm/smaps: use vma->vm_pgoff directly when counting partial swap
mm/smaps: simplify shmem handling of pte holes
Guo Ren <guoren@linux.alibaba.com>:
mm: debug_vm_pgtable: don't use __P000 directly
Kees Cook <keescook@chromium.org>:
kasan: test: bypass __alloc_size checks
Patch series "Add __alloc_size()", v3:
rapidio: avoid bogus __alloc_size warning
Compiler Attributes: add __alloc_size() for better bounds checking
slab: clean up function prototypes
slab: add __alloc_size attributes for better bounds checking
mm/kvmalloc: add __alloc_size attributes for better bounds checking
mm/vmalloc: add __alloc_size attributes for better bounds checking
mm/page_alloc: add __alloc_size attributes for better bounds checking
percpu: add __alloc_size attributes for better bounds checking
Yinan Zhang <zhangyinan2019@email.szu.edu.cn>:
mm/page_ext.c: fix a comment
Subsystem: mm/pagecache
David Howells <dhowells@redhat.com>:
mm: stop filemap_read() from grabbing a superfluous page
Christoph Hellwig <hch@lst.de>:
Patch series "simplify bdi unregistation":
mm: export bdi_unregister
mtd: call bdi_unregister explicitly
fs: explicitly unregister per-superblock BDIs
mm: don't automatically unregister bdis
mm: simplify bdi refcounting
Jens Axboe <axboe@kernel.dk>:
mm: don't read i_size of inode unless we need it
"Matthew Wilcox (Oracle)" <willy@infradead.org>:
mm/filemap.c: remove bogus VM_BUG_ON
Jens Axboe <axboe@kernel.dk>:
mm: move more expensive part of XA setup out of mapping check
Subsystem: mm/gup
John Hubbard <jhubbard@nvidia.com>:
mm/gup: further simplify __gup_device_huge()
Subsystem: mm/swap
Xu Wang <vulab@iscas.ac.cn>:
mm/swapfile: remove needless request_queue NULL pointer check
Rafael Aquini <aquini@redhat.com>:
mm/swapfile: fix an integer overflow in swap_show()
"Matthew Wilcox (Oracle)" <willy@infradead.org>:
mm: optimise put_pages_list()
Subsystem: mm/memcg
Peter Xu <peterx@redhat.com>:
mm/memcg: drop swp_entry_t* in mc_handle_file_pte()
Shakeel Butt <shakeelb@google.com>:
memcg: flush stats only if updated
memcg: unify memcg stat flushing
Waiman Long <longman@redhat.com>:
mm/memcg: remove obsolete memcg_free_kmem()
Len Baker <len.baker@gmx.com>:
mm/list_lru.c: prefer struct_size over open coded arithmetic
Shakeel Butt <shakeelb@google.com>:
memcg, kmem: further deprecate kmem.limit_in_bytes
Muchun Song <songmuchun@bytedance.com>:
mm: list_lru: remove holding lru lock
mm: list_lru: fix the return value of list_lru_count_one()
mm: memcontrol: remove kmemcg_id reparenting
mm: memcontrol: remove the kmem states
mm: list_lru: only add memcg-aware lrus to the global lru list
Vasily Averin <vvs@virtuozzo.com>:
Patch series "memcg: prohibit unconditional exceeding the limit of dying tasks", v3:
mm, oom: pagefault_out_of_memory: don't force global OOM for dying tasks
Michal Hocko <mhocko@suse.com>:
mm, oom: do not trigger out_of_memory from the #PF
Vasily Averin <vvs@virtuozzo.com>:
memcg: prohibit unconditional exceeding the limit of dying tasks
Subsystem: mm/pagemap
Peng Liu <liupeng256@huawei.com>:
mm/mmap.c: fix a data race of mm->total_vm
Rolf Eike Beer <eb@emlix.com>:
mm: use __pfn_to_section() instead of open coding it
Amit Daniel Kachhap <amit.kachhap@arm.com>:
mm/memory.c: avoid unnecessary kernel/user pointer conversion
Nadav Amit <namit@vmware.com>:
mm/memory.c: use correct VMA flags when freeing page-tables
Peter Xu <peterx@redhat.com>:
Patch series "mm: A few cleanup patches around zap, shmem and uffd", v4:
mm/shmem: unconditionally set pte dirty in mfill_atomic_install_pte
mm: clear vmf->pte after pte_unmap_same() returns
mm: drop first_index/last_index in zap_details
mm: add zap_skip_check_mapping() helper
Qi Zheng <zhengqi.arch@bytedance.com>:
Patch series "Do some code cleanups related to mm", v3:
mm: introduce pmd_install() helper
mm: remove redundant smp_wmb()
Tiberiu A Georgescu <tiberiu.georgescu@nutanix.com>:
Documentation: update pagemap with shmem exceptions
Nicholas Piggin <npiggin@gmail.com>:
Patch series "shoot lazy tlbs", v4:
lazy tlb: introduce lazy mm refcount helper functions
lazy tlb: allow lazy tlb mm refcounting to be configurable
lazy tlb: shoot lazies, a non-refcounting lazy tlb option
powerpc/64s: enable MMU_LAZY_TLB_SHOOTDOWN
Lukas Bulwahn <lukas.bulwahn@gmail.com>:
memory: remove unused CONFIG_MEM_BLOCK_SIZE
Subsystem: mm/mprotect
Liu Song <liu.song11@zte.com.cn>:
mm/mprotect.c: avoid repeated assignment in do_mprotect_pkey()
Subsystem: mm/mremap
Dmitry Safonov <dima@arista.com>:
mm/mremap: don't account pages in vma_to_resize()
Subsystem: mm/iomap
Lucas De Marchi <lucas.demarchi@intel.com>:
include/linux/io-mapping.h: remove fallback for writecombine
Subsystem: mm/tracing
Gang Li <ligang.bdlg@bytedance.com>:
mm: mmap_lock: remove redundant newline in TP_printk
mm: mmap_lock: use DECLARE_EVENT_CLASS and DEFINE_EVENT_FN
Subsystem: mm/vmalloc
Vasily Averin <vvs@virtuozzo.com>:
mm/vmalloc: repair warn_alloc()s in __vmalloc_area_node()
Peter Zijlstra <peterz@infradead.org>:
mm/vmalloc: don't allow VM_NO_GUARD on vmap()
Eric Dumazet <edumazet@google.com>:
mm/vmalloc: make show_numa_info() aware of hugepage mappings
mm/vmalloc: make sure to dump unpurged areas in /proc/vmallocinfo
"Uladzislau Rezki (Sony)" <urezki@gmail.com>:
mm/vmalloc: do not adjust the search size for alignment overhead
mm/vmalloc: check various alignments when debugging
Vasily Averin <vvs@virtuozzo.com>:
vmalloc: back off when the current task is OOM-killed
Kefeng Wang <wangkefeng.wang@huawei.com>:
vmalloc: choose a better start address in vm_area_register_early()
arm64: support page mapping percpu first chunk allocator
kasan: arm64: fix pcpu_page_first_chunk crash with KASAN_VMALLOC
Michal Hocko <mhocko@suse.com>:
mm/vmalloc: be more explicit about supported gfp flags
Chen Wandun <chenwandun@huawei.com>:
mm/vmalloc: introduce alloc_pages_bulk_array_mempolicy to accelerate memory allocation
Changcheng Deng <deng.changcheng@zte.com.cn>:
lib/test_vmalloc.c: use swap() to make code cleaner
Subsystem: mm/pagealloc
Eric Dumazet <edumazet@google.com>:
mm/large system hash: avoid possible NULL deref in alloc_large_system_hash
Miaohe Lin <linmiaohe@huawei.com>:
Patch series "Cleanups and fixup for page_alloc", v2:
mm/page_alloc.c: remove meaningless VM_BUG_ON() in pindex_to_order()
mm/page_alloc.c: simplify the code by using macro K()
mm/page_alloc.c: fix obsolete comment in free_pcppages_bulk()
mm/page_alloc.c: use helper function zone_spans_pfn()
mm/page_alloc.c: avoid allocating highmem pages via alloc_pages_exact[_nid]
Bharata B Rao <bharata@amd.com>:
Patch series "Fix NUMA nodes fallback list ordering":
mm/page_alloc: print node fallback order
Krupa Ramakrishnan <krupa.ramakrishnan@amd.com>:
mm/page_alloc: use accumulated load when building node fallback list
Geert Uytterhoeven <geert+renesas@glider.be>:
Patch series "Fix NUMA without SMP":
mm: move node_reclaim_distance to fix NUMA without SMP
mm: move fold_vm_numa_events() to fix NUMA without SMP
Eric Dumazet <edumazet@google.com>:
mm/page_alloc.c: do not acquire zone lock in is_free_buddy_page()
Feng Tang <feng.tang@intel.com>:
mm/page_alloc: detect allocation forbidden by cpuset and bail out early
Liangcai Fan <liangcaifan19@gmail.com>:
mm/page_alloc.c: show watermark_boost of zone in zoneinfo
Christophe Leroy <christophe.leroy@csgroup.eu>:
mm: create a new system state and fix core_kernel_text()
mm: make generic arch_is_kernel_initmem_freed() do what it says
powerpc: use generic version of arch_is_kernel_initmem_freed()
s390: use generic version of arch_is_kernel_initmem_freed()
Sebastian Andrzej Siewior <bigeasy@linutronix.de>:
mm: page_alloc: use migrate_disable() in drain_local_pages_wq()
Wang ShaoBo <bobo.shaobowang@huawei.com>:
mm/page_alloc: use clamp() to simplify code
Subsystem: mm/memory-failure
Marco Elver <elver@google.com>:
mm: fix data race in PagePoisoned()
Rikard Falkeborn <rikard.falkeborn@gmail.com>:
mm/memory_failure: constify static mm_walk_ops
Yang Shi <shy828301@gmail.com>:
Patch series "Solve silent data loss caused by poisoned page cache (shmem/tmpfs)", v5:
mm: filemap: coding style cleanup for filemap_map_pmd()
mm: hwpoison: refactor refcount check handling
mm: shmem: don't truncate page if memory failure happens
mm: hwpoison: handle non-anonymous THP correctly
Subsystem: mm/hugetlb
Peter Xu <peterx@redhat.com>:
mm/hugetlb: drop __unmap_hugepage_range definition from hugetlb.h
Mike Kravetz <mike.kravetz@oracle.com>:
Patch series "hugetlb: add demote/split page functionality", v4:
hugetlb: add demote hugetlb page sysfs interfaces
mm/cma: add cma_pages_valid to determine if pages are in CMA
hugetlb: be sure to free demoted CMA pages to CMA
hugetlb: add demote bool to gigantic page routines
hugetlb: add hugetlb demote page support
Liangcai Fan <liangcaifan19@gmail.com>:
mm: khugepaged: recalculate min_free_kbytes after stopping khugepaged
Mina Almasry <almasrymina@google.com>:
mm, hugepages: add mremap() support for hugepage backed vma
mm, hugepages: add hugetlb vma mremap() test
Baolin Wang <baolin.wang@linux.alibaba.com>:
hugetlb: support node specified when using cma for gigantic hugepages
Ran Jianping <ran.jianping@zte.com.cn>:
mm: remove duplicate include in hugepage-mremap.c
Baolin Wang <baolin.wang@linux.alibaba.com>:
Patch series "Some cleanups and improvements for hugetlb":
hugetlb_cgroup: remove unused hugetlb_cgroup_from_counter macro
hugetlb: replace the obsolete hugetlb_instantiation_mutex in the comments
hugetlb: remove redundant validation in has_same_uncharge_info()
hugetlb: remove redundant VM_BUG_ON() in add_reservation_in_range()
Mike Kravetz <mike.kravetz@oracle.com>:
hugetlb: remove unnecessary set_page_count in prep_compound_gigantic_page
Subsystem: mm/userfaultfd
Axel Rasmussen <axelrasmussen@google.com>:
Patch series "Small userfaultfd selftest fixups", v2:
userfaultfd/selftests: don't rely on GNU extensions for random numbers
userfaultfd/selftests: fix feature support detection
userfaultfd/selftests: fix calculation of expected ioctls
Subsystem: mm/vmscan
Miaohe Lin <linmiaohe@huawei.com>:
mm/page_isolation: fix potential missing call to unset_migratetype_isolate()
mm/page_isolation: guard against possible putback unisolated page
Kai Song <songkai01@inspur.com>:
mm/vmscan.c: fix -Wunused-but-set-variable warning
Mel Gorman <mgorman@techsingularity.net>:
Patch series "Remove dependency on congestion_wait in mm/", v5. Patch series:
mm/vmscan: throttle reclaim until some writeback completes if congested
mm/vmscan: throttle reclaim and compaction when too may pages are isolated
mm/vmscan: throttle reclaim when no progress is being made
mm/writeback: throttle based on page writeback instead of congestion
mm/page_alloc: remove the throttling logic from the page allocator
mm/vmscan: centralise timeout values for reclaim_throttle
mm/vmscan: increase the timeout if page reclaim is not making progress
mm/vmscan: delay waking of tasks throttled on NOPROGRESS
Yuanzheng Song <songyuanzheng@huawei.com>:
mm/vmpressure: fix data-race with memcg->socket_pressure
Subsystem: mm/tools
Zhenliang Wei <weizhenliang@huawei.com>:
tools/vm/page_owner_sort.c: count and sort by mem
Naoya Horiguchi <naoya.horiguchi@nec.com>:
Patch series "tools/vm/page-types.c: a few improvements":
tools/vm/page-types.c: make walk_file() aware of address range option
tools/vm/page-types.c: move show_file() to summary output
tools/vm/page-types.c: print file offset in hexadecimal
Subsystem: mm/memblock
Mike Rapoport <rppt@linux.ibm.com>:
Patch series "memblock: cleanup memblock_free interface", v2:
arch_numa: simplify numa_distance allocation
xen/x86: free_p2m_page: use memblock_free_ptr() to free a virtual pointer
memblock: drop memblock_free_early_nid() and memblock_free_early()
memblock: stop aliasing __memblock_free_late with memblock_free_late
memblock: rename memblock_free to memblock_phys_free
memblock: use memblock_free for freeing virtual pointers
Subsystem: mm/oom-kill
Sultan Alsawaf <sultan@kerneltoast.com>:
mm: mark the OOM reaper thread as freezable
Subsystem: mm/hugetlbfs
Zhenguo Yao <yaozhenguo1@gmail.com>:
hugetlbfs: extend the definition of hugepages parameter to support node allocation
Subsystem: mm/migration
John Hubbard <jhubbard@nvidia.com>:
mm/migrate: de-duplicate migrate_reason strings
Yang Shi <shy828301@gmail.com>:
mm: migrate: make demotion knob depend on migration
Subsystem: mm/thp
"George G. Davis" <davis.george@siemens.com>:
selftests/vm/transhuge-stress: fix ram size thinko
Rongwei Wang <rongwei.wang@linux.alibaba.com>:
Patch series "fix two bugs for file THP":
mm, thp: lock filemap when truncating page cache
mm, thp: fix incorrect unmap behavior for private pages
Subsystem: mm/readahead
Lin Feng <linf@wangsu.com>:
mm/readahead.c: fix incorrect comments for get_init_ra_size
Subsystem: mm/nommu
Kefeng Wang <wangkefeng.wang@huawei.com>:
mm: nommu: kill arch_get_unmapped_area()
Subsystem: mm/ksm
"Aneesh Kumar K.V" <aneesh.kumar@linux.ibm.com>:
selftest/vm: fix ksm selftest to run with different NUMA topologies
Pedro Demarchi Gomes <pedrodemargomes@gmail.com>:
selftests: vm: add KSM huge pages merging time test
Subsystem: mm/vmstat
Liu Shixin <liushixin2@huawei.com>:
mm/vmstat: annotate data race for zone->free_area[order].nr_free
Lin Feng <linf@wangsu.com>:
mm: vmstat.c: make extfrag_index show more pretty
Subsystem: mm/madvise
David Hildenbrand <david@redhat.com>:
selftests/vm: make MADV_POPULATE_(READ|WRITE) use in-tree headers
Subsystem: mm/memory-hotplug
Tang Yizhou <tangyizhou@huawei.com>:
mm/memory_hotplug: add static qualifier for online_policy_to_str()
David Hildenbrand <david@redhat.com>:
Patch series "memory-hotplug.rst: document the "auto-movable" online policy":
memory-hotplug.rst: fix two instances of "movablecore" that should be "movable_node"
memory-hotplug.rst: fix wrong /sys/module/memory_hotplug/parameters/ path
memory-hotplug.rst: document the "auto-movable" online policy
Patch series "mm/memory_hotplug: Kconfig and 32 bit cleanups":
mm/memory_hotplug: remove CONFIG_X86_64_ACPI_NUMA dependency from CONFIG_MEMORY_HOTPLUG
mm/memory_hotplug: remove CONFIG_MEMORY_HOTPLUG_SPARSE
mm/memory_hotplug: restrict CONFIG_MEMORY_HOTPLUG to 64 bit
mm/memory_hotplug: remove HIGHMEM leftovers
mm/memory_hotplug: remove stale function declarations
x86: remove memory hotplug support on X86_32
Patch series "mm/memory_hotplug: full support for add_memory_driver_managed() with CONFIG_ARCH_KEEP_MEMBLOCK", v2:
mm/memory_hotplug: handle memblock_add_node() failures in add_memory_resource()
memblock: improve MEMBLOCK_HOTPLUG documentation
memblock: allow to specify flags with memblock_add_node()
memblock: add MEMBLOCK_DRIVER_MANAGED to mimic IORESOURCE_SYSRAM_DRIVER_MANAGED
mm/memory_hotplug: indicate MEMBLOCK_DRIVER_MANAGED with IORESOURCE_SYSRAM_DRIVER_MANAGED
Subsystem: mm/rmap
Alistair Popple <apopple@nvidia.com>:
mm/rmap.c: avoid double faults migrating device private pages
Subsystem: mm/zsmalloc
Miaohe Lin <linmiaohe@huawei.com>:
mm/zsmalloc.c: close race window between zs_pool_dec_isolated() and zs_unregister_migration()
Subsystem: mm/highmem
Ira Weiny <ira.weiny@intel.com>:
mm/highmem: remove deprecated kmap_atomic
Subsystem: mm/zram
Jaewon Kim <jaewon31.kim@samsung.com>:
zram_drv: allow reclaim on bio_alloc
Dan Carpenter <dan.carpenter@oracle.com>:
zram: off by one in read_block_state()
Brian Geffon <bgeffon@google.com>:
zram: introduce an aged idle interface
Subsystem: mm/cleanups
Stephen Kitt <steve@sk2.org>:
mm: remove HARDENED_USERCOPY_FALLBACK
Mianhan Liu <liumh1@shanghaitech.edu.cn>:
include/linux/mm.h: move nr_free_buffer_pages from swap.h to mm.h
Subsystem: mm/kfence
Marco Elver <elver@google.com>:
stacktrace: move filter_irq_stacks() to kernel/stacktrace.c
kfence: count unexpectedly skipped allocations
kfence: move saving stack trace of allocations into __kfence_alloc()
kfence: limit currently covered allocations when pool nearly full
kfence: add note to documentation about skipping covered allocations
kfence: test: use kunit_skip() to skip tests
kfence: shorten critical sections of alloc/free
kfence: always use static branches to guard kfence_alloc()
kfence: default to dynamic branch instead of static keys mode
Subsystem: mm/damon
Geert Uytterhoeven <geert@linux-m68k.org>:
mm/damon: grammar s/works/work/
SeongJae Park <sjpark@amazon.de>:
Documentation/vm: move user guides to admin-guide/mm/
SeongJae Park <sj@kernel.org>:
MAINTAINERS: update SeongJae's email address
SeongJae Park <sjpark@amazon.de>:
docs/vm/damon: remove broken reference
include/linux/damon.h: fix kernel-doc comments for 'damon_callback'
SeongJae Park <sj@kernel.org>:
mm/damon/core: print kdamond start log in debug mode only
Changbin Du <changbin.du@gmail.com>:
mm/damon: remove unnecessary do_exit() from kdamond
mm/damon: needn't hold kdamond_lock to print pid of kdamond
Colin Ian King <colin.king@canonical.com>:
mm/damon/core: nullify pointer ctx->kdamond with a NULL
SeongJae Park <sj@kernel.org>:
Patch series "Implement Data Access Monitoring-based Memory Operation Schemes":
mm/damon/core: account age of target regions
mm/damon/core: implement DAMON-based Operation Schemes (DAMOS)
mm/damon/vaddr: support DAMON-based Operation Schemes
mm/damon/dbgfs: support DAMON-based Operation Schemes
mm/damon/schemes: implement statistics feature
selftests/damon: add 'schemes' debugfs tests
Docs/admin-guide/mm/damon: document DAMON-based Operation Schemes
Patch series "DAMON: Support Physical Memory Address Space Monitoring::
mm/damon/dbgfs: allow users to set initial monitoring target regions
mm/damon/dbgfs-test: add a unit test case for 'init_regions'
Docs/admin-guide/mm/damon: document 'init_regions' feature
mm/damon/vaddr: separate commonly usable functions
mm/damon: implement primitives for physical address space monitoring
mm/damon/dbgfs: support physical memory monitoring
Docs/DAMON: document physical memory monitoring support
Rikard Falkeborn <rikard.falkeborn@gmail.com>:
mm/damon/vaddr: constify static mm_walk_ops
Rongwei Wang <rongwei.wang@linux.alibaba.com>:
mm/damon/dbgfs: remove unnecessary variables
SeongJae Park <sj@kernel.org>:
mm/damon/paddr: support the pageout scheme
mm/damon/schemes: implement size quota for schemes application speed control
mm/damon/schemes: skip already charged targets and regions
mm/damon/schemes: implement time quota
mm/damon/dbgfs: support quotas of schemes
mm/damon/selftests: support schemes quotas
mm/damon/schemes: prioritize regions within the quotas
mm/damon/vaddr,paddr: support pageout prioritization
mm/damon/dbgfs: support prioritization weights
tools/selftests/damon: update for regions prioritization of schemes
mm/damon/schemes: activate schemes based on a watermarks mechanism
mm/damon/dbgfs: support watermarks
selftests/damon: support watermarks
mm/damon: introduce DAMON-based Reclamation (DAMON_RECLAIM)
Documentation/admin-guide/mm/damon: add a document for DAMON_RECLAIM
Xin Hao <xhao@linux.alibaba.com>:
Patch series "mm/damon: Fix some small bugs", v4:
mm/damon: remove unnecessary variable initialization
mm/damon/dbgfs: add adaptive_targets list check before enable monitor_on
SeongJae Park <sj@kernel.org>:
Patch series "Fix trivial nits in Documentation/admin-guide/mm":
Docs/admin-guide/mm/damon/start: fix wrong example commands
Docs/admin-guide/mm/damon/start: fix a wrong link
Docs/admin-guide/mm/damon/start: simplify the content
Docs/admin-guide/mm/pagemap: wordsmith page flags descriptions
Changbin Du <changbin.du@gmail.com>:
mm/damon: simplify stop mechanism
Colin Ian King <colin.i.king@googlemail.com>:
mm/damon: fix a few spelling mistakes in comments and a pr_debug message
Changbin Du <changbin.du@gmail.com>:
mm/damon: remove return value from before_terminate callback
a/Documentation/admin-guide/blockdev/zram.rst | 8
a/Documentation/admin-guide/cgroup-v1/memory.rst | 11
a/Documentation/admin-guide/kernel-parameters.txt | 14
a/Documentation/admin-guide/mm/damon/index.rst | 1
a/Documentation/admin-guide/mm/damon/reclaim.rst | 235 +++
a/Documentation/admin-guide/mm/damon/start.rst | 140 +
a/Documentation/admin-guide/mm/damon/usage.rst | 117 +
a/Documentation/admin-guide/mm/hugetlbpage.rst | 42
a/Documentation/admin-guide/mm/memory-hotplug.rst | 147 +-
a/Documentation/admin-guide/mm/pagemap.rst | 75 -
a/Documentation/core-api/memory-hotplug.rst | 3
a/Documentation/dev-tools/kfence.rst | 23
a/Documentation/translations/zh_CN/core-api/memory-hotplug.rst | 4
a/Documentation/vm/damon/design.rst | 29
a/Documentation/vm/damon/faq.rst | 5
a/Documentation/vm/damon/index.rst | 1
a/Documentation/vm/page_owner.rst | 23
a/MAINTAINERS | 2
a/Makefile | 15
a/arch/Kconfig | 28
a/arch/alpha/kernel/core_irongate.c | 6
a/arch/arc/mm/init.c | 6
a/arch/arm/mach-hisi/platmcpm.c | 2
a/arch/arm/mach-rpc/ecard.c | 2
a/arch/arm/mm/init.c | 2
a/arch/arm64/Kconfig | 4
a/arch/arm64/mm/kasan_init.c | 16
a/arch/arm64/mm/mmu.c | 4
a/arch/ia64/mm/contig.c | 2
a/arch/ia64/mm/init.c | 2
a/arch/m68k/mm/mcfmmu.c | 3
a/arch/m68k/mm/motorola.c | 6
a/arch/mips/loongson64/init.c | 4
a/arch/mips/mm/init.c | 6
a/arch/mips/sgi-ip27/ip27-memory.c | 3
a/arch/mips/sgi-ip30/ip30-setup.c | 6
a/arch/powerpc/Kconfig | 1
a/arch/powerpc/configs/skiroot_defconfig | 1
a/arch/powerpc/include/asm/machdep.h | 2
a/arch/powerpc/include/asm/sections.h | 13
a/arch/powerpc/kernel/dt_cpu_ftrs.c | 8
a/arch/powerpc/kernel/paca.c | 8
a/arch/powerpc/kernel/setup-common.c | 4
a/arch/powerpc/kernel/setup_64.c | 6
a/arch/powerpc/kernel/smp.c | 2
a/arch/powerpc/mm/book3s64/radix_tlb.c | 4
a/arch/powerpc/mm/hugetlbpage.c | 9
a/arch/powerpc/platforms/powernv/pci-ioda.c | 4
a/arch/powerpc/platforms/powernv/setup.c | 4
a/arch/powerpc/platforms/pseries/setup.c | 2
a/arch/powerpc/platforms/pseries/svm.c | 9
a/arch/riscv/kernel/setup.c | 10
a/arch/s390/include/asm/sections.h | 12
a/arch/s390/kernel/setup.c | 11
a/arch/s390/kernel/smp.c | 6
a/arch/s390/kernel/uv.c | 2
a/arch/s390/mm/init.c | 3
a/arch/s390/mm/kasan_init.c | 2
a/arch/sh/boards/mach-ap325rxa/setup.c | 2
a/arch/sh/boards/mach-ecovec24/setup.c | 4
a/arch/sh/boards/mach-kfr2r09/setup.c | 2
a/arch/sh/boards/mach-migor/setup.c | 2
a/arch/sh/boards/mach-se/7724/setup.c | 4
a/arch/sparc/kernel/smp_64.c | 4
a/arch/um/kernel/mem.c | 4
a/arch/x86/Kconfig | 6
a/arch/x86/kernel/setup.c | 4
a/arch/x86/kernel/setup_percpu.c | 2
a/arch/x86/mm/init.c | 2
a/arch/x86/mm/init_32.c | 31
a/arch/x86/mm/kasan_init_64.c | 4
a/arch/x86/mm/numa.c | 2
a/arch/x86/mm/numa_emulation.c | 2
a/arch/x86/xen/mmu_pv.c | 8
a/arch/x86/xen/p2m.c | 4
a/arch/x86/xen/setup.c | 6
a/drivers/base/Makefile | 2
a/drivers/base/arch_numa.c | 96 +
a/drivers/base/node.c | 9
a/drivers/block/zram/zram_drv.c | 66
a/drivers/firmware/efi/memmap.c | 2
a/drivers/hwmon/occ/p9_sbe.c | 1
a/drivers/macintosh/smu.c | 2
a/drivers/mmc/core/mmc_test.c | 1
a/drivers/mtd/mtdcore.c | 1
a/drivers/of/kexec.c | 4
a/drivers/of/of_reserved_mem.c | 5
a/drivers/rapidio/devices/rio_mport_cdev.c | 9
a/drivers/s390/char/sclp_early.c | 4
a/drivers/usb/early/xhci-dbc.c | 10
a/drivers/virtio/Kconfig | 2
a/drivers/xen/swiotlb-xen.c | 4
a/fs/d_path.c | 8
a/fs/exec.c | 4
a/fs/ocfs2/alloc.c | 21
a/fs/ocfs2/dlm/dlmrecovery.c | 1
a/fs/ocfs2/file.c | 8
a/fs/ocfs2/inode.c | 4
a/fs/ocfs2/journal.c | 28
a/fs/ocfs2/journal.h | 3
a/fs/ocfs2/super.c | 40
a/fs/open.c | 16
a/fs/posix_acl.c | 3
a/fs/proc/task_mmu.c | 28
a/fs/super.c | 3
a/include/asm-generic/sections.h | 14
a/include/linux/backing-dev-defs.h | 3
a/include/linux/backing-dev.h | 1
a/include/linux/cma.h | 1
a/include/linux/compiler-gcc.h | 8
a/include/linux/compiler_attributes.h | 10
a/include/linux/compiler_types.h | 12
a/include/linux/cpuset.h | 17
a/include/linux/damon.h | 258 +++
a/include/linux/fs.h | 1
a/include/linux/gfp.h | 8
a/include/linux/highmem.h | 28
a/include/linux/hugetlb.h | 36
a/include/linux/io-mapping.h | 6
a/include/linux/kasan.h | 8
a/include/linux/kernel.h | 1
a/include/linux/kfence.h | 21
a/include/linux/memblock.h | 48
a/include/linux/memcontrol.h | 9
a/include/linux/memory.h | 26
a/include/linux/memory_hotplug.h | 3
a/include/linux/mempolicy.h | 5
a/include/linux/migrate.h | 23
a/include/linux/migrate_mode.h | 13
a/include/linux/mm.h | 57
a/include/linux/mm_types.h | 2
a/include/linux/mmzone.h | 41
a/include/linux/node.h | 4
a/include/linux/page-flags.h | 2
a/include/linux/percpu.h | 6
a/include/linux/sched/mm.h | 25
a/include/linux/slab.h | 181 +-
a/include/linux/slub_def.h | 13
a/include/linux/stackdepot.h | 8
a/include/linux/stacktrace.h | 1
a/include/linux/swap.h | 1
a/include/linux/vmalloc.h | 24
a/include/trace/events/mmap_lock.h | 50
a/include/trace/events/vmscan.h | 42
a/include/trace/events/writeback.h | 7
a/init/Kconfig | 2
a/init/initramfs.c | 4
a/init/main.c | 6
a/kernel/cgroup/cpuset.c | 23
a/kernel/cpu.c | 2
a/kernel/dma/swiotlb.c | 6
a/kernel/exit.c | 2
a/kernel/extable.c | 2
a/kernel/fork.c | 51
a/kernel/kexec_file.c | 5
a/kernel/kthread.c | 21
a/kernel/locking/lockdep.c | 15
a/kernel/printk/printk.c | 4
a/kernel/sched/core.c | 37
a/kernel/sched/sched.h | 4
a/kernel/sched/topology.c | 1
a/kernel/stacktrace.c | 30
a/kernel/tsacct.c | 2
a/kernel/workqueue.c | 2
a/lib/Kconfig.debug | 2
a/lib/Kconfig.kfence | 26
a/lib/bootconfig.c | 2
a/lib/cpumask.c | 6
a/lib/stackdepot.c | 76 -
a/lib/test_kasan.c | 26
a/lib/test_kasan_module.c | 2
a/lib/test_vmalloc.c | 6
a/mm/Kconfig | 10
a/mm/backing-dev.c | 65
a/mm/cma.c | 26
a/mm/compaction.c | 12
a/mm/damon/Kconfig | 24
a/mm/damon/Makefile | 4
a/mm/damon/core.c | 500 ++++++-
a/mm/damon/dbgfs-test.h | 56
a/mm/damon/dbgfs.c | 486 +++++-
a/mm/damon/paddr.c | 275 +++
a/mm/damon/prmtv-common.c | 133 +
a/mm/damon/prmtv-common.h | 20
a/mm/damon/reclaim.c | 356 ++++
a/mm/damon/vaddr-test.h | 2
a/mm/damon/vaddr.c | 167 +-
a/mm/debug.c | 20
a/mm/debug_vm_pgtable.c | 7
a/mm/filemap.c | 78 -
a/mm/gup.c | 5
a/mm/highmem.c | 6
a/mm/hugetlb.c | 713 +++++++++-
a/mm/hugetlb_cgroup.c | 3
a/mm/internal.h | 26
a/mm/kasan/common.c | 8
a/mm/kasan/generic.c | 16
a/mm/kasan/kasan.h | 2
a/mm/kasan/shadow.c | 5
a/mm/kfence/core.c | 214 ++-
a/mm/kfence/kfence.h | 2
a/mm/kfence/kfence_test.c | 14
a/mm/khugepaged.c | 10
a/mm/list_lru.c | 58
a/mm/memblock.c | 35
a/mm/memcontrol.c | 217 +--
a/mm/memory-failure.c | 117 +
a/mm/memory.c | 166 +-
a/mm/memory_hotplug.c | 57
a/mm/mempolicy.c | 143 +-
a/mm/migrate.c | 61
a/mm/mmap.c | 2
a/mm/mprotect.c | 5
a/mm/mremap.c | 86 -
a/mm/nommu.c | 6
a/mm/oom_kill.c | 27
a/mm/page-writeback.c | 13
a/mm/page_alloc.c | 119 -
a/mm/page_ext.c | 2
a/mm/page_isolation.c | 29
a/mm/percpu.c | 24
a/mm/readahead.c | 2
a/mm/rmap.c | 8
a/mm/shmem.c | 44
a/mm/slab.c | 16
a/mm/slab_common.c | 8
a/mm/slub.c | 117 -
a/mm/sparse-vmemmap.c | 2
a/mm/sparse.c | 6
a/mm/swap.c | 23
a/mm/swapfile.c | 6
a/mm/userfaultfd.c | 8
a/mm/vmalloc.c | 107 +
a/mm/vmpressure.c | 2
a/mm/vmscan.c | 194 ++
a/mm/vmstat.c | 76 -
a/mm/zsmalloc.c | 7
a/net/ipv4/tcp.c | 1
a/net/ipv4/udp.c | 1
a/net/netfilter/ipvs/ip_vs_ctl.c | 1
a/net/openvswitch/meter.c | 1
a/net/sctp/protocol.c | 1
a/scripts/checkpatch.pl | 3
a/scripts/decodecode | 2
a/scripts/spelling.txt | 18
a/security/Kconfig | 14
a/tools/testing/selftests/damon/debugfs_attrs.sh | 25
a/tools/testing/selftests/memory-hotplug/config | 1
a/tools/testing/selftests/vm/.gitignore | 1
a/tools/testing/selftests/vm/Makefile | 1
a/tools/testing/selftests/vm/hugepage-mremap.c | 161 ++
a/tools/testing/selftests/vm/ksm_tests.c | 154 ++
a/tools/testing/selftests/vm/madv_populate.c | 15
a/tools/testing/selftests/vm/run_vmtests.sh | 11
a/tools/testing/selftests/vm/transhuge-stress.c | 2
a/tools/testing/selftests/vm/userfaultfd.c | 157 +-
a/tools/vm/page-types.c | 38
a/tools/vm/page_owner_sort.c | 94 +
b/Documentation/admin-guide/mm/index.rst | 2
b/Documentation/vm/index.rst | 26
260 files changed, 6448 insertions(+), 2327 deletions(-)
^ permalink raw reply [flat|nested] 232+ messages in thread
* incoming
@ 2021-11-09 2:30 Andrew Morton
0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2021-11-09 2:30 UTC (permalink / raw)
To: Linus Torvalds; +Cc: linux-mm, mm-commits
87 patches, based on 8bb7eca972ad531c9b149c0a51ab43a417385813, plus
previously sent material.
Subsystems affected by this patch series:
mm/pagecache
mm/hugetlb
procfs
misc
MAINTAINERS
lib
checkpatch
binfmt
kallsyms
ramfs
init
codafs
nilfs2
hfs
crash_dump
signals
seq_file
fork
sysvfs
kcov
gdb
resource
selftests
ipc
Subsystem: mm/pagecache
Johannes Weiner <hannes@cmpxchg.org>:
vfs: keep inodes with page cache off the inode shrinker LRU
Subsystem: mm/hugetlb
zhangyiru <zhangyiru3@huawei.com>:
mm,hugetlb: remove mlock ulimit for SHM_HUGETLB
Subsystem: procfs
Florian Weimer <fweimer@redhat.com>:
procfs: do not list TID 0 in /proc/<pid>/task
David Hildenbrand <david@redhat.com>:
x86/xen: update xen_oldmem_pfn_is_ram() documentation
x86/xen: simplify xen_oldmem_pfn_is_ram()
x86/xen: print a warning when HVMOP_get_mem_type fails
proc/vmcore: let pfn_is_ram() return a bool
proc/vmcore: convert oldmem_pfn_is_ram callback to more generic vmcore callbacks
virtio-mem: factor out hotplug specifics from virtio_mem_init() into virtio_mem_init_hotplug()
virtio-mem: factor out hotplug specifics from virtio_mem_probe() into virtio_mem_init_hotplug()
virtio-mem: factor out hotplug specifics from virtio_mem_remove() into virtio_mem_deinit_hotplug()
virtio-mem: kdump mode to sanitize /proc/vmcore access
Stephen Brennan <stephen.s.brennan@oracle.com>:
proc: allow pid_revalidate() during LOOKUP_RCU
Subsystem: misc
Andy Shevchenko <andriy.shevchenko@linux.intel.com>:
Patch series "kernel.h further split", v5:
kernel.h: drop unneeded <linux/kernel.h> inclusion from other headers
kernel.h: split out container_of() and typeof_member() macros
include/kunit/test.h: replace kernel.h with the necessary inclusions
include/linux/list.h: replace kernel.h with the necessary inclusions
include/linux/llist.h: replace kernel.h with the necessary inclusions
include/linux/plist.h: replace kernel.h with the necessary inclusions
include/media/media-entity.h: replace kernel.h with the necessary inclusions
include/linux/delay.h: replace kernel.h with the necessary inclusions
include/linux/sbitmap.h: replace kernel.h with the necessary inclusions
include/linux/radix-tree.h: replace kernel.h with the necessary inclusions
include/linux/generic-radix-tree.h: replace kernel.h with the necessary inclusions
Stephen Rothwell <sfr@canb.auug.org.au>:
kernel.h: split out instruction pointer accessors
Rasmus Villemoes <linux@rasmusvillemoes.dk>:
linux/container_of.h: switch to static_assert
Colin Ian King <colin.i.king@googlemail.com>:
mailmap: update email address for Colin King
Subsystem: MAINTAINERS
Kees Cook <keescook@chromium.org>:
MAINTAINERS: add "exec & binfmt" section with myself and Eric
Lukas Bulwahn <lukas.bulwahn@gmail.com>:
Patch series "Rectify file references for dt-bindings in MAINTAINERS", v5:
MAINTAINERS: rectify entry for ARM/TOSHIBA VISCONTI ARCHITECTURE
MAINTAINERS: rectify entry for HIKEY960 ONBOARD USB GPIO HUB DRIVER
MAINTAINERS: rectify entry for INTEL KEEM BAY DRM DRIVER
MAINTAINERS: rectify entry for ALLWINNER HARDWARE SPINLOCK SUPPORT
Subsystem: lib
Imran Khan <imran.f.khan@oracle.com>:
Patch series "lib, stackdepot: check stackdepot handle before accessing slabs", v2:
lib, stackdepot: check stackdepot handle before accessing slabs
lib, stackdepot: add helper to print stack entries
lib, stackdepot: add helper to print stack entries into buffer
Lucas De Marchi <lucas.demarchi@intel.com>:
include/linux/string_helpers.h: add linux/string.h for strlen()
Alexey Dobriyan <adobriyan@gmail.com>:
lib: uninline simple_strntoull() as well
Thomas Gleixner <tglx@linutronix.de>:
mm/scatterlist: replace the !preemptible warning in sg_miter_stop()
Subsystem: checkpatch
Rikard Falkeborn <rikard.falkeborn@gmail.com>:
const_structs.checkpatch: add a few sound ops structs
Joe Perches <joe@perches.com>:
checkpatch: improve EXPORT_SYMBOL test for EXPORT_SYMBOL_NS uses
Peter Ujfalusi <peter.ujfalusi@linux.intel.com>:
checkpatch: get default codespell dictionary path from package location
Subsystem: binfmt
Kees Cook <keescook@chromium.org>:
binfmt_elf: reintroduce using MAP_FIXED_NOREPLACE
Alexey Dobriyan <adobriyan@gmail.com>:
ELF: simplify STACK_ALLOC macro
Subsystem: kallsyms
Kefeng Wang <wangkefeng.wang@huawei.com>:
Patch series "sections: Unify kernel sections range check and use", v4:
kallsyms: remove arch specific text and data check
kallsyms: fix address-checks for kernel related range
sections: move and rename core_kernel_data() to is_kernel_core_data()
sections: move is_kernel_inittext() into sections.h
x86: mm: rename __is_kernel_text() to is_x86_32_kernel_text()
sections: provide internal __is_kernel() and __is_kernel_text() helper
mm: kasan: use is_kernel() helper
extable: use is_kernel_text() helper
powerpc/mm: use core_kernel_text() helper
microblaze: use is_kernel_text() helper
alpha: use is_kernel_text() helper
Subsystem: ramfs
yangerkun <yangerkun@huawei.com>:
ramfs: fix mount source show for ramfs
Subsystem: init
Andrew Halaney <ahalaney@redhat.com>:
init: make unknown command line param message clearer
Subsystem: codafs
Jan Harkes <jaharkes@cs.cmu.edu>:
Patch series "Coda updates for -next":
coda: avoid NULL pointer dereference from a bad inode
coda: check for async upcall request using local state
Alex Shi <alex.shi@linux.alibaba.com>:
coda: remove err which no one care
Jan Harkes <jaharkes@cs.cmu.edu>:
coda: avoid flagging NULL inodes
coda: avoid hidden code duplication in rename
coda: avoid doing bad things on inode type changes during revalidation
Xiyu Yang <xiyuyang19@fudan.edu.cn>:
coda: convert from atomic_t to refcount_t on coda_vm_ops->refcnt
Jing Yangyang <jing.yangyang@zte.com.cn>:
coda: use vmemdup_user to replace the open code
Jan Harkes <jaharkes@cs.cmu.edu>:
coda: bump module version to 7.2
Subsystem: nilfs2
Qing Wang <wangqing@vivo.com>:
Patch series "nilfs2 updates":
nilfs2: replace snprintf in show functions with sysfs_emit
Ryusuke Konishi <konishi.ryusuke@gmail.com>:
nilfs2: remove filenames from file comments
Subsystem: hfs
Arnd Bergmann <arnd@arndb.de>:
hfs/hfsplus: use WARN_ON for sanity check
Subsystem: crash_dump
Changcheng Deng <deng.changcheng@zte.com.cn>:
crash_dump: fix boolreturn.cocci warning
Ye Guojin <ye.guojin@zte.com.cn>:
crash_dump: remove duplicate include in crash_dump.h
Subsystem: signals
Ye Guojin <ye.guojin@zte.com.cn>:
signal: remove duplicate include in signal.h
Subsystem: seq_file
Andy Shevchenko <andriy.shevchenko@linux.intel.com>:
seq_file: move seq_escape() to a header
Muchun Song <songmuchun@bytedance.com>:
seq_file: fix passing wrong private data
Subsystem: fork
Ran Xiaokai <ran.xiaokai@zte.com.cn>:
kernel/fork.c: unshare(): use swap() to make code cleaner
Subsystem: sysvfs
Pavel Skripkin <paskripkin@gmail.com>:
sysv: use BUILD_BUG_ON instead of runtime check
Subsystem: kcov
Sebastian Andrzej Siewior <bigeasy@linutronix.de>:
Patch series "kcov: PREEMPT_RT fixup + misc", v2:
Documentation/kcov: include types.h in the example
Documentation/kcov: define `ip' in the example
kcov: allocate per-CPU memory on the relevant node
kcov: avoid enable+disable interrupts if !in_task()
kcov: replace local_irq_save() with a local_lock_t
Subsystem: gdb
Douglas Anderson <dianders@chromium.org>:
scripts/gdb: handle split debug for vmlinux
Subsystem: resource
David Hildenbrand <david@redhat.com>:
Patch series "virtio-mem: disallow mapping virtio-mem memory via /dev/mem", v5:
kernel/resource: clean up and optimize iomem_is_exclusive()
kernel/resource: disallow access to exclusive system RAM regions
virtio-mem: disallow mapping virtio-mem memory via /dev/mem
Subsystem: selftests
SeongJae Park <sjpark@amazon.de>:
selftests/kselftest/runner/run_one(): allow running non-executable files
Subsystem: ipc
Michal Clapinski <mclapinski@google.com>:
ipc: check checkpoint_restore_ns_capable() to modify C/R proc files
Manfred Spraul <manfred@colorfullife.com>:
ipc/ipc_sysctl.c: remove fallback for !CONFIG_PROC_SYSCTL
.mailmap | 2
Documentation/dev-tools/kcov.rst | 5
MAINTAINERS | 21 +
arch/alpha/kernel/traps.c | 4
arch/microblaze/mm/pgtable.c | 3
arch/powerpc/mm/pgtable_32.c | 7
arch/riscv/lib/delay.c | 4
arch/s390/include/asm/facility.h | 4
arch/x86/kernel/aperture_64.c | 13
arch/x86/kernel/unwind_orc.c | 2
arch/x86/mm/init_32.c | 14
arch/x86/xen/mmu_hvm.c | 39 --
drivers/gpu/drm/drm_dp_mst_topology.c | 5
drivers/gpu/drm/drm_mm.c | 5
drivers/gpu/drm/i915/i915_vma.c | 5
drivers/gpu/drm/i915/intel_runtime_pm.c | 20 -
drivers/media/dvb-frontends/cxd2880/cxd2880_common.h | 1
drivers/virtio/Kconfig | 1
drivers/virtio/virtio_mem.c | 321 +++++++++++++------
fs/binfmt_elf.c | 33 +
fs/coda/cnode.c | 13
fs/coda/coda_linux.c | 39 +-
fs/coda/coda_linux.h | 6
fs/coda/dir.c | 20 -
fs/coda/file.c | 12
fs/coda/psdev.c | 14
fs/coda/upcall.c | 3
fs/hfs/inode.c | 6
fs/hfsplus/inode.c | 12
fs/hugetlbfs/inode.c | 23 -
fs/inode.c | 46 +-
fs/internal.h | 1
fs/nilfs2/alloc.c | 2
fs/nilfs2/alloc.h | 2
fs/nilfs2/bmap.c | 2
fs/nilfs2/bmap.h | 2
fs/nilfs2/btnode.c | 2
fs/nilfs2/btnode.h | 2
fs/nilfs2/btree.c | 2
fs/nilfs2/btree.h | 2
fs/nilfs2/cpfile.c | 2
fs/nilfs2/cpfile.h | 2
fs/nilfs2/dat.c | 2
fs/nilfs2/dat.h | 2
fs/nilfs2/dir.c | 2
fs/nilfs2/direct.c | 2
fs/nilfs2/direct.h | 2
fs/nilfs2/file.c | 2
fs/nilfs2/gcinode.c | 2
fs/nilfs2/ifile.c | 2
fs/nilfs2/ifile.h | 2
fs/nilfs2/inode.c | 2
fs/nilfs2/ioctl.c | 2
fs/nilfs2/mdt.c | 2
fs/nilfs2/mdt.h | 2
fs/nilfs2/namei.c | 2
fs/nilfs2/nilfs.h | 2
fs/nilfs2/page.c | 2
fs/nilfs2/page.h | 2
fs/nilfs2/recovery.c | 2
fs/nilfs2/segbuf.c | 2
fs/nilfs2/segbuf.h | 2
fs/nilfs2/segment.c | 2
fs/nilfs2/segment.h | 2
fs/nilfs2/sufile.c | 2
fs/nilfs2/sufile.h | 2
fs/nilfs2/super.c | 2
fs/nilfs2/sysfs.c | 78 ++--
fs/nilfs2/sysfs.h | 2
fs/nilfs2/the_nilfs.c | 2
fs/nilfs2/the_nilfs.h | 2
fs/proc/base.c | 21 -
fs/proc/vmcore.c | 109 ++++--
fs/ramfs/inode.c | 11
fs/seq_file.c | 16
fs/sysv/super.c | 6
include/asm-generic/sections.h | 75 +++-
include/kunit/test.h | 13
include/linux/bottom_half.h | 3
include/linux/container_of.h | 52 ++-
include/linux/crash_dump.h | 30 +
include/linux/delay.h | 2
include/linux/fs.h | 1
include/linux/fwnode.h | 1
include/linux/generic-radix-tree.h | 3
include/linux/hugetlb.h | 6
include/linux/instruction_pointer.h | 8
include/linux/kallsyms.h | 21 -
include/linux/kernel.h | 39 --
include/linux/list.h | 4
include/linux/llist.h | 4
include/linux/pagemap.h | 50 ++
include/linux/plist.h | 5
include/linux/radix-tree.h | 4
include/linux/rwsem.h | 1
include/linux/sbitmap.h | 11
include/linux/seq_file.h | 19 +
include/linux/signal.h | 1
include/linux/smp.h | 1
include/linux/spinlock.h | 1
include/linux/stackdepot.h | 5
include/linux/string_helpers.h | 1
include/media/media-entity.h | 3
init/main.c | 4
ipc/ipc_sysctl.c | 42 +-
ipc/shm.c | 8
kernel/extable.c | 33 -
kernel/fork.c | 9
kernel/kcov.c | 40 +-
kernel/locking/lockdep.c | 3
kernel/resource.c | 54 ++-
kernel/trace/ftrace.c | 2
lib/scatterlist.c | 11
lib/stackdepot.c | 46 ++
lib/vsprintf.c | 3
mm/Kconfig | 7
mm/filemap.c | 8
mm/kasan/report.c | 17 -
mm/memfd.c | 4
mm/mmap.c | 3
mm/page_owner.c | 18 -
mm/truncate.c | 19 +
mm/vmscan.c | 7
mm/workingset.c | 10
net/sysctl_net.c | 2
scripts/checkpatch.pl | 33 +
scripts/const_structs.checkpatch | 4
scripts/gdb/linux/symbols.py | 3
tools/testing/selftests/kselftest/runner.sh | 28 +
tools/testing/selftests/proc/.gitignore | 1
tools/testing/selftests/proc/Makefile | 2
tools/testing/selftests/proc/proc-tid0.c | 81 ++++
132 files changed, 1206 insertions(+), 681 deletions(-)
^ permalink raw reply [flat|nested] 232+ messages in thread
* incoming
@ 2021-11-11 4:32 Andrew Morton
0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2021-11-11 4:32 UTC (permalink / raw)
To: Linus Torvalds; +Cc: linux-mm, mm-commits
The post-linux-next material.
7 patches, based on debe436e77c72fcee804fb867f275e6d31aa999c.
Subsystems affected by this patch series:
mm/debug
mm/slab-generic
mm/migration
mm/memcg
mm/kasan
Subsystem: mm/debug
Yixuan Cao <caoyixuan2019@email.szu.edu.cn>:
mm/page_owner.c: modify the type of argument "order" in some functions
Subsystem: mm/slab-generic
Ingo Molnar <mingo@kernel.org>:
mm: allow only SLUB on PREEMPT_RT
Subsystem: mm/migration
Baolin Wang <baolin.wang@linux.alibaba.com>:
mm: migrate: simplify the file-backed pages validation when migrating its mapping
Alistair Popple <apopple@nvidia.com>:
mm/migrate.c: remove MIGRATE_PFN_LOCKED
Subsystem: mm/memcg
Christoph Hellwig <hch@lst.de>:
Patch series "unexport memcg locking helpers":
mm: unexport folio_memcg_{,un}lock
mm: unexport {,un}lock_page_memcg
Subsystem: mm/kasan
Kuan-Ying Lee <Kuan-Ying.Lee@mediatek.com>:
kasan: add kasan mode messages when kasan init
Documentation/vm/hmm.rst | 2
arch/arm64/mm/kasan_init.c | 2
arch/powerpc/kvm/book3s_hv_uvmem.c | 4
drivers/gpu/drm/amd/amdkfd/kfd_migrate.c | 2
drivers/gpu/drm/nouveau/nouveau_dmem.c | 4
include/linux/migrate.h | 1
include/linux/page_owner.h | 12 +-
init/Kconfig | 2
lib/test_hmm.c | 5 -
mm/kasan/hw_tags.c | 14 ++
mm/kasan/sw_tags.c | 2
mm/memcontrol.c | 4
mm/migrate.c | 151 +++++--------------------------
mm/page_owner.c | 6 -
14 files changed, 61 insertions(+), 150 deletions(-)
^ permalink raw reply [flat|nested] 232+ messages in thread
* incoming
@ 2021-11-20 0:42 Andrew Morton
0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2021-11-20 0:42 UTC (permalink / raw)
To: Linus Torvalds; +Cc: linux-mm, mm-commits
15 patches, based on a90af8f15bdc9449ee2d24e1d73fa3f7e8633f81.
Subsystems affected by this patch series:
mm/swap
ipc
mm/slab-generic
hexagon
mm/kmemleak
mm/hugetlb
mm/kasan
mm/damon
mm/highmem
proc
Subsystem: mm/swap
Matthew Wilcox <willy@infradead.org>:
mm/swap.c:put_pages_list(): reinitialise the page list
Subsystem: ipc
Alexander Mikhalitsyn <alexander.mikhalitsyn@virtuozzo.com>:
Patch series "shm: shm_rmid_forced feature fixes":
ipc: WARN if trying to remove ipc object which is absent
shm: extend forced shm destroy to support objects from several IPC nses
Subsystem: mm/slab-generic
Yunfeng Ye <yeyunfeng@huawei.com>:
mm: emit the "free" trace report before freeing memory in kmem_cache_free()
Subsystem: hexagon
Nathan Chancellor <nathan@kernel.org>:
Patch series "Fixes for ARCH=hexagon allmodconfig", v2:
hexagon: export raw I/O routines for modules
hexagon: clean up timer-regs.h
hexagon: ignore vmlinux.lds
Subsystem: mm/kmemleak
Rustam Kovhaev <rkovhaev@gmail.com>:
mm: kmemleak: slob: respect SLAB_NOLEAKTRACE flag
Subsystem: mm/hugetlb
Bui Quang Minh <minhquangbui99@gmail.com>:
hugetlb: fix hugetlb cgroup refcounting during mremap
Mina Almasry <almasrymina@google.com>:
hugetlb, userfaultfd: fix reservation restore on userfaultfd error
Subsystem: mm/kasan
Kees Cook <keescook@chromium.org>:
kasan: test: silence intentional read overflow warnings
Subsystem: mm/damon
SeongJae Park <sj@kernel.org>:
Patch series "DAMON fixes":
mm/damon/dbgfs: use '__GFP_NOWARN' for user-specified size buffer allocation
mm/damon/dbgfs: fix missed use of damon_dbgfs_lock
Subsystem: mm/highmem
Ard Biesheuvel <ardb@kernel.org>:
kmap_local: don't assume kmap PTEs are linear arrays in memory
Subsystem: proc
David Hildenbrand <david@redhat.com>:
proc/vmcore: fix clearing user buffer by properly using clear_user()
arch/arm/Kconfig | 1
arch/hexagon/include/asm/timer-regs.h | 26 ----
arch/hexagon/include/asm/timex.h | 3
arch/hexagon/kernel/.gitignore | 1
arch/hexagon/kernel/time.c | 12 +-
arch/hexagon/lib/io.c | 4
fs/proc/vmcore.c | 20 ++-
include/linux/hugetlb_cgroup.h | 12 ++
include/linux/ipc_namespace.h | 15 ++
include/linux/sched/task.h | 2
ipc/shm.c | 189 +++++++++++++++++++++++++---------
ipc/util.c | 6 -
lib/test_kasan.c | 2
mm/Kconfig | 3
mm/damon/dbgfs.c | 20 ++-
mm/highmem.c | 32 +++--
mm/hugetlb.c | 11 +
mm/slab.c | 3
mm/slab.h | 2
mm/slob.c | 3
mm/slub.c | 2
mm/swap.c | 1
22 files changed, 254 insertions(+), 116 deletions(-)
^ permalink raw reply [flat|nested] 232+ messages in thread
* incoming
@ 2021-12-10 22:45 Andrew Morton
0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2021-12-10 22:45 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm
21 patches, based on c741e49150dbb0c0aebe234389f4aa8b47958fa8.
Subsystems affected by this patch series:
mm/mlock
MAINTAINERS
mailmap
mm/pagecache
mm/damon
mm/slub
mm/memcg
mm/hugetlb
mm/pagecache
Subsystem: mm/mlock
Drew DeVault <sir@cmpwn.com>:
Increase default MLOCK_LIMIT to 8 MiB
Subsystem: MAINTAINERS
Dave Young <dyoung@redhat.com>:
MAINTAINERS: update kdump maintainers
Subsystem: mailmap
Guo Ren <guoren@linux.alibaba.com>:
mailmap: update email address for Guo Ren
Subsystem: mm/pagecache
"Matthew Wilcox (Oracle)" <willy@infradead.org>:
filemap: remove PageHWPoison check from next_uptodate_page()
Subsystem: mm/damon
SeongJae Park <sj@kernel.org>:
Patch series "mm/damon: Fix fake /proc/loadavg reports", v3:
timers: implement usleep_idle_range()
mm/damon/core: fix fake load reports due to uninterruptible sleeps
Patch series "mm/damon: Trivial fixups and improvements":
mm/damon/core: use better timer mechanisms selection threshold
mm/damon/dbgfs: remove an unnecessary error message
mm/damon/core: remove unnecessary error messages
mm/damon/vaddr: remove an unnecessary warning message
mm/damon/vaddr-test: split a test function having >1024 bytes frame size
mm/damon/vaddr-test: remove unnecessary variables
selftests/damon: skip test if DAMON is running
selftests/damon: test DAMON enabling with empty target_ids case
selftests/damon: test wrong DAMOS condition ranges input
selftests/damon: test debugfs file reads/writes with huge count
selftests/damon: split test cases
Subsystem: mm/slub
Gerald Schaefer <gerald.schaefer@linux.ibm.com>:
mm/slub: fix endianness bug for alloc/free_traces attributes
Subsystem: mm/memcg
Waiman Long <longman@redhat.com>:
mm/memcg: relocate mod_objcg_mlstate(), get_obj_stock() and put_obj_stock()
Subsystem: mm/hugetlb
Zhenguo Yao <yaozhenguo1@gmail.com>:
hugetlbfs: fix issue of preallocation of gigantic pages can't work
Subsystem: mm/pagecache
Manjong Lee <mj0123.lee@samsung.com>:
mm: bdi: initialize bdi_min_ratio when bdi is unregistered
.mailmap | 2
MAINTAINERS | 2
include/linux/delay.h | 14
include/uapi/linux/resource.h | 13
kernel/time/timer.c | 16 -
mm/backing-dev.c | 7
mm/damon/core.c | 20 -
mm/damon/dbgfs.c | 4
mm/damon/vaddr-test.h | 85 ++---
mm/damon/vaddr.c | 1
mm/filemap.c | 2
mm/hugetlb.c | 2
mm/memcontrol.c | 106 +++----
mm/slub.c | 15 -
tools/testing/selftests/damon/.gitignore | 2
tools/testing/selftests/damon/Makefile | 7
tools/testing/selftests/damon/_debugfs_common.sh | 52 +++
tools/testing/selftests/damon/debugfs_attrs.sh | 149 ++--------
tools/testing/selftests/damon/debugfs_empty_targets.sh | 13
tools/testing/selftests/damon/debugfs_huge_count_read_write.sh | 22 +
tools/testing/selftests/damon/debugfs_schemes.sh | 19 +
tools/testing/selftests/damon/debugfs_target_ids.sh | 19 +
tools/testing/selftests/damon/huge_count_read_write.c | 39 ++
23 files changed, 363 insertions(+), 248 deletions(-)
^ permalink raw reply [flat|nested] 232+ messages in thread
* incoming
@ 2021-12-25 5:11 Andrew Morton
0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2021-12-25 5:11 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm
9 patches, based on bc491fb12513e79702c6f936c838f792b5389129.
Subsystems affected by this patch series:
mm/kfence
mm/mempolicy
core-kernel
MAINTAINERS
mm/memory-failure
mm/pagemap
mm/pagealloc
mm/damon
mm/memory-failure
Subsystem: mm/kfence
Baokun Li <libaokun1@huawei.com>:
kfence: fix memory leak when cat kfence objects
Subsystem: mm/mempolicy
Andrey Ryabinin <arbn@yandex-team.com>:
mm: mempolicy: fix THP allocations escaping mempolicy restrictions
Subsystem: core-kernel
Philipp Rudo <prudo@redhat.com>:
kernel/crash_core: suppress unknown crashkernel parameter warning
Subsystem: MAINTAINERS
Randy Dunlap <rdunlap@infradead.org>:
MAINTAINERS: mark more list instances as moderated
Subsystem: mm/memory-failure
Naoya Horiguchi <naoya.horiguchi@nec.com>:
mm, hwpoison: fix condition in free hugetlb page path
Subsystem: mm/pagemap
Hugh Dickins <hughd@google.com>:
mm: delete unsafe BUG from page_cache_add_speculative()
Subsystem: mm/pagealloc
Thibaut Sautereau <thibaut.sautereau@ssi.gouv.fr>:
mm/page_alloc: fix __alloc_size attribute for alloc_pages_exact_nid
Subsystem: mm/damon
SeongJae Park <sj@kernel.org>:
mm/damon/dbgfs: protect targets destructions with kdamond_lock
Subsystem: mm/memory-failure
Liu Shixin <liushixin2@huawei.com>:
mm/hwpoison: clear MF_COUNT_INCREASED before retrying get_any_page()
MAINTAINERS | 4 ++--
include/linux/gfp.h | 2 +-
include/linux/pagemap.h | 1 -
kernel/crash_core.c | 11 +++++++++++
mm/damon/dbgfs.c | 2 ++
mm/kfence/core.c | 1 +
mm/memory-failure.c | 14 +++++---------
mm/mempolicy.c | 3 +--
8 files changed, 23 insertions(+), 15 deletions(-)
^ permalink raw reply [flat|nested] 232+ messages in thread
* incoming
@ 2021-12-31 4:12 Andrew Morton
0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2021-12-31 4:12 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm
2 patches, based on 4f3d93c6eaff6b84e43b63e0d7a119c5920e1020.
Subsystems affected by this patch series:
mm/userfaultfd
mm/damon
Subsystem: mm/userfaultfd
Mike Kravetz <mike.kravetz@oracle.com>:
userfaultfd/selftests: fix hugetlb area allocations
Subsystem: mm/damon
SeongJae Park <sj@kernel.org>:
mm/damon/dbgfs: fix 'struct pid' leaks in 'dbgfs_target_ids_write()'
mm/damon/dbgfs.c | 9 +++++++--
tools/testing/selftests/vm/userfaultfd.c | 16 ++++++++++------
2 files changed, 17 insertions(+), 8 deletions(-)
^ permalink raw reply [flat|nested] 232+ messages in thread
* incoming
@ 2022-01-14 22:02 Andrew Morton
0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2022-01-14 22:02 UTC (permalink / raw)
To: Linus Torvalds; +Cc: linux-mm, mm-commits
146 patches, based on df0cc57e057f18e44dac8e6c18aba47ab53202f9 ("Linux 5.16")
Subsystems affected by this patch series:
kthread
ia64
scripts
ntfs
squashfs
ocfs2
vfs
mm/slab-generic
mm/slab
mm/kmemleak
mm/dax
mm/kasan
mm/debug
mm/pagecache
mm/gup
mm/shmem
mm/frontswap
mm/memremap
mm/memcg
mm/selftests
mm/pagemap
mm/dma
mm/vmalloc
mm/memory-failure
mm/hugetlb
mm/userfaultfd
mm/vmscan
mm/mempolicy
mm/oom-kill
mm/hugetlbfs
mm/migration
mm/thp
mm/ksm
mm/page-poison
mm/percpu
mm/rmap
mm/zswap
mm/zram
mm/cleanups
mm/hmm
mm/damon
Subsystem: kthread
Cai Huoqing <caihuoqing@baidu.com>:
kthread: add the helper function kthread_run_on_cpu()
RDMA/siw: make use of the helper function kthread_run_on_cpu()
ring-buffer: make use of the helper function kthread_run_on_cpu()
rcutorture: make use of the helper function kthread_run_on_cpu()
trace/osnoise: make use of the helper function kthread_run_on_cpu()
trace/hwlat: make use of the helper function kthread_run_on_cpu()
Subsystem: ia64
Yang Guang <yang.guang5@zte.com.cn>:
ia64: module: use swap() to make code cleaner
arch/ia64/kernel/setup.c: use swap() to make code cleaner
Jason Wang <wangborong@cdjrlc.com>:
ia64: fix typo in a comment
Greg Kroah-Hartman <gregkh@linuxfoundation.org>:
ia64: topology: use default_groups in kobj_type
Subsystem: scripts
Drew Fustini <dfustini@baylibre.com>:
scripts/spelling.txt: add "oveflow"
Subsystem: ntfs
Yang Li <yang.lee@linux.alibaba.com>:
fs/ntfs/attrib.c: fix one kernel-doc comment
Subsystem: squashfs
Zheng Liang <zhengliang6@huawei.com>:
squashfs: provide backing_dev_info in order to disable read-ahead
Subsystem: ocfs2
Zhang Mingyu <zhang.mingyu@zte.com.cn>:
ocfs2: use BUG_ON instead of if condition followed by BUG.
Joseph Qi <joseph.qi@linux.alibaba.com>:
ocfs2: clearly handle ocfs2_grab_pages_for_write() return value
Greg Kroah-Hartman <gregkh@linuxfoundation.org>:
ocfs2: use default_groups in kobj_type
Colin Ian King <colin.i.king@gmail.com>:
ocfs2: remove redundant assignment to pointer root_bh
Greg Kroah-Hartman <gregkh@linuxfoundation.org>:
ocfs2: cluster: use default_groups in kobj_type
Colin Ian King <colin.i.king@gmail.com>:
ocfs2: remove redundant assignment to variable free_space
Subsystem: vfs
Amit Daniel Kachhap <amit.kachhap@arm.com>:
fs/ioctl: remove unnecessary __user annotation
Subsystem: mm/slab-generic
Marco Elver <elver@google.com>:
mm/slab_common: use WARN() if cache still has objects on destroy
Subsystem: mm/slab
Muchun Song <songmuchun@bytedance.com>:
mm: slab: make slab iterator functions static
Subsystem: mm/kmemleak
Kuan-Ying Lee <Kuan-Ying.Lee@mediatek.com>:
kmemleak: fix kmemleak false positive report with HW tag-based kasan enable
Calvin Zhang <calvinzhang.cool@gmail.com>:
mm: kmemleak: alloc gray object for reserved region with direct map
Kefeng Wang <wangkefeng.wang@huawei.com>:
mm: defer kmemleak object creation of module_alloc()
Subsystem: mm/dax
Joao Martins <joao.m.martins@oracle.com>:
Patch series "mm, device-dax: Introduce compound pages in devmap", v7:
mm/page_alloc: split prep_compound_page into head and tail subparts
mm/page_alloc: refactor memmap_init_zone_device() page init
mm/memremap: add ZONE_DEVICE support for compound pages
device-dax: use ALIGN() for determining pgoff
device-dax: use struct_size()
device-dax: ensure dev_dax->pgmap is valid for dynamic devices
device-dax: factor out page mapping initialization
device-dax: set mapping prior to vmf_insert_pfn{,_pmd,pud}()
device-dax: remove pfn from __dev_dax_{pte,pmd,pud}_fault()
device-dax: compound devmap support
Subsystem: mm/kasan
Marco Elver <elver@google.com>:
kasan: test: add globals left-out-of-bounds test
kasan: add ability to detect double-kmem_cache_destroy()
kasan: test: add test case for double-kmem_cache_destroy()
Andrey Konovalov <andreyknvl@google.com>:
kasan: fix quarantine conflicting with init_on_free
Subsystem: mm/debug
"Matthew Wilcox (Oracle)" <willy@infradead.org>:
mm,fs: split dump_mapping() out from dump_page()
Anshuman Khandual <anshuman.khandual@arm.com>:
mm/debug_vm_pgtable: update comments regarding migration swap entries
Subsystem: mm/pagecache
chiminghao <chi.minghao@zte.com.cn>:
mm/truncate.c: remove unneeded variable
Subsystem: mm/gup
Christophe Leroy <christophe.leroy@csgroup.eu>:
gup: avoid multiple user access locking/unlocking in fault_in_{read/write}able
Li Xinhai <lixinhai.lxh@gmail.com>:
mm/gup.c: stricter check on THP migration entry during follow_pmd_mask
Subsystem: mm/shmem
Yang Shi <shy828301@gmail.com>:
mm: shmem: don't truncate page if memory failure happens
Gang Li <ligang.bdlg@bytedance.com>:
shmem: fix a race between shmem_unused_huge_shrink and shmem_evict_inode
Subsystem: mm/frontswap
Christophe JAILLET <christophe.jaillet@wanadoo.fr>:
mm/frontswap.c: use non-atomic '__set_bit()' when possible
Subsystem: mm/memremap
Subsystem: mm/memcg
Muchun Song <songmuchun@bytedance.com>:
mm: memcontrol: make cgroup_memory_nokmem static
Donghai Qiao <dqiao@redhat.com>:
mm/page_counter: remove an incorrect call to propagate_protected_usage()
Dan Schatzberg <schatzberg.dan@gmail.com>:
mm/memcg: add oom_group_kill memory event
Shakeel Butt <shakeelb@google.com>:
memcg: better bounds on the memcg stats updates
Wang Weiyang <wangweiyang2@huawei.com>:
mm/memcg: use struct_size() helper in kzalloc()
Shakeel Butt <shakeelb@google.com>:
memcg: add per-memcg vmalloc stat
Subsystem: mm/selftests
chiminghao <chi.minghao@zte.com.cn>:
tools/testing/selftests/vm/userfaultfd.c: use swap() to make code cleaner
Subsystem: mm/pagemap
Qi Zheng <zhengqi.arch@bytedance.com>:
mm: remove redundant check about FAULT_FLAG_ALLOW_RETRY bit
Colin Cross <ccross@google.com>:
Patch series "mm: rearrange madvise code to allow for reuse", v11:
mm: rearrange madvise code to allow for reuse
mm: add a field to store names for private anonymous memory
Suren Baghdasaryan <surenb@google.com>:
mm: add anonymous vma name refcounting
Arnd Bergmann <arnd@arndb.de>:
mm: move anon_vma declarations to linux/mm_inline.h
mm: move tlb_flush_pending inline helpers to mm_inline.h
Suren Baghdasaryan <surenb@google.com>:
mm: protect free_pgtables with mmap_lock write lock in exit_mmap
mm: document locking restrictions for vm_operations_struct::close
mm/oom_kill: allow process_mrelease to run under mmap_lock protection
Shuah Khan <skhan@linuxfoundation.org>:
docs/vm: add vmalloced-kernel-stacks document
Pasha Tatashin <pasha.tatashin@soleen.com>:
Patch series "page table check", v3:
mm: change page type prior to adding page table entry
mm: ptep_clear() page table helper
mm: page table check
x86: mm: add x86_64 support for page table check
"Matthew Wilcox (Oracle)" <willy@infradead.org>:
mm: remove last argument of reuse_swap_page()
mm: remove the total_mapcount argument from page_trans_huge_map_swapcount()
mm: remove the total_mapcount argument from page_trans_huge_mapcount()
Subsystem: mm/dma
Christian König <christian.koenig@amd.com>:
mm/dmapool.c: revert "make dma pool to use kmalloc_node"
Subsystem: mm/vmalloc
Michal Hocko <mhocko@suse.com>:
Patch series "extend vmalloc support for constrained allocations", v2:
mm/vmalloc: alloc GFP_NO{FS,IO} for vmalloc
mm/vmalloc: add support for __GFP_NOFAIL
mm/vmalloc: be more explicit about supported gfp flags.
mm: allow !GFP_KERNEL allocations for kvmalloc
mm: make slab and vmalloc allocators __GFP_NOLOCKDEP aware
"NeilBrown" <neilb@suse.de>:
mm: introduce memalloc_retry_wait()
Suren Baghdasaryan <surenb@google.com>:
mm/pagealloc: sysctl: change watermark_scale_factor max limit to 30%
Changcheng Deng <deng.changcheng@zte.com.cn>:
mm: fix boolreturn.cocci warning
Xiongwei Song <sxwjean@gmail.com>:
mm: page_alloc: fix building error on -Werror=array-compare
Michal Hocko <mhocko@suse.com>:
mm: drop node from alloc_pages_vma
Miles Chen <miles.chen@mediatek.com>:
include/linux/gfp.h: further document GFP_DMA32
Anshuman Khandual <anshuman.khandual@arm.com>:
mm/page_alloc.c: modify the comment section for alloc_contig_pages()
Baoquan He <bhe@redhat.com>:
Patch series "Handle warning of allocation failure on DMA zone w/o managed pages", v4:
mm_zone: add function to check if managed dma zone exists
dma/pool: create dma atomic pool only if dma zone has managed pages
mm/page_alloc.c: do not warn allocation failure on zone DMA if no managed pages
Subsystem: mm/memory-failure
Subsystem: mm/hugetlb
Mina Almasry <almasrymina@google.com>:
hugetlb: add hugetlb.*.numa_stat file
Yosry Ahmed <yosryahmed@google.com>:
mm, hugepages: make memory size variable in hugepage-mremap selftest
Yang Yang <yang.yang29@zte.com.cn>:
mm/vmstat: add events for THP max_ptes_* exceeds
Waiman Long <longman@redhat.com>:
selftests/vm: make charge_reserved_hugetlb.sh work with existing cgroup setting
Subsystem: mm/userfaultfd
Peter Xu <peterx@redhat.com>:
selftests/uffd: allow EINTR/EAGAIN
Mike Kravetz <mike.kravetz@oracle.com>:
userfaultfd/selftests: clean up hugetlb allocation code
Subsystem: mm/vmscan
Gang Li <ligang.bdlg@bytedance.com>:
vmscan: make drop_slab_node static
Chen Wandun <chenwandun@huawei.com>:
mm/page_isolation: unset migratetype directly for non Buddy page
Subsystem: mm/mempolicy
"Aneesh Kumar K.V" <aneesh.kumar@linux.ibm.com>:
Patch series "mm: add new syscall set_mempolicy_home_node", v6:
mm/mempolicy: use policy_node helper with MPOL_PREFERRED_MANY
mm/mempolicy: add set_mempolicy_home_node syscall
mm/mempolicy: wire up syscall set_mempolicy_home_node
Randy Dunlap <rdunlap@infradead.org>:
mm/mempolicy: fix all kernel-doc warnings
Subsystem: mm/oom-kill
Jann Horn <jannh@google.com>:
mm, oom: OOM sysrq should always kill a process
Subsystem: mm/hugetlbfs
Sean Christopherson <seanjc@google.com>:
hugetlbfs: fix off-by-one error in hugetlb_vmdelete_list()
Subsystem: mm/migration
Baolin Wang <baolin.wang@linux.alibaba.com>:
Patch series "Improve the migration stats":
mm: migrate: fix the return value of migrate_pages()
mm: migrate: correct the hugetlb migration stats
mm: compaction: fix the migration stats in trace_mm_compaction_migratepages()
mm: migrate: support multiple target nodes demotion
mm: migrate: add more comments for selecting target node randomly
Huang Ying <ying.huang@intel.com>:
mm/migrate: move node demotion code to near its user
Colin Ian King <colin.i.king@gmail.com>:
mm/migrate: remove redundant variables used in a for-loop
Subsystem: mm/thp
Anshuman Khandual <anshuman.khandual@arm.com>:
mm/thp: drop unused trace events hugepage_[invalidate|splitting]
Subsystem: mm/ksm
Nanyong Sun <sunnanyong@huawei.com>:
mm: ksm: fix use-after-free kasan report in ksm_might_need_to_copy
Subsystem: mm/page-poison
Naoya Horiguchi <naoya.horiguchi@nec.com>:
Patch series "mm/hwpoison: fix unpoison_memory()", v4:
mm/hwpoison: mf_mutex for soft offline and unpoison
mm/hwpoison: remove MF_MSG_BUDDY_2ND and MF_MSG_POISONED_HUGE
mm/hwpoison: fix unpoison_memory()
Subsystem: mm/percpu
Qi Zheng <zhengqi.arch@bytedance.com>:
mm: memcg/percpu: account extra objcg space to memory cgroups
Subsystem: mm/rmap
Huang Ying <ying.huang@intel.com>:
mm/rmap: fix potential batched TLB flush race
Subsystem: mm/zswap
Zhaoyu Liu <zackary.liu.pro@gmail.com>:
zpool: remove the list of pools_head
Subsystem: mm/zram
Luis Chamberlain <mcgrof@kernel.org>:
zram: use ATTRIBUTE_GROUPS
Subsystem: mm/cleanups
Quanfa Fu <fuqf0919@gmail.com>:
mm: fix some comment errors
Ting Liu <liuting.0x7c00@bytedance.com>:
mm: make some vars and functions static or __init
Subsystem: mm/hmm
Alistair Popple <apopple@nvidia.com>:
mm/hmm.c: allow VM_MIXEDMAP to work with hmm_range_fault
Subsystem: mm/damon
Xin Hao <xhao@linux.alibaba.com>:
Patch series "mm/damon: Do some small changes", v4:
mm/damon: unified access_check function naming rules
mm/damon: add 'age' of region tracepoint support
mm/damon/core: use abs() instead of diff_of()
mm/damon: remove some unneeded function definitions in damon.h
Yihao Han <hanyihao@vivo.com>:
mm/damon/vaddr: remove swap_ranges() and replace it with swap()
Xin Hao <xhao@linux.alibaba.com>:
mm/damon/schemes: add the validity judgment of thresholds
mm/damon: move damon_rand() definition into damon.h
mm/damon: modify damon_rand() macro to static inline function
SeongJae Park <sj@kernel.org>:
Patch series "mm/damon: Misc cleanups":
mm/damon: convert macro functions to static inline functions
Docs/admin-guide/mm/damon/usage: update for scheme quotas and watermarks
Docs/admin-guide/mm/damon/usage: remove redundant information
Docs/admin-guide/mm/damon/usage: mention tracepoint at the beginning
Docs/admin-guide/mm/damon/usage: update for kdamond_pid and (mk|rm)_contexts
mm/damon: remove a mistakenly added comment for a future feature
Patch series "mm/damon/schemes: Extend stats for better online analysis and tuning":
mm/damon/schemes: account scheme actions that successfully applied
mm/damon/schemes: account how many times quota limit has exceeded
mm/damon/reclaim: provide reclamation statistics
Docs/admin-guide/mm/damon/reclaim: document statistics parameters
mm/damon/dbgfs: support all DAMOS stats
Docs/admin-guide/mm/damon/usage: update for schemes statistics
Baolin Wang <baolin.wang@linux.alibaba.com>:
mm/damon: add access checking for hugetlb pages
Guoqing Jiang <guoqing.jiang@linux.dev>:
mm/damon: move the implementation of damon_insert_region to damon.h
SeongJae Park <sj@kernel.org>:
Patch series "mm/damon: Hide unnecessary information disclosures":
mm/damon/dbgfs: remove an unnecessary variable
mm/damon/vaddr: use pr_debug() for damon_va_three_regions() failure logging
mm/damon/vaddr: hide kernel pointer from damon_va_three_regions() failure log
mm/damon: hide kernel pointer from tracepoint event
Documentation/admin-guide/cgroup-v1/hugetlb.rst | 4
Documentation/admin-guide/cgroup-v2.rst | 11
Documentation/admin-guide/mm/damon/reclaim.rst | 25
Documentation/admin-guide/mm/damon/usage.rst | 235 +++++--
Documentation/admin-guide/mm/numa_memory_policy.rst | 16
Documentation/admin-guide/sysctl/vm.rst | 2
Documentation/filesystems/proc.rst | 6
Documentation/vm/arch_pgtable_helpers.rst | 20
Documentation/vm/index.rst | 2
Documentation/vm/page_migration.rst | 12
Documentation/vm/page_table_check.rst | 56 +
Documentation/vm/vmalloced-kernel-stacks.rst | 153 ++++
MAINTAINERS | 9
arch/Kconfig | 3
arch/alpha/kernel/syscalls/syscall.tbl | 1
arch/alpha/mm/fault.c | 16
arch/arc/mm/fault.c | 3
arch/arm/mm/fault.c | 2
arch/arm/tools/syscall.tbl | 1
arch/arm64/include/asm/unistd.h | 2
arch/arm64/include/asm/unistd32.h | 2
arch/arm64/kernel/module.c | 4
arch/arm64/mm/fault.c | 6
arch/hexagon/mm/vm_fault.c | 8
arch/ia64/kernel/module.c | 6
arch/ia64/kernel/setup.c | 5
arch/ia64/kernel/syscalls/syscall.tbl | 1
arch/ia64/kernel/topology.c | 3
arch/ia64/kernel/uncached.c | 2
arch/ia64/mm/fault.c | 16
arch/m68k/kernel/syscalls/syscall.tbl | 1
arch/m68k/mm/fault.c | 18
arch/microblaze/kernel/syscalls/syscall.tbl | 1
arch/microblaze/mm/fault.c | 18
arch/mips/kernel/syscalls/syscall_n32.tbl | 1
arch/mips/kernel/syscalls/syscall_n64.tbl | 1
arch/mips/kernel/syscalls/syscall_o32.tbl | 1
arch/mips/mm/fault.c | 19
arch/nds32/mm/fault.c | 16
arch/nios2/mm/fault.c | 18
arch/openrisc/mm/fault.c | 18
arch/parisc/kernel/syscalls/syscall.tbl | 1
arch/parisc/mm/fault.c | 18
arch/powerpc/kernel/syscalls/syscall.tbl | 1
arch/powerpc/mm/fault.c | 6
arch/riscv/mm/fault.c | 2
arch/s390/kernel/module.c | 5
arch/s390/kernel/syscalls/syscall.tbl | 1
arch/s390/mm/fault.c | 28
arch/sh/kernel/syscalls/syscall.tbl | 1
arch/sh/mm/fault.c | 18
arch/sparc/kernel/syscalls/syscall.tbl | 1
arch/sparc/mm/fault_32.c | 16
arch/sparc/mm/fault_64.c | 16
arch/um/kernel/trap.c | 8
arch/x86/Kconfig | 1
arch/x86/entry/syscalls/syscall_32.tbl | 1
arch/x86/entry/syscalls/syscall_64.tbl | 1
arch/x86/include/asm/pgtable.h | 31 -
arch/x86/kernel/module.c | 7
arch/x86/mm/fault.c | 3
arch/xtensa/kernel/syscalls/syscall.tbl | 1
arch/xtensa/mm/fault.c | 17
drivers/block/zram/zram_drv.c | 11
drivers/dax/bus.c | 32 +
drivers/dax/bus.h | 1
drivers/dax/device.c | 140 ++--
drivers/infiniband/sw/siw/siw_main.c | 7
drivers/of/fdt.c | 6
fs/ext4/extents.c | 8
fs/ext4/inline.c | 5
fs/ext4/page-io.c | 9
fs/f2fs/data.c | 4
fs/f2fs/gc.c | 5
fs/f2fs/inode.c | 4
fs/f2fs/node.c | 4
fs/f2fs/recovery.c | 6
fs/f2fs/segment.c | 9
fs/f2fs/super.c | 5
fs/hugetlbfs/inode.c | 7
fs/inode.c | 49 +
fs/ioctl.c | 2
fs/ntfs/attrib.c | 2
fs/ocfs2/alloc.c | 2
fs/ocfs2/aops.c | 26
fs/ocfs2/cluster/masklog.c | 11
fs/ocfs2/dir.c | 2
fs/ocfs2/filecheck.c | 3
fs/ocfs2/journal.c | 6
fs/proc/task_mmu.c | 13
fs/squashfs/super.c | 33 +
fs/userfaultfd.c | 8
fs/xfs/kmem.c | 3
fs/xfs/xfs_buf.c | 2
include/linux/ceph/libceph.h | 1
include/linux/damon.h | 93 +--
include/linux/fs.h | 1
include/linux/gfp.h | 12
include/linux/hugetlb.h | 4
include/linux/hugetlb_cgroup.h | 7
include/linux/kasan.h | 4
include/linux/kthread.h | 25
include/linux/memcontrol.h | 22
include/linux/mempolicy.h | 1
include/linux/memremap.h | 11
include/linux/mm.h | 76 --
include/linux/mm_inline.h | 136 ++++
include/linux/mm_types.h | 252 +++-----
include/linux/mmzone.h | 9
include/linux/page-flags.h | 6
include/linux/page_idle.h | 1
include/linux/page_table_check.h | 147 ++++
include/linux/pgtable.h | 8
include/linux/sched/mm.h | 26
include/linux/swap.h | 8
include/linux/syscalls.h | 3
include/linux/vm_event_item.h | 3
include/linux/vmalloc.h | 7
include/ras/ras_event.h | 2
include/trace/events/compaction.h | 24
include/trace/events/damon.h | 15
include/trace/events/thp.h | 35 -
include/uapi/asm-generic/unistd.h | 5
include/uapi/linux/prctl.h | 3
kernel/dma/pool.c | 4
kernel/fork.c | 3
kernel/kthread.c | 1
kernel/rcu/rcutorture.c | 7
kernel/sys.c | 63 ++
kernel/sys_ni.c | 1
kernel/sysctl.c | 3
kernel/trace/ring_buffer.c | 7
kernel/trace/trace_hwlat.c | 6
kernel/trace/trace_osnoise.c | 3
lib/test_hmm.c | 24
lib/test_kasan.c | 30
mm/Kconfig | 14
mm/Kconfig.debug | 24
mm/Makefile | 1
mm/compaction.c | 7
mm/damon/core.c | 45 -
mm/damon/dbgfs.c | 20
mm/damon/paddr.c | 24
mm/damon/prmtv-common.h | 4
mm/damon/reclaim.c | 46 +
mm/damon/vaddr.c | 186 ++++--
mm/debug.c | 52 -
mm/debug_vm_pgtable.c | 6
mm/dmapool.c | 2
mm/frontswap.c | 4
mm/gup.c | 31 -
mm/hmm.c | 5
mm/huge_memory.c | 32 -
mm/hugetlb.c | 6
mm/hugetlb_cgroup.c | 133 +++-
mm/internal.h | 7
mm/kasan/quarantine.c | 11
mm/kasan/shadow.c | 9
mm/khugepaged.c | 23
mm/kmemleak.c | 21
mm/ksm.c | 5
mm/madvise.c | 510 ++++++++++------
mm/mapping_dirty_helpers.c | 1
mm/memcontrol.c | 44 -
mm/memory-failure.c | 189 +++---
mm/memory.c | 12
mm/mempolicy.c | 95 ++-
mm/memremap.c | 18
mm/migrate.c | 527 ++++++++++-------
mm/mlock.c | 2
mm/mmap.c | 55 +
mm/mmu_gather.c | 1
mm/mprotect.c | 2
mm/oom_kill.c | 30
mm/page_alloc.c | 198 ++++--
mm/page_counter.c | 1
mm/page_ext.c | 8
mm/page_isolation.c | 2
mm/page_owner.c | 4
mm/page_table_check.c | 270 ++++++++
mm/percpu-internal.h | 18
mm/percpu.c | 10
mm/pgtable-generic.c | 1
mm/rmap.c | 43 +
mm/shmem.c | 91 ++
mm/slab.h | 5
mm/slab_common.c | 34 -
mm/swap.c | 2
mm/swapfile.c | 46 -
mm/truncate.c | 5
mm/userfaultfd.c | 5
mm/util.c | 15
mm/vmalloc.c | 75 +-
mm/vmscan.c | 2
mm/vmstat.c | 3
mm/zpool.c | 12
net/ceph/buffer.c | 4
net/ceph/ceph_common.c | 27
net/ceph/crypto.c | 2
net/ceph/messenger.c | 2
net/ceph/messenger_v2.c | 2
net/ceph/osdmap.c | 12
net/sunrpc/svc_xprt.c | 3
scripts/spelling.txt | 1
tools/testing/selftests/vm/charge_reserved_hugetlb.sh | 34 -
tools/testing/selftests/vm/hmm-tests.c | 42 +
tools/testing/selftests/vm/hugepage-mremap.c | 46 -
tools/testing/selftests/vm/hugetlb_reparenting_test.sh | 21
tools/testing/selftests/vm/run_vmtests.sh | 2
tools/testing/selftests/vm/userfaultfd.c | 33 -
tools/testing/selftests/vm/write_hugetlb_memory.sh | 2
211 files changed, 3980 insertions(+), 1759 deletions(-)
^ permalink raw reply [flat|nested] 232+ messages in thread
* incoming
@ 2022-01-20 2:07 Andrew Morton
0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2022-01-20 2:07 UTC (permalink / raw)
To: Linus Torvalds; +Cc: linux-mm, mm-commits
55 patches, based on df0cc57e057f18e44dac8e6c18aba47ab53202f9 ("Linux 5.16")
Subsystems affected by this patch series:
percpu
procfs
sysctl
misc
core-kernel
get_maintainer
lib
checkpatch
binfmt
nilfs2
hfs
fat
adfs
panic
delayacct
kconfig
kcov
ubsan
Subsystem: percpu
Kefeng Wang <wangkefeng.wang@huawei.com>:
Patch series "mm: percpu: Cleanup percpu first chunk function":
mm: percpu: generalize percpu related config
mm: percpu: add pcpu_fc_cpu_to_node_fn_t typedef
mm: percpu: add generic pcpu_fc_alloc/free funciton
mm: percpu: add generic pcpu_populate_pte() function
Subsystem: procfs
David Hildenbrand <david@redhat.com>:
proc/vmcore: don't fake reading zeroes on surprise vmcore_cb unregistration
Hans de Goede <hdegoede@redhat.com>:
proc: make the proc_create[_data]() stubs static inlines
Qi Zheng <zhengqi.arch@bytedance.com>:
proc: convert the return type of proc_fd_access_allowed() to be boolean
Subsystem: sysctl
Geert Uytterhoeven <geert+renesas@glider.be>:
sysctl: fix duplicate path separator in printed entries
luo penghao <luo.penghao@zte.com.cn>:
sysctl: remove redundant ret assignment
Subsystem: misc
Andy Shevchenko <andriy.shevchenko@linux.intel.com>:
include/linux/unaligned: replace kernel.h with the necessary inclusions
kernel.h: include a note to discourage people from including it in headers
Subsystem: core-kernel
Yafang Shao <laoar.shao@gmail.com>:
Patch series "task comm cleanups", v2:
fs/exec: replace strlcpy with strscpy_pad in __set_task_comm
fs/exec: replace strncpy with strscpy_pad in __get_task_comm
drivers/infiniband: replace open-coded string copy with get_task_comm
fs/binfmt_elf: replace open-coded string copy with get_task_comm
samples/bpf/test_overhead_kprobe_kern: replace bpf_probe_read_kernel with bpf_probe_read_kernel_str to get task comm
tools/bpf/bpftool/skeleton: replace bpf_probe_read_kernel with bpf_probe_read_kernel_str to get task comm
tools/testing/selftests/bpf: replace open-coded 16 with TASK_COMM_LEN
kthread: dynamically allocate memory to store kthread's full name
Davidlohr Bueso <dave@stgolabs.net>:
kernel/sys.c: only take tasklist_lock for get/setpriority(PRIO_PGRP)
Subsystem: get_maintainer
Randy Dunlap <rdunlap@infradead.org>:
get_maintainer: don't remind about no git repo when --nogit is used
Subsystem: lib
Alexey Dobriyan <adobriyan@gmail.com>:
kstrtox: uninline everything
Andy Shevchenko <andriy.shevchenko@linux.intel.com>:
list: introduce list_is_head() helper and re-use it in list.h
Zhen Lei <thunder.leizhen@huawei.com>:
lib/list_debug.c: print more list debugging context in __list_del_entry_valid()
Isabella Basso <isabbasso@riseup.net>:
Patch series "test_hash.c: refactor into KUnit", v3:
hash.h: remove unused define directive
test_hash.c: split test_int_hash into arch-specific functions
test_hash.c: split test_hash_init
lib/Kconfig.debug: properly split hash test kernel entries
test_hash.c: refactor into kunit
Andy Shevchenko <andriy.shevchenko@linux.intel.com>:
kunit: replace kernel.h with the necessary inclusions
uuid: discourage people from using UAPI header in new code
uuid: remove licence boilerplate text from the header
Andrey Konovalov <andreyknvl@google.com>:
lib/test_meminit: destroy cache in kmem_cache_alloc_bulk() test
Subsystem: checkpatch
Jerome Forissier <jerome@forissier.org>:
checkpatch: relax regexp for COMMIT_LOG_LONG_LINE
Joe Perches <joe@perches.com>:
checkpatch: improve Kconfig help test
Rikard Falkeborn <rikard.falkeborn@gmail.com>:
const_structs.checkpatch: add frequently used ops structs
Subsystem: binfmt
"H.J. Lu" <hjl.tools@gmail.com>:
fs/binfmt_elf: use PT_LOAD p_align values for static PIE
Subsystem: nilfs2
Colin Ian King <colin.i.king@gmail.com>:
nilfs2: remove redundant pointer sbufs
Subsystem: hfs
Kees Cook <keescook@chromium.org>:
hfsplus: use struct_group_attr() for memcpy() region
Subsystem: fat
"NeilBrown" <neilb@suse.de>:
FAT: use io_schedule_timeout() instead of congestion_wait()
Subsystem: adfs
Minghao Chi <chi.minghao@zte.com.cn>:
fs/adfs: remove unneeded variable make code cleaner
Subsystem: panic
Marco Elver <elver@google.com>:
panic: use error_report_end tracepoint on warnings
Sebastian Andrzej Siewior <bigeasy@linutronix.de>:
panic: remove oops_id
Subsystem: delayacct
Yang Yang <yang.yang29@zte.com.cn>:
delayacct: support swapin delay accounting for swapping without blkio
delayacct: fix incomplete disable operation when switch enable to disable
delayacct: cleanup flags in struct task_delay_info and functions use it
wangyong <wang.yong12@zte.com.cn>:
Documentation/accounting/delay-accounting.rst: add thrashing page cache and direct compact
delayacct: track delays from memory compact
Subsystem: kconfig
Qian Cai <quic_qiancai@quicinc.com>:
configs: introduce debug.config for CI-like setup
Nathan Chancellor <nathan@kernel.org>:
Patch series "Fix CONFIG_TEST_KMOD with 256kB page size":
arch/Kconfig: split PAGE_SIZE_LESS_THAN_256KB from PAGE_SIZE_LESS_THAN_64KB
btrfs: use generic Kconfig option for 256kB page size limit
lib/Kconfig.debug: make TEST_KMOD depend on PAGE_SIZE_LESS_THAN_256KB
Subsystem: kcov
Marco Elver <elver@google.com>:
kcov: fix generic Kconfig dependencies if ARCH_WANTS_NO_INSTR
Subsystem: ubsan
Kees Cook <keescook@chromium.org>:
ubsan: remove CONFIG_UBSAN_OBJECT_SIZE
Colin Ian King <colin.i.king@gmail.com>:
lib: remove redundant assignment to variable ret
Documentation/accounting/delay-accounting.rst | 63 +-
arch/Kconfig | 4
arch/arm64/Kconfig | 20
arch/ia64/Kconfig | 9
arch/mips/Kconfig | 10
arch/mips/mm/init.c | 28 -
arch/powerpc/Kconfig | 17
arch/powerpc/kernel/setup_64.c | 113 ----
arch/riscv/Kconfig | 10
arch/sparc/Kconfig | 12
arch/sparc/kernel/led.c | 8
arch/sparc/kernel/smp_64.c | 119 -----
arch/x86/Kconfig | 19
arch/x86/kernel/setup_percpu.c | 82 ---
drivers/base/arch_numa.c | 78 ---
drivers/infiniband/hw/qib/qib.h | 2
drivers/infiniband/hw/qib/qib_file_ops.c | 2
drivers/infiniband/sw/rxe/rxe_qp.c | 3
drivers/net/wireless/broadcom/brcm80211/brcmfmac/xtlv.c | 2
fs/adfs/inode.c | 4
fs/binfmt_elf.c | 6
fs/btrfs/Kconfig | 3
fs/exec.c | 5
fs/fat/file.c | 5
fs/hfsplus/hfsplus_raw.h | 12
fs/hfsplus/xattr.c | 4
fs/nilfs2/page.c | 4
fs/proc/array.c | 3
fs/proc/base.c | 4
fs/proc/proc_sysctl.c | 9
fs/proc/vmcore.c | 10
include/kunit/assert.h | 2
include/linux/delayacct.h | 107 ++--
include/linux/elfcore-compat.h | 5
include/linux/elfcore.h | 5
include/linux/hash.h | 5
include/linux/kernel.h | 9
include/linux/kthread.h | 1
include/linux/list.h | 36 -
include/linux/percpu.h | 21
include/linux/proc_fs.h | 12
include/linux/sched.h | 9
include/linux/unaligned/packed_struct.h | 2
include/trace/events/error_report.h | 8
include/uapi/linux/taskstats.h | 6
include/uapi/linux/uuid.h | 10
kernel/configs/debug.config | 105 ++++
kernel/delayacct.c | 49 +-
kernel/kthread.c | 32 +
kernel/panic.c | 21
kernel/sys.c | 16
lib/Kconfig.debug | 45 +
lib/Kconfig.ubsan | 13
lib/Makefile | 5
lib/asn1_encoder.c | 2
lib/kstrtox.c | 12
lib/list_debug.c | 8
lib/lz4/lz4defs.h | 2
lib/test_hash.c | 375 +++++++---------
lib/test_meminit.c | 1
lib/test_ubsan.c | 22
mm/Kconfig | 12
mm/memory.c | 4
mm/page_alloc.c | 3
mm/page_io.c | 3
mm/percpu.c | 168 +++++--
samples/bpf/offwaketime_kern.c | 4
samples/bpf/test_overhead_kprobe_kern.c | 11
samples/bpf/test_overhead_tp_kern.c | 5
scripts/Makefile.ubsan | 1
scripts/checkpatch.pl | 54 +-
scripts/const_structs.checkpatch | 23
scripts/get_maintainer.pl | 2
tools/accounting/getdelays.c | 8
tools/bpf/bpftool/skeleton/pid_iter.bpf.c | 4
tools/include/linux/hash.h | 5
tools/testing/selftests/bpf/progs/test_stacktrace_map.c | 6
tools/testing/selftests/bpf/progs/test_tracepoint.c | 6
78 files changed, 943 insertions(+), 992 deletions(-)
^ permalink raw reply [flat|nested] 232+ messages in thread
* incoming
@ 2022-01-22 6:10 Andrew Morton
0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2022-01-22 6:10 UTC (permalink / raw)
To: Linus Torvalds; +Cc: linux-mm, mm-commits
This is the post-linux-next queue. Material which was based on or
dependent upon material which was in -next.
69 patches, based on 9b57f458985742bd1c585f4c7f36d04634ce1143.
Subsystems affected by this patch series:
mm/migration
sysctl
mm/zsmalloc
proc
lib
Subsystem: mm/migration
Alistair Popple <apopple@nvidia.com>:
mm/migrate.c: rework migration_entry_wait() to not take a pageref
Subsystem: sysctl
Xiaoming Ni <nixiaoming@huawei.com>:
Patch series "sysctl: first set of kernel/sysctl cleanups", v2:
sysctl: add a new register_sysctl_init() interface
sysctl: move some boundary constants from sysctl.c to sysctl_vals
hung_task: move hung_task sysctl interface to hung_task.c
watchdog: move watchdog sysctl interface to watchdog.c
Stephen Kitt <steve@sk2.org>:
sysctl: make ngroups_max const
Xiaoming Ni <nixiaoming@huawei.com>:
sysctl: use const for typically used max/min proc sysctls
sysctl: use SYSCTL_ZERO to replace some static int zero uses
aio: move aio sysctl to aio.c
dnotify: move dnotify sysctl to dnotify.c
Luis Chamberlain <mcgrof@kernel.org>:
Patch series "sysctl: second set of kernel/sysctl cleanups", v2:
hpet: simplify subdirectory registration with register_sysctl()
i915: simplify subdirectory registration with register_sysctl()
macintosh/mac_hid.c: simplify subdirectory registration with register_sysctl()
ocfs2: simplify subdirectory registration with register_sysctl()
test_sysctl: simplify subdirectory registration with register_sysctl()
Xiaoming Ni <nixiaoming@huawei.com>:
inotify: simplify subdirectory registration with register_sysctl()
Luis Chamberlain <mcgrof@kernel.org>:
cdrom: simplify subdirectory registration with register_sysctl()
Xiaoming Ni <nixiaoming@huawei.com>:
eventpoll: simplify sysctl declaration with register_sysctl()
Patch series "sysctl: 3rd set of kernel/sysctl cleanups", v2:
firmware_loader: move firmware sysctl to its own files
random: move the random sysctl declarations to its own file
Luis Chamberlain <mcgrof@kernel.org>:
sysctl: add helper to register a sysctl mount point
fs: move binfmt_misc sysctl to its own file
Xiaoming Ni <nixiaoming@huawei.com>:
printk: move printk sysctl to printk/sysctl.c
scsi/sg: move sg-big-buff sysctl to scsi/sg.c
stackleak: move stack_erasing sysctl to stackleak.c
Luis Chamberlain <mcgrof@kernel.org>:
sysctl: share unsigned long const values
Patch series "sysctl: 4th set of kernel/sysctl cleanups":
fs: move inode sysctls to its own file
fs: move fs stat sysctls to file_table.c
fs: move dcache sysctls to its own file
sysctl: move maxolduid as a sysctl specific const
fs: move shared sysctls to fs/sysctls.c
fs: move locking sysctls where they are used
fs: move namei sysctls to its own file
fs: move fs/exec.c sysctls into its own file
fs: move pipe sysctls to is own file
Patch series "sysctl: add and use base directory declarer and registration helper":
sysctl: add and use base directory declarer and registration helper
fs: move namespace sysctls and declare fs base directory
kernel/sysctl.c: rename sysctl_init() to sysctl_init_bases()
Xiaoming Ni <nixiaoming@huawei.com>:
printk: fix build warning when CONFIG_PRINTK=n
fs/coredump: move coredump sysctls into its own file
kprobe: move sysctl_kprobes_optimization to kprobes.c
Colin Ian King <colin.i.king@gmail.com>:
kernel/sysctl.c: remove unused variable ten_thousand
Baokun Li <libaokun1@huawei.com>:
sysctl: returns -EINVAL when a negative value is passed to proc_doulongvec_minmax
Subsystem: mm/zsmalloc
Minchan Kim <minchan@kernel.org>:
Patch series "zsmalloc: remove bit_spin_lock", v2:
zsmalloc: introduce some helper functions
zsmalloc: rename zs_stat_type to class_stat_type
zsmalloc: decouple class actions from zspage works
zsmalloc: introduce obj_allocated
zsmalloc: move huge compressed obj from page to zspage
zsmalloc: remove zspage isolation for migration
locking/rwlocks: introduce write_lock_nested
zsmalloc: replace per zpage lock with pool->migrate_lock
Mike Galbraith <umgwanakikbuti@gmail.com>:
zsmalloc: replace get_cpu_var with local_lock
Subsystem: proc
Muchun Song <songmuchun@bytedance.com>:
fs: proc: store PDE()->data into inode->i_private
proc: remove PDE_DATA() completely
Subsystem: lib
Vlastimil Babka <vbabka@suse.cz>:
lib/stackdepot: allow optional init and stack_table allocation by kvmalloc()
lib/stackdepot: fix spelling mistake and grammar in pr_err message
lib/stackdepot: allow optional init and stack_table allocation by kvmalloc() - fixup
lib/stackdepot: allow optional init and stack_table allocation by kvmalloc() - fixup3
lib/stackdepot: allow optional init and stack_table allocation by kvmalloc() - fixup4
Marco Elver <elver@google.com>:
lib/stackdepot: always do filter_irq_stacks() in stack_depot_save()
Christoph Hellwig <hch@lst.de>:
Patch series "remove Xen tmem leftovers":
mm: remove cleancache
frontswap: remove frontswap_writethrough
frontswap: remove frontswap_tmem_exclusive_gets
frontswap: remove frontswap_shrink
frontswap: remove frontswap_curr_pages
frontswap: simplify frontswap_init
frontswap: remove the frontswap exports
mm: simplify try_to_unuse
frontswap: remove frontswap_test
frontswap: simplify frontswap_register_ops
mm: mark swap_lock and swap_active_head static
frontswap: remove support for multiple ops
mm: hide the FRONTSWAP Kconfig symbol
Documentation/vm/cleancache.rst | 296 ------
Documentation/vm/frontswap.rst | 31
Documentation/vm/index.rst | 1
MAINTAINERS | 7
arch/alpha/kernel/srm_env.c | 4
arch/arm/configs/bcm2835_defconfig | 1
arch/arm/configs/qcom_defconfig | 1
arch/arm/kernel/atags_proc.c | 2
arch/arm/mm/alignment.c | 2
arch/ia64/kernel/salinfo.c | 10
arch/m68k/configs/amiga_defconfig | 1
arch/m68k/configs/apollo_defconfig | 1
arch/m68k/configs/atari_defconfig | 1
arch/m68k/configs/bvme6000_defconfig | 1
arch/m68k/configs/hp300_defconfig | 1
arch/m68k/configs/mac_defconfig | 1
arch/m68k/configs/multi_defconfig | 1
arch/m68k/configs/mvme147_defconfig | 1
arch/m68k/configs/mvme16x_defconfig | 1
arch/m68k/configs/q40_defconfig | 1
arch/m68k/configs/sun3_defconfig | 1
arch/m68k/configs/sun3x_defconfig | 1
arch/powerpc/kernel/proc_powerpc.c | 4
arch/s390/configs/debug_defconfig | 1
arch/s390/configs/defconfig | 1
arch/sh/mm/alignment.c | 4
arch/xtensa/platforms/iss/simdisk.c | 4
block/bdev.c | 5
drivers/acpi/proc.c | 2
drivers/base/firmware_loader/fallback.c | 7
drivers/base/firmware_loader/fallback.h | 11
drivers/base/firmware_loader/fallback_table.c | 25
drivers/cdrom/cdrom.c | 23
drivers/char/hpet.c | 22
drivers/char/random.c | 14
drivers/gpu/drm/drm_dp_mst_topology.c | 1
drivers/gpu/drm/drm_mm.c | 4
drivers/gpu/drm/drm_modeset_lock.c | 9
drivers/gpu/drm/i915/i915_perf.c | 22
drivers/gpu/drm/i915/intel_runtime_pm.c | 3
drivers/hwmon/dell-smm-hwmon.c | 4
drivers/macintosh/mac_hid.c | 24
drivers/net/bonding/bond_procfs.c | 8
drivers/net/wireless/cisco/airo.c | 22
drivers/net/wireless/intersil/hostap/hostap_ap.c | 16
drivers/net/wireless/intersil/hostap/hostap_download.c | 2
drivers/net/wireless/intersil/hostap/hostap_proc.c | 24
drivers/net/wireless/ray_cs.c | 2
drivers/nubus/proc.c | 36
drivers/parisc/led.c | 4
drivers/pci/proc.c | 10
drivers/platform/x86/thinkpad_acpi.c | 4
drivers/platform/x86/toshiba_acpi.c | 16
drivers/pnp/isapnp/proc.c | 2
drivers/pnp/pnpbios/proc.c | 4
drivers/scsi/scsi_proc.c | 4
drivers/scsi/sg.c | 35
drivers/usb/gadget/function/rndis.c | 4
drivers/zorro/proc.c | 2
fs/Makefile | 4
fs/afs/proc.c | 6
fs/aio.c | 31
fs/binfmt_misc.c | 6
fs/btrfs/extent_io.c | 10
fs/btrfs/super.c | 2
fs/coredump.c | 66 +
fs/dcache.c | 37
fs/eventpoll.c | 10
fs/exec.c | 145 +--
fs/ext4/mballoc.c | 14
fs/ext4/readpage.c | 6
fs/ext4/super.c | 3
fs/f2fs/data.c | 13
fs/file_table.c | 47 -
fs/inode.c | 39
fs/jbd2/journal.c | 2
fs/locks.c | 34
fs/mpage.c | 7
fs/namei.c | 58 +
fs/namespace.c | 24
fs/notify/dnotify/dnotify.c | 21
fs/notify/fanotify/fanotify_user.c | 10
fs/notify/inotify/inotify_user.c | 11
fs/ntfs3/ntfs_fs.h | 1
fs/ocfs2/stackglue.c | 25
fs/ocfs2/super.c | 2
fs/pipe.c | 64 +
fs/proc/generic.c | 6
fs/proc/inode.c | 1
fs/proc/internal.h | 5
fs/proc/proc_net.c | 8
fs/proc/proc_sysctl.c | 67 +
fs/super.c | 3
fs/sysctls.c | 47 -
include/linux/aio.h | 4
include/linux/cleancache.h | 124 --
include/linux/coredump.h | 10
include/linux/dcache.h | 10
include/linux/dnotify.h | 1
include/linux/fanotify.h | 2
include/linux/frontswap.h | 35
include/linux/fs.h | 18
include/linux/inotify.h | 3
include/linux/kprobes.h | 6
include/linux/migrate.h | 2
include/linux/mount.h | 3
include/linux/pipe_fs_i.h | 4
include/linux/poll.h | 2
include/linux/printk.h | 4
include/linux/proc_fs.h | 17
include/linux/ref_tracker.h | 2
include/linux/rwlock.h | 6
include/linux/rwlock_api_smp.h | 8
include/linux/rwlock_rt.h | 10
include/linux/sched/sysctl.h | 14
include/linux/seq_file.h | 2
include/linux/shmem_fs.h | 3
include/linux/spinlock_api_up.h | 1
include/linux/stackdepot.h | 25
include/linux/stackleak.h | 5
include/linux/swapfile.h | 3
include/linux/sysctl.h | 67 +
include/scsi/sg.h | 4
init/main.c | 9
ipc/util.c | 2
kernel/hung_task.c | 81 +
kernel/irq/proc.c | 8
kernel/kprobes.c | 30
kernel/locking/spinlock.c | 10
kernel/locking/spinlock_rt.c | 12
kernel/printk/Makefile | 5
kernel/printk/internal.h | 8
kernel/printk/printk.c | 4
kernel/printk/sysctl.c | 85 +
kernel/resource.c | 4
kernel/stackleak.c | 26
kernel/sysctl.c | 790 +----------------
kernel/watchdog.c | 101 ++
lib/Kconfig | 4
lib/Kconfig.kasan | 2
lib/stackdepot.c | 46
lib/test_sysctl.c | 22
mm/Kconfig | 40
mm/Makefile | 1
mm/cleancache.c | 315 ------
mm/filemap.c | 102 +-
mm/frontswap.c | 259 -----
mm/kasan/common.c | 1
mm/migrate.c | 38
mm/page_owner.c | 2
mm/shmem.c | 33
mm/swapfile.c | 90 -
mm/truncate.c | 15
mm/zsmalloc.c | 557 ++++-------
mm/zswap.c | 8
net/atm/proc.c | 4
net/bluetooth/af_bluetooth.c | 8
net/can/bcm.c | 2
net/can/proc.c | 2
net/core/neighbour.c | 6
net/core/pktgen.c | 6
net/ipv4/netfilter/ipt_CLUSTERIP.c | 6
net/ipv4/raw.c | 8
net/ipv4/tcp_ipv4.c | 2
net/ipv4/udp.c | 6
net/netfilter/x_tables.c | 10
net/netfilter/xt_hashlimit.c | 18
net/netfilter/xt_recent.c | 4
net/sunrpc/auth_gss/svcauth_gss.c | 4
net/sunrpc/cache.c | 24
net/sunrpc/stats.c | 2
sound/core/info.c | 4
172 files changed, 1877 insertions(+), 2931 deletions(-)
^ permalink raw reply [flat|nested] 232+ messages in thread
* incoming
@ 2022-01-29 2:13 Andrew Morton
2022-01-29 4:25 ` incoming Matthew Wilcox
0 siblings, 1 reply; 232+ messages in thread
From: Andrew Morton @ 2022-01-29 2:13 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm
12 patches, based on 169387e2aa291a4e3cb856053730fe99d6cec06f.
Subsystems affected by this patch series:
sysctl
binfmt
ia64
mm/memory-failure
mm/folios
selftests
mm/kasan
mm/psi
ocfs2
Subsystem: sysctl
Andrew Morton <akpm@linux-foundation.org>:
include/linux/sysctl.h: fix register_sysctl_mount_point() return type
Subsystem: binfmt
Tong Zhang <ztong0001@gmail.com>:
binfmt_misc: fix crash when load/unload module
Subsystem: ia64
Randy Dunlap <rdunlap@infradead.org>:
ia64: make IA64_MCA_RECOVERY bool instead of tristate
Subsystem: mm/memory-failure
Joao Martins <joao.m.martins@oracle.com>:
memory-failure: fetch compound_head after pgmap_pfn_valid()
Subsystem: mm/folios
Wei Yang <richard.weiyang@gmail.com>:
mm: page->mapping folio->mapping should have the same offset
Subsystem: selftests
Maor Gottlieb <maorg@nvidia.com>:
tools/testing/scatterlist: add missing defines
Subsystem: mm/kasan
Marco Elver <elver@google.com>:
kasan: test: fix compatibility with FORTIFY_SOURCE
Peter Collingbourne <pcc@google.com>:
mm, kasan: use compare-exchange operation to set KASAN page tag
Subsystem: mm/psi
Suren Baghdasaryan <surenb@google.com>:
psi: fix "no previous prototype" warnings when CONFIG_CGROUPS=n
psi: fix "defined but not used" warnings when CONFIG_PROC_FS=n
Subsystem: ocfs2
Joseph Qi <joseph.qi@linux.alibaba.com>:
Patch series "ocfs2: fix a deadlock case":
jbd2: export jbd2_journal_[grab|put]_journal_head
ocfs2: fix a deadlock when commit trans
arch/ia64/Kconfig | 2
fs/binfmt_misc.c | 8 +--
fs/jbd2/journal.c | 2
fs/ocfs2/suballoc.c | 25 ++++-------
include/linux/mm.h | 17 +++++--
include/linux/mm_types.h | 1
include/linux/psi.h | 11 ++--
include/linux/sysctl.h | 2
kernel/sched/psi.c | 79 ++++++++++++++++++-----------------
lib/test_kasan.c | 5 ++
mm/memory-failure.c | 6 ++
tools/testing/scatterlist/linux/mm.h | 3 -
12 files changed, 91 insertions(+), 70 deletions(-)
^ permalink raw reply [flat|nested] 232+ messages in thread
* Re: incoming
2022-01-29 2:13 incoming Andrew Morton
@ 2022-01-29 4:25 ` Matthew Wilcox
2022-01-29 6:23 ` incoming Andrew Morton
0 siblings, 1 reply; 232+ messages in thread
From: Matthew Wilcox @ 2022-01-29 4:25 UTC (permalink / raw)
To: Andrew Morton; +Cc: Linus Torvalds, mm-commits, linux-mm
On Fri, Jan 28, 2022 at 06:13:41PM -0800, Andrew Morton wrote:
> 12 patches, based on 169387e2aa291a4e3cb856053730fe99d6cec06f.
^^
I see 7?
^ permalink raw reply [flat|nested] 232+ messages in thread
* Re: incoming
2022-01-29 4:25 ` incoming Matthew Wilcox
@ 2022-01-29 6:23 ` Andrew Morton
0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2022-01-29 6:23 UTC (permalink / raw)
To: Matthew Wilcox; +Cc: Linus Torvalds, mm-commits, linux-mm
On Sat, 29 Jan 2022 04:25:33 +0000 Matthew Wilcox <willy@infradead.org> wrote:
> On Fri, Jan 28, 2022 at 06:13:41PM -0800, Andrew Morton wrote:
> > 12 patches, based on 169387e2aa291a4e3cb856053730fe99d6cec06f.
> ^^
>
> I see 7?
Crap, sorry, ignore all this, shall redo tomorrow.
(It wasn't a good day over here. The thing with disk drives is that
the bigger they are, the harder they fall).
^ permalink raw reply [flat|nested] 232+ messages in thread
* incoming
@ 2022-01-29 21:40 Andrew Morton
0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2022-01-29 21:40 UTC (permalink / raw)
To: Linus Torvalds; +Cc: linux-mm, mm-commits
12 patches, based on f8c7e4ede46fe63ff10000669652648aab09d112.
Subsystems affected by this patch series:
sysctl
binfmt
ia64
mm/memory-failure
mm/folios
selftests
mm/kasan
mm/psi
ocfs2
Subsystem: sysctl
Andrew Morton <akpm@linux-foundation.org>:
include/linux/sysctl.h: fix register_sysctl_mount_point() return type
Subsystem: binfmt
Tong Zhang <ztong0001@gmail.com>:
binfmt_misc: fix crash when load/unload module
Subsystem: ia64
Randy Dunlap <rdunlap@infradead.org>:
ia64: make IA64_MCA_RECOVERY bool instead of tristate
Subsystem: mm/memory-failure
Joao Martins <joao.m.martins@oracle.com>:
memory-failure: fetch compound_head after pgmap_pfn_valid()
Subsystem: mm/folios
Wei Yang <richard.weiyang@gmail.com>:
mm: page->mapping folio->mapping should have the same offset
Subsystem: selftests
Maor Gottlieb <maorg@nvidia.com>:
tools/testing/scatterlist: add missing defines
Subsystem: mm/kasan
Marco Elver <elver@google.com>:
kasan: test: fix compatibility with FORTIFY_SOURCE
Peter Collingbourne <pcc@google.com>:
mm, kasan: use compare-exchange operation to set KASAN page tag
Subsystem: mm/psi
Suren Baghdasaryan <surenb@google.com>:
psi: fix "no previous prototype" warnings when CONFIG_CGROUPS=n
psi: fix "defined but not used" warnings when CONFIG_PROC_FS=n
Subsystem: ocfs2
Joseph Qi <joseph.qi@linux.alibaba.com>:
Patch series "ocfs2: fix a deadlock case":
jbd2: export jbd2_journal_[grab|put]_journal_head
ocfs2: fix a deadlock when commit trans
arch/ia64/Kconfig | 2
fs/binfmt_misc.c | 8 +--
fs/jbd2/journal.c | 2
fs/ocfs2/suballoc.c | 25 ++++-------
include/linux/mm.h | 17 +++++--
include/linux/mm_types.h | 1
include/linux/psi.h | 11 ++--
include/linux/sysctl.h | 2
kernel/sched/psi.c | 79 ++++++++++++++++++-----------------
lib/test_kasan.c | 5 ++
mm/memory-failure.c | 6 ++
tools/testing/scatterlist/linux/mm.h | 3 -
12 files changed, 91 insertions(+), 70 deletions(-)
^ permalink raw reply [flat|nested] 232+ messages in thread
* incoming
@ 2022-02-04 4:48 Andrew Morton
0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2022-02-04 4:48 UTC (permalink / raw)
To: Linus Torvalds; +Cc: linux-mm, mm-commits
10 patches, based on 1f2cfdd349b7647f438c1e552dc1b983da86d830.
Subsystems affected by this patch series:
mm/vmscan
mm/debug
mm/pagemap
ipc
mm/kmemleak
MAINTAINERS
mm/selftests
Subsystem: mm/vmscan
Chen Wandun <chenwandun@huawei.com>:
Revert "mm/page_isolation: unset migratetype directly for non Buddy page"
Subsystem: mm/debug
Pasha Tatashin <pasha.tatashin@soleen.com>:
Patch series "page table check fixes and cleanups", v5:
mm/debug_vm_pgtable: remove pte entry from the page table
mm/page_table_check: use unsigned long for page counters and cleanup
mm/khugepaged: unify collapse pmd clear, flush and free
mm/page_table_check: check entries at pmd levels
Subsystem: mm/pagemap
Mike Rapoport <rppt@linux.ibm.com>:
mm/pgtable: define pte_index so that preprocessor could recognize it
Subsystem: ipc
Minghao Chi <chi.minghao@zte.com.cn>:
ipc/sem: do not sleep with a spin lock held
Subsystem: mm/kmemleak
Lang Yu <lang.yu@amd.com>:
mm/kmemleak: avoid scanning potential huge holes
Subsystem: MAINTAINERS
Mike Rapoport <rppt@linux.ibm.com>:
MAINTAINERS: update rppt's email
Subsystem: mm/selftests
Shuah Khan <skhan@linuxfoundation.org>:
kselftest/vm: revert "tools/testing/selftests/vm/userfaultfd.c: use swap() to make code cleaner"
MAINTAINERS | 2 -
include/linux/page_table_check.h | 19 ++++++++++
include/linux/pgtable.h | 1
ipc/sem.c | 4 +-
mm/debug_vm_pgtable.c | 2 +
mm/khugepaged.c | 37 +++++++++++---------
mm/kmemleak.c | 13 +++----
mm/page_isolation.c | 2 -
mm/page_table_check.c | 55 +++++++++++++++----------------
tools/testing/selftests/vm/userfaultfd.c | 11 ++++--
10 files changed, 89 insertions(+), 57 deletions(-)
^ permalink raw reply [flat|nested] 232+ messages in thread
* incoming
@ 2022-02-12 0:27 Andrew Morton
2022-02-12 2:02 ` incoming Linus Torvalds
0 siblings, 1 reply; 232+ messages in thread
From: Andrew Morton @ 2022-02-12 0:27 UTC (permalink / raw)
To: Linus Torvalds; +Cc: linux-mm, mm-commits, patches
5 patches, based on f1baf68e1383f6ed93eb9cff2866d46562607a43.
Subsystems affected by this patch series:
binfmt
procfs
mm/vmscan
mm/memcg
mm/kfence
Subsystem: binfmt
Mike Rapoport <rppt@linux.ibm.com>:
fs/binfmt_elf: fix PT_LOAD p_align values for loaders
Subsystem: procfs
Yang Shi <shy828301@gmail.com>:
fs/proc: task_mmu.c: don't read mapcount for migration entry
Subsystem: mm/vmscan
Mel Gorman <mgorman@suse.de>:
mm: vmscan: remove deadlock due to throttling failing to make progress
Subsystem: mm/memcg
Roman Gushchin <guro@fb.com>:
mm: memcg: synchronize objcg lists with a dedicated spinlock
Subsystem: mm/kfence
Peng Liu <liupeng256@huawei.com>:
kfence: make test case compatible with run time set sample interval
fs/binfmt_elf.c | 2 +-
fs/proc/task_mmu.c | 40 +++++++++++++++++++++++++++++++---------
include/linux/kfence.h | 2 ++
include/linux/memcontrol.h | 5 +++--
mm/kfence/core.c | 3 ++-
mm/kfence/kfence_test.c | 8 ++++----
mm/memcontrol.c | 10 +++++-----
mm/vmscan.c | 4 +++-
8 files changed, 51 insertions(+), 23 deletions(-)
^ permalink raw reply [flat|nested] 232+ messages in thread
* Re: incoming
2022-02-12 0:27 incoming Andrew Morton
@ 2022-02-12 2:02 ` Linus Torvalds
2022-02-12 5:24 ` incoming Andrew Morton
0 siblings, 1 reply; 232+ messages in thread
From: Linus Torvalds @ 2022-02-12 2:02 UTC (permalink / raw)
To: Andrew Morton; +Cc: Linux-MM, mm-commits, patches
On Fri, Feb 11, 2022 at 4:27 PM Andrew Morton <akpm@linux-foundation.org> wrote:
>
> 5 patches, based on f1baf68e1383f6ed93eb9cff2866d46562607a43.
So this *completely* flummoxed 'b4', because you first sent the wrong
series, and then sent the right one in the same thread.
I fetched the emails manually, but honestly, this was confusing even
then, with two "[PATCH x/5]" series where the only way to tell the
right one was basically by date of email. They did arrive in the same
order in my mailbox, but even that wouldn't have been guaranteed if
there had been some mailer delays somewhere..
So next time when you mess up, resend it all as a completely new
series and completely new threading - so with a new header email too.
Please?
And since I'm here, let me just verify that yes, the series you
actually want me to apply is this one (as described by the head
email):
Subject: [patch 1/5] fs/binfmt_elf: fix PT_LOAD p_align values ..
Subject: [patch 2/5] fs/proc: task_mmu.c: don't read mapcount f..
Subject: [patch 3/5] mm: vmscan: remove deadlock due to throttl..
Subject: [patch 4/5] mm: memcg: synchronize objcg lists with a ..
Subject: [patch 5/5] kfence: make test case compatible with run..
and not the other one with GUP patches?
Linus
^ permalink raw reply [flat|nested] 232+ messages in thread
* Re: incoming
2022-02-12 2:02 ` incoming Linus Torvalds
@ 2022-02-12 5:24 ` Andrew Morton
0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2022-02-12 5:24 UTC (permalink / raw)
To: Linus Torvalds; +Cc: Linux-MM, mm-commits, patches
On Fri, 11 Feb 2022 18:02:53 -0800 Linus Torvalds <torvalds@linux-foundation.org> wrote:
> On Fri, Feb 11, 2022 at 4:27 PM Andrew Morton <akpm@linux-foundation.org> wrote:
> >
> > 5 patches, based on f1baf68e1383f6ed93eb9cff2866d46562607a43.
>
> So this *completely* flummoxed 'b4', because you first sent the wrong
> series, and then sent the right one in the same thread.
>
> I fetched the emails manually, but honestly, this was confusing even
> then, with two "[PATCH x/5]" series where the only way to tell the
> right one was basically by date of email. They did arrive in the same
> order in my mailbox, but even that wouldn't have been guaranteed if
> there had been some mailer delays somewhere..
Yes, I wondered. Sorry bout that.
> So next time when you mess up, resend it all as a completely new
> series and completely new threading - so with a new header email too.
> Please?
Wilco.
> And since I'm here, let me just verify that yes, the series you
> actually want me to apply is this one (as described by the head
> email):
>
> Subject: [patch 1/5] fs/binfmt_elf: fix PT_LOAD p_align values ..
> Subject: [patch 2/5] fs/proc: task_mmu.c: don't read mapcount f..
> Subject: [patch 3/5] mm: vmscan: remove deadlock due to throttl..
> Subject: [patch 4/5] mm: memcg: synchronize objcg lists with a ..
> Subject: [patch 5/5] kfence: make test case compatible with run..
>
> and not the other one with GUP patches?
Those are the ones. Five fixes, three with cc:stable.
^ permalink raw reply [flat|nested] 232+ messages in thread
* incoming
@ 2022-02-26 3:10 Andrew Morton
0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2022-02-26 3:10 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm, patches
12 patches, based on c47658311d60be064b839f329c0e4d34f5f0735b.
Subsystems affected by this patch series:
MAINTAINERS
mm/hugetlb
mm/kasan
mm/hugetlbfs
mm/pagemap
mm/selftests
mm/memcg
m/slab
mailmap
memfd
Subsystem: MAINTAINERS
Luis Chamberlain <mcgrof@kernel.org>:
MAINTAINERS: add sysctl-next git tree
Subsystem: mm/hugetlb
"Aneesh Kumar K.V" <aneesh.kumar@linux.ibm.com>:
mm/hugetlb: fix kernel crash with hugetlb mremap
Subsystem: mm/kasan
Andrey Konovalov <andreyknvl@google.com>:
kasan: test: prevent cache merging in kmem_cache_double_destroy
Subsystem: mm/hugetlbfs
Liu Yuntao <liuyuntao10@huawei.com>:
hugetlbfs: fix a truncation issue in hugepages parameter
Subsystem: mm/pagemap
Suren Baghdasaryan <surenb@google.com>:
mm: fix use-after-free bug when mm->mmap is reused after being freed
Subsystem: mm/selftests
"Aneesh Kumar K.V" <aneesh.kumar@linux.ibm.com>:
selftest/vm: fix map_fixed_noreplace test failure
Subsystem: mm/memcg
Roman Gushchin <roman.gushchin@linux.dev>:
MAINTAINERS: add Roman as a memcg co-maintainer
Vladimir Davydov <vdavydov.dev@gmail.com>:
MAINTAINERS: remove Vladimir from memcg maintainers
Shakeel Butt <shakeelb@google.com>:
MAINTAINERS: add Shakeel as a memcg co-maintainer
Subsystem: m/slab
Vlastimil Babka <vbabka@suse.cz>:
MAINTAINERS, SLAB: add Roman as reviewer, git tree
Subsystem: mailmap
Roman Gushchin <roman.gushchin@linux.dev>:
mailmap: update Roman Gushchin's email
Subsystem: memfd
Mike Kravetz <mike.kravetz@oracle.com>:
selftests/memfd: clean up mapping in mfd_fail_write
.mailmap | 3 +
MAINTAINERS | 6 ++
lib/test_kasan.c | 5 +-
mm/hugetlb.c | 11 ++---
mm/mmap.c | 1
tools/testing/selftests/memfd/memfd_test.c | 1
tools/testing/selftests/vm/map_fixed_noreplace.c | 49 +++++++++++++++++------
7 files changed, 56 insertions(+), 20 deletions(-)
^ permalink raw reply [flat|nested] 232+ messages in thread
* incoming
@ 2022-03-05 4:28 Andrew Morton
0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2022-03-05 4:28 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm, patches
8 patches, based on 07ebd38a0da24d2534da57b4841346379db9f354.
Subsystems affected by this patch series:
mm/hugetlb
mm/pagemap
memfd
selftests
mm/userfaultfd
kconfig
Subsystem: mm/hugetlb
Mike Kravetz <mike.kravetz@oracle.com>:
selftests/vm: cleanup hugetlb file after mremap test
Subsystem: mm/pagemap
Suren Baghdasaryan <surenb@google.com>:
mm: refactor vm_area_struct::anon_vma_name usage code
mm: prevent vm_area_struct::anon_name refcount saturation
mm: fix use-after-free when anon vma name is used after vma is freed
Subsystem: memfd
Hugh Dickins <hughd@google.com>:
memfd: fix F_SEAL_WRITE after shmem huge page allocated
Subsystem: selftests
Chengming Zhou <zhouchengming@bytedance.com>:
kselftest/vm: fix tests build with old libc
Subsystem: mm/userfaultfd
Yun Zhou <yun.zhou@windriver.com>:
proc: fix documentation and description of pagemap
Subsystem: kconfig
Qian Cai <quic_qiancai@quicinc.com>:
configs/debug: set CONFIG_DEBUG_INFO=y properly
Documentation/admin-guide/mm/pagemap.rst | 2
fs/proc/task_mmu.c | 9 +-
fs/userfaultfd.c | 6 -
include/linux/mm.h | 7 +
include/linux/mm_inline.h | 105 ++++++++++++++++++---------
include/linux/mm_types.h | 5 +
kernel/configs/debug.config | 2
kernel/fork.c | 4 -
kernel/sys.c | 19 +++-
mm/madvise.c | 98 +++++++++----------------
mm/memfd.c | 40 +++++++---
mm/mempolicy.c | 2
mm/mlock.c | 2
mm/mmap.c | 12 +--
mm/mprotect.c | 2
tools/testing/selftests/vm/hugepage-mremap.c | 26 ++++--
tools/testing/selftests/vm/run_vmtests.sh | 3
tools/testing/selftests/vm/userfaultfd.c | 1
18 files changed, 201 insertions(+), 144 deletions(-)
^ permalink raw reply [flat|nested] 232+ messages in thread
* incoming
@ 2022-03-16 23:14 Andrew Morton
0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2022-03-16 23:14 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm, patches
4 patches, based on 56e337f2cf1326323844927a04e9dbce9a244835.
Subsystems affected by this patch series:
mm/swap
kconfig
ocfs2
selftests
Subsystem: mm/swap
Guo Ziliang <guo.ziliang@zte.com.cn>:
mm: swap: get rid of deadloop in swapin readahead
Subsystem: kconfig
Qian Cai <quic_qiancai@quicinc.com>:
configs/debug: restore DEBUG_INFO=y for overriding
Subsystem: ocfs2
Joseph Qi <joseph.qi@linux.alibaba.com>:
ocfs2: fix crash when initialize filecheck kobj fails
Subsystem: selftests
Yosry Ahmed <yosryahmed@google.com>:
selftests: vm: fix clang build error multiple output files
fs/ocfs2/super.c | 22 +++++++++++-----------
kernel/configs/debug.config | 1 +
mm/swap_state.c | 2 +-
tools/testing/selftests/vm/Makefile | 6 ++----
4 files changed, 15 insertions(+), 16 deletions(-)
^ permalink raw reply [flat|nested] 232+ messages in thread
* incoming
@ 2022-03-22 21:38 Andrew Morton
0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2022-03-22 21:38 UTC (permalink / raw)
To: Linus Torvalds; +Cc: linux-mm, mm-commits, patches
- A few misc subsystems
- There is a lot of MM material in Willy's tree. Folio work and
non-folio patches which depended on that work.
Here I send almost all the MM patches which precede the patches in
Willy's tree. The remaining ~100 MM patches are staged on Willy's
tree and I'll send those along once Willy is merged up.
I tried this batch against your current tree (as of
51912904076680281) and a couple need some extra persuasion to apply,
but all looks OK otherwise.
227 patches, based on f443e374ae131c168a065ea1748feac6b2e76613
Subsystems affected by this patch series:
kthread
scripts
ntfs
ocfs2
block
vfs
mm/kasan
mm/pagecache
mm/gup
mm/swap
mm/shmem
mm/memcg
mm/selftests
mm/pagemap
mm/mremap
mm/sparsemem
mm/vmalloc
mm/pagealloc
mm/memory-failure
mm/mlock
mm/hugetlb
mm/userfaultfd
mm/vmscan
mm/compaction
mm/mempolicy
mm/oom-kill
mm/migration
mm/thp
mm/cma
mm/autonuma
mm/psi
mm/ksm
mm/page-poison
mm/madvise
mm/memory-hotplug
mm/rmap
mm/zswap
mm/uaccess
mm/ioremap
mm/highmem
mm/cleanups
mm/kfence
mm/hmm
mm/damon
Subsystem: kthread
Rasmus Villemoes <linux@rasmusvillemoes.dk>:
linux/kthread.h: remove unused macros
Subsystem: scripts
Colin Ian King <colin.i.king@gmail.com>:
scripts/spelling.txt: add more spellings to spelling.txt
Subsystem: ntfs
Dongliang Mu <mudongliangabcd@gmail.com>:
ntfs: add sanity check on allocation size
Subsystem: ocfs2
Joseph Qi <joseph.qi@linux.alibaba.com>:
ocfs2: cleanup some return variables
hongnanli <hongnan.li@linux.alibaba.com>:
fs/ocfs2: fix comments mentioning i_mutex
Subsystem: block
NeilBrown <neilb@suse.de>:
Patch series "Remove remaining parts of congestion tracking code", v2:
doc: convert 'subsection' to 'section' in gfp.h
mm: document and polish read-ahead code
mm: improve cleanup when ->readpages doesn't process all pages
fuse: remove reliance on bdi congestion
nfs: remove reliance on bdi congestion
ceph: remove reliance on bdi congestion
remove inode_congested()
remove bdi_congested() and wb_congested() and related functions
f2fs: replace congestion_wait() calls with io_schedule_timeout()
block/bfq-iosched.c: use "false" rather than "BLK_RW_ASYNC"
remove congestion tracking framework
Subsystem: vfs
Anthony Iliopoulos <ailiop@suse.com>:
mount: warn only once about timestamp range expiration
Subsystem: mm/kasan
Miaohe Lin <linmiaohe@huawei.com>:
mm/memremap: avoid calling kasan_remove_zero_shadow() for device private memory
Subsystem: mm/pagecache
Miaohe Lin <linmiaohe@huawei.com>:
filemap: remove find_get_pages()
mm/writeback: minor clean up for highmem_dirtyable_memory
Minchan Kim <minchan@kernel.org>:
mm: fs: fix lru_cache_disabled race in bh_lru
Subsystem: mm/gup
Peter Xu <peterx@redhat.com>:
Patch series "mm/gup: some cleanups", v5:
mm: fix invalid page pointer returned with FOLL_PIN gups
John Hubbard <jhubbard@nvidia.com>:
mm/gup: follow_pfn_pte(): -EEXIST cleanup
mm/gup: remove unused pin_user_pages_locked()
mm: change lookup_node() to use get_user_pages_fast()
mm/gup: remove unused get_user_pages_locked()
Subsystem: mm/swap
Bang Li <libang.linuxer@gmail.com>:
mm/swap: fix confusing comment in folio_mark_accessed
Subsystem: mm/shmem
Xavier Roche <xavier.roche@algolia.com>:
tmpfs: support for file creation time
Hugh Dickins <hughd@google.com>:
shmem: mapping_set_exiting() to help mapped resilience
tmpfs: do not allocate pages on read
Miaohe Lin <linmiaohe@huawei.com>:
mm: shmem: use helper macro __ATTR_RW
Subsystem: mm/memcg
Shakeel Butt <shakeelb@google.com>:
memcg: replace in_interrupt() with !in_task()
Yosry Ahmed <yosryahmed@google.com>:
memcg: add per-memcg total kernel memory stat
Wei Yang <richard.weiyang@gmail.com>:
mm/memcg: mem_cgroup_per_node is already set to 0 on allocation
mm/memcg: retrieve parent memcg from css.parent
Shakeel Butt <shakeelb@google.com>:
Patch series "memcg: robust enforcement of memory.high", v2:
memcg: refactor mem_cgroup_oom
memcg: unify force charging conditions
selftests: memcg: test high limit for single entry allocation
memcg: synchronously enforce memory.high for large overcharges
Randy Dunlap <rdunlap@infradead.org>:
mm/memcontrol: return 1 from cgroup.memory __setup() handler
Michal Hocko <mhocko@suse.com>:
Patch series "mm/memcg: Address PREEMPT_RT problems instead of disabling it", v5:
mm/memcg: revert ("mm/memcg: optimize user context object stock access")
Sebastian Andrzej Siewior <bigeasy@linutronix.de>:
mm/memcg: disable threshold event handlers on PREEMPT_RT
mm/memcg: protect per-CPU counter by disabling preemption on PREEMPT_RT where needed.
Johannes Weiner <hannes@cmpxchg.org>:
mm/memcg: opencode the inner part of obj_cgroup_uncharge_pages() in drain_obj_stock()
Sebastian Andrzej Siewior <bigeasy@linutronix.de>:
mm/memcg: protect memcg_stock with a local_lock_t
mm/memcg: disable migration instead of preemption in drain_all_stock().
Muchun Song <songmuchun@bytedance.com>:
Patch series "Optimize list lru memory consumption", v6:
mm: list_lru: transpose the array of per-node per-memcg lru lists
mm: introduce kmem_cache_alloc_lru
fs: introduce alloc_inode_sb() to allocate filesystems specific inode
fs: allocate inode by using alloc_inode_sb()
f2fs: allocate inode by using alloc_inode_sb()
mm: dcache: use kmem_cache_alloc_lru() to allocate dentry
xarray: use kmem_cache_alloc_lru to allocate xa_node
mm: memcontrol: move memcg_online_kmem() to mem_cgroup_css_online()
mm: list_lru: allocate list_lru_one only when needed
mm: list_lru: rename memcg_drain_all_list_lrus to memcg_reparent_list_lrus
mm: list_lru: replace linear array with xarray
mm: memcontrol: reuse memory cgroup ID for kmem ID
mm: memcontrol: fix cannot alloc the maximum memcg ID
mm: list_lru: rename list_lru_per_memcg to list_lru_memcg
mm: memcontrol: rename memcg_cache_id to memcg_kmem_id
Vasily Averin <vvs@virtuozzo.com>:
memcg: enable accounting for tty-related objects
Subsystem: mm/selftests
Guillaume Tucker <guillaume.tucker@collabora.com>:
selftests, x86: fix how check_cc.sh is being invoked
Subsystem: mm/pagemap
Anshuman Khandual <anshuman.khandual@arm.com>:
mm: merge pte_mkhuge() call into arch_make_huge_pte()
Stafford Horne <shorne@gmail.com>:
mm: remove mmu_gathers storage from remaining architectures
Muchun Song <songmuchun@bytedance.com>:
Patch series "Fix some cache flush bugs", v5:
mm: thp: fix wrong cache flush in remove_migration_pmd()
mm: fix missing cache flush for all tail pages of compound page
mm: hugetlb: fix missing cache flush in copy_huge_page_from_user()
mm: hugetlb: fix missing cache flush in hugetlb_mcopy_atomic_pte()
mm: shmem: fix missing cache flush in shmem_mfill_atomic_pte()
mm: userfaultfd: fix missing cache flush in mcopy_atomic_pte() and __mcopy_atomic()
mm: replace multiple dcache flush with flush_dcache_folio()
Peter Xu <peterx@redhat.com>:
Patch series "mm: Rework zap ptes on swap entries", v5:
mm: don't skip swap entry even if zap_details specified
mm: rename zap_skip_check_mapping() to should_zap_page()
mm: change zap_details.zap_mapping into even_cows
mm: rework swap handling of zap_pte_range
Randy Dunlap <rdunlap@infradead.org>:
mm/mmap: return 1 from stack_guard_gap __setup() handler
Miaohe Lin <linmiaohe@huawei.com>:
mm/memory.c: use helper function range_in_vma()
mm/memory.c: use helper macro min and max in unmap_mapping_range_tree()
Hugh Dickins <hughd@google.com>:
mm: _install_special_mapping() apply VM_LOCKED_CLEAR_MASK
Miaohe Lin <linmiaohe@huawei.com>:
mm/mmap: remove obsolete comment in ksys_mmap_pgoff
Subsystem: mm/mremap
Miaohe Lin <linmiaohe@huawei.com>:
mm/mremap:: use vma_lookup() instead of find_vma()
Subsystem: mm/sparsemem
Miaohe Lin <linmiaohe@huawei.com>:
mm/sparse: make mminit_validate_memmodel_limits() static
Subsystem: mm/vmalloc
Miaohe Lin <linmiaohe@huawei.com>:
mm/vmalloc: remove unneeded function forward declaration
"Uladzislau Rezki (Sony)" <urezki@gmail.com>:
mm/vmalloc: Move draining areas out of caller context
Uladzislau Rezki <uladzislau.rezki@sony.com>:
mm/vmalloc: add adjust_search_size parameter
"Uladzislau Rezki (Sony)" <urezki@gmail.com>:
mm/vmalloc: eliminate an extra orig_gfp_mask
Jiapeng Chong <jiapeng.chong@linux.alibaba.com>:
mm/vmalloc.c: fix "unused function" warning
Bang Li <libang.linuxer@gmail.com>:
mm/vmalloc: fix comments about vmap_area struct
Subsystem: mm/pagealloc
Zi Yan <ziy@nvidia.com>:
mm: page_alloc: avoid merging non-fallbackable pageblocks with others
Peter Collingbourne <pcc@google.com>:
mm/mmzone.c: use try_cmpxchg() in page_cpupid_xchg_last()
Miaohe Lin <linmiaohe@huawei.com>:
mm/mmzone.h: remove unused macros
Nicolas Saenz Julienne <nsaenzju@redhat.com>:
mm/page_alloc: don't pass pfn to free_unref_page_commit()
David Hildenbrand <david@redhat.com>:
Patch series "mm: enforce pageblock_order < MAX_ORDER":
cma: factor out minimum alignment requirement
mm: enforce pageblock_order < MAX_ORDER
Nathan Chancellor <nathan@kernel.org>:
mm/page_alloc: mark pagesets as __maybe_unused
Alistair Popple <apopple@nvidia.com>:
mm/pages_alloc.c: don't create ZONE_MOVABLE beyond the end of a node
Mel Gorman <mgorman@techsingularity.net>:
Patch series "Follow-up on high-order PCP caching", v2:
mm/page_alloc: fetch the correct pcp buddy during bulk free
mm/page_alloc: track range of active PCP lists during bulk free
mm/page_alloc: simplify how many pages are selected per pcp list during bulk free
mm/page_alloc: drain the requested list first during bulk free
mm/page_alloc: free pages in a single pass during bulk free
mm/page_alloc: limit number of high-order pages on PCP during bulk free
mm/page_alloc: do not prefetch buddies during bulk free
Oscar Salvador <osalvador@suse.de>:
arch/x86/mm/numa: Do not initialize nodes twice
Suren Baghdasaryan <surenb@google.com>:
mm: count time in drain_all_pages during direct reclaim as memory pressure
Eric Dumazet <edumazet@google.com>:
mm/page_alloc: call check_new_pages() while zone spinlock is not held
Mel Gorman <mgorman@techsingularity.net>:
mm/page_alloc: check high-order pages for corruption during PCP operations
Subsystem: mm/memory-failure
Naoya Horiguchi <naoya.horiguchi@nec.com>:
mm/memory-failure.c: remove obsolete comment
mm/hwpoison: fix error page recovered but reported "not recovered"
Rik van Riel <riel@surriel.com>:
mm: invalidate hwpoison page cache page in fault path
Miaohe Lin <linmiaohe@huawei.com>:
Patch series "A few cleanup and fixup patches for memory failure", v3:
mm/memory-failure.c: minor clean up for memory_failure_dev_pagemap
mm/memory-failure.c: catch unexpected -EFAULT from vma_address()
mm/memory-failure.c: rework the signaling logic in kill_proc
mm/memory-failure.c: fix race with changing page more robustly
mm/memory-failure.c: remove PageSlab check in hwpoison_filter_dev
mm/memory-failure.c: rework the try_to_unmap logic in hwpoison_user_mappings()
mm/memory-failure.c: remove obsolete comment in __soft_offline_page
mm/memory-failure.c: remove unnecessary PageTransTail check
mm/hwpoison-inject: support injecting hwpoison to free page
luofei <luofei@unicloud.com>:
mm/hwpoison: avoid the impact of hwpoison_filter() return value on mce handler
mm/hwpoison: add in-use hugepage hwpoison filter judgement
Miaohe Lin <linmiaohe@huawei.com>:
Patch series "A few fixup patches for memory failure", v2:
mm/memory-failure.c: fix race with changing page compound again
mm/memory-failure.c: avoid calling invalidate_inode_page() with unexpected pages
mm/memory-failure.c: make non-LRU movable pages unhandlable
Vlastimil Babka <vbabka@suse.cz>:
mm, fault-injection: declare should_fail_alloc_page()
Subsystem: mm/mlock
Miaohe Lin <linmiaohe@huawei.com>:
mm/mlock: fix potential imbalanced rlimit ucounts adjustment
Subsystem: mm/hugetlb
Muchun Song <songmuchun@bytedance.com>:
Patch series "Free the 2nd vmemmap page associated with each HugeTLB page", v7:
mm: hugetlb: free the 2nd vmemmap page associated with each HugeTLB page
mm: hugetlb: replace hugetlb_free_vmemmap_enabled with a static_key
mm: sparsemem: use page table lock to protect kernel pmd operations
selftests: vm: add a hugetlb test case
mm: sparsemem: move vmemmap related to HugeTLB to CONFIG_HUGETLB_PAGE_FREE_VMEMMAP
Anshuman Khandual <anshuman.khandual@arm.com>:
mm/hugetlb: generalize ARCH_WANT_GENERAL_HUGETLB
Mike Kravetz <mike.kravetz@oracle.com>:
hugetlb: clean up potential spectre issue warnings
Miaohe Lin <linmiaohe@huawei.com>:
mm/hugetlb: use helper macro __ATTR_RW
David Howells <dhowells@redhat.com>:
mm/hugetlb.c: export PageHeadHuge()
Miaohe Lin <linmiaohe@huawei.com>:
mm: remove unneeded local variable follflags
Subsystem: mm/userfaultfd
Nadav Amit <namit@vmware.com>:
userfaultfd: provide unmasked address on page-fault
Guo Zhengkui <guozhengkui@vivo.com>:
userfaultfd/selftests: fix uninitialized_var.cocci warning
Subsystem: mm/vmscan
Hugh Dickins <hughd@google.com>:
mm/fs: delete PF_SWAPWRITE
mm: __isolate_lru_page_prepare() in isolate_migratepages_block()
Waiman Long <longman@redhat.com>:
mm/list_lru: optimize memcg_reparent_list_lru_node()
Marcelo Tosatti <mtosatti@redhat.com>:
mm: lru_cache_disable: replace work queue synchronization with synchronize_rcu
Sebastian Andrzej Siewior <bigeasy@linutronix.de>:
mm: workingset: replace IRQ-off check with a lockdep assert.
Charan Teja Kalla <quic_charante@quicinc.com>:
mm: vmscan: fix documentation for page_check_references()
Subsystem: mm/compaction
Baolin Wang <baolin.wang@linux.alibaba.com>:
mm: compaction: cleanup the compaction trace events
Subsystem: mm/mempolicy
Hugh Dickins <hughd@google.com>:
mempolicy: mbind_range() set_policy() after vma_merge()
Subsystem: mm/oom-kill
Miaohe Lin <linmiaohe@huawei.com>:
mm/oom_kill: remove unneeded is_memcg_oom check
Subsystem: mm/migration
Huang Ying <ying.huang@intel.com>:
mm,migrate: fix establishing demotion target
"andrew.yang" <andrew.yang@mediatek.com>:
mm/migrate: fix race between lock page and clear PG_Isolated
Subsystem: mm/thp
Hugh Dickins <hughd@google.com>:
mm/thp: refix __split_huge_pmd_locked() for migration PMD
Subsystem: mm/cma
Hari Bathini <hbathini@linux.ibm.com>:
Patch series "powerpc/fadump: handle CMA activation failure appropriately", v3:
mm/cma: provide option to opt out from exposing pages on activation failure
powerpc/fadump: opt out from freeing pages on cma activation failure
Subsystem: mm/autonuma
Huang Ying <ying.huang@intel.com>:
Patch series "NUMA balancing: optimize memory placement for memory tiering system", v13:
NUMA Balancing: add page promotion counter
NUMA balancing: optimize page placement for memory tiering system
memory tiering: skip to scan fast memory
Subsystem: mm/psi
Johannes Weiner <hannes@cmpxchg.org>:
mm: page_io: fix psi memory pressure error on cold swapins
Subsystem: mm/ksm
Yang Yang <yang.yang29@zte.com.cn>:
mm/vmstat: add event for ksm swapping in copy
Miaohe Lin <linmiaohe@huawei.com>:
mm/ksm: use helper macro __ATTR_RW
Subsystem: mm/page-poison
"Matthew Wilcox (Oracle)" <willy@infradead.org>:
mm/hwpoison: check the subpage, not the head page
Subsystem: mm/madvise
Miaohe Lin <linmiaohe@huawei.com>:
mm/madvise: use vma_lookup() instead of find_vma()
Charan Teja Kalla <quic_charante@quicinc.com>:
Patch series "mm: madvise: return correct bytes processed with:
mm: madvise: return correct bytes advised with process_madvise
mm: madvise: skip unmapped vma holes passed to process_madvise
Subsystem: mm/memory-hotplug
Michal Hocko <mhocko@suse.com>:
Patch series "mm, memory_hotplug: handle unitialized numa node gracefully":
mm, memory_hotplug: make arch_alloc_nodedata independent on CONFIG_MEMORY_HOTPLUG
mm: handle uninitialized numa nodes gracefully
mm, memory_hotplug: drop arch_free_nodedata
mm, memory_hotplug: reorganize new pgdat initialization
mm: make free_area_init_node aware of memory less nodes
Wei Yang <richard.weiyang@gmail.com>:
memcg: do not tweak node in alloc_mem_cgroup_per_node_info
David Hildenbrand <david@redhat.com>:
drivers/base/memory: add memory block to memory group after registration succeeded
drivers/base/node: consolidate node device subsystem initialization in node_dev_init()
Miaohe Lin <linmiaohe@huawei.com>:
Patch series "A few cleanup patches around memory_hotplug":
mm/memory_hotplug: remove obsolete comment of __add_pages
mm/memory_hotplug: avoid calling zone_intersects() for ZONE_NORMAL
mm/memory_hotplug: clean up try_offline_node
mm/memory_hotplug: fix misplaced comment in offline_pages
David Hildenbrand <david@redhat.com>:
Patch series "drivers/base/memory: determine and store zone for single-zone memory blocks", v2:
drivers/base/node: rename link_mem_sections() to register_memory_block_under_node()
drivers/base/memory: determine and store zone for single-zone memory blocks
drivers/base/memory: clarify adding and removing of memory blocks
Oscar Salvador <osalvador@suse.de>:
mm: only re-generate demotion targets when a numa node changes its N_CPU state
Subsystem: mm/rmap
Hugh Dickins <hughd@google.com>:
mm/thp: ClearPageDoubleMap in first page_add_file_rmap()
Subsystem: mm/zswap
"Maciej S. Szmigiero" <maciej.szmigiero@oracle.com>:
mm/zswap.c: allow handling just same-value filled pages
Subsystem: mm/uaccess
Christophe Leroy <christophe.leroy@csgroup.eu>:
mm: remove usercopy_warn()
mm: uninline copy_overflow()
Randy Dunlap <rdunlap@infradead.org>:
mm/usercopy: return 1 from hardened_usercopy __setup() handler
Subsystem: mm/ioremap
Vlastimil Babka <vbabka@suse.cz>:
mm/early_ioremap: declare early_memremap_pgprot_adjust()
Subsystem: mm/highmem
Ira Weiny <ira.weiny@intel.com>:
highmem: document kunmap_local()
Miaohe Lin <linmiaohe@huawei.com>:
mm/highmem: remove unnecessary done label
Subsystem: mm/cleanups
"Dr. David Alan Gilbert" <linux@treblig.org>:
mm/page_table_check.c: use strtobool for param parsing
Subsystem: mm/kfence
tangmeng <tangmeng@uniontech.com>:
mm/kfence: remove unnecessary CONFIG_KFENCE option
Tianchen Ding <dtcccc@linux.alibaba.com>:
Patch series "provide the flexibility to enable KFENCE", v3:
kfence: allow re-enabling KFENCE after system startup
kfence: alloc kfence_pool after system startup
Peng Liu <liupeng256@huawei.com>:
Patch series "kunit: fix a UAF bug and do some optimization", v2:
kunit: fix UAF when run kfence test case test_gfpzero
kunit: make kunit_test_timeout compatible with comment
kfence: test: try to avoid test_gfpzero trigger rcu_stall
Marco Elver <elver@google.com>:
kfence: allow use of a deferrable timer
Subsystem: mm/hmm
Miaohe Lin <linmiaohe@huawei.com>:
mm/hmm.c: remove unneeded local variable ret
Subsystem: mm/damon
SeongJae Park <sj@kernel.org>:
Patch series "Remove the type-unclear target id concept":
mm/damon/dbgfs/init_regions: use target index instead of target id
Docs/admin-guide/mm/damon/usage: update for changed initail_regions file input
mm/damon/core: move damon_set_targets() into dbgfs
mm/damon: remove the target id concept
Baolin Wang <baolin.wang@linux.alibaba.com>:
mm/damon: remove redundant page validation
SeongJae Park <sj@kernel.org>:
Patch series "Allow DAMON user code independent of monitoring primitives":
mm/damon: rename damon_primitives to damon_operations
mm/damon: let monitoring operations can be registered and selected
mm/damon/paddr,vaddr: register themselves to DAMON in subsys_initcall
mm/damon/reclaim: use damon_select_ops() instead of damon_{v,p}a_set_operations()
mm/damon/dbgfs: use damon_select_ops() instead of damon_{v,p}a_set_operations()
mm/damon/dbgfs: use operations id for knowing if the target has pid
mm/damon/dbgfs-test: fix is_target_id() change
mm/damon/paddr,vaddr: remove damon_{p,v}a_{target_valid,set_operations}()
tangmeng <tangmeng@uniontech.com>:
mm/damon: remove unnecessary CONFIG_DAMON option
SeongJae Park <sj@kernel.org>:
Patch series "Docs/damon: Update documents for better consistency":
Docs/vm/damon: call low level monitoring primitives the operations
Docs/vm/damon/design: update DAMON-Idle Page Tracking interference handling
Docs/damon: update outdated term 'regions update interval'
Patch series "Introduce DAMON sysfs interface", v3:
mm/damon/core: allow non-exclusive DAMON start/stop
mm/damon/core: add number of each enum type values
mm/damon: implement a minimal stub for sysfs-based DAMON interface
mm/damon/sysfs: link DAMON for virtual address spaces monitoring
mm/damon/sysfs: support the physical address space monitoring
mm/damon/sysfs: support DAMON-based Operation Schemes
mm/damon/sysfs: support DAMOS quotas
mm/damon/sysfs: support schemes prioritization
mm/damon/sysfs: support DAMOS watermarks
mm/damon/sysfs: support DAMOS stats
selftests/damon: add a test for DAMON sysfs interface
Docs/admin-guide/mm/damon/usage: document DAMON sysfs interface
Docs/ABI/testing: add DAMON sysfs interface ABI document
Xin Hao <xhao@linux.alibaba.com>:
mm/damon/sysfs: remove repeat container_of() in damon_sysfs_kdamond_release()
Documentation/ABI/testing/sysfs-kernel-mm-damon | 274 ++
Documentation/admin-guide/cgroup-v1/memory.rst | 2
Documentation/admin-guide/cgroup-v2.rst | 5
Documentation/admin-guide/kernel-parameters.txt | 2
Documentation/admin-guide/mm/damon/usage.rst | 380 +++
Documentation/admin-guide/mm/zswap.rst | 22
Documentation/admin-guide/sysctl/kernel.rst | 31
Documentation/core-api/mm-api.rst | 19
Documentation/dev-tools/kfence.rst | 12
Documentation/filesystems/porting.rst | 6
Documentation/filesystems/vfs.rst | 16
Documentation/vm/damon/design.rst | 43
Documentation/vm/damon/faq.rst | 2
MAINTAINERS | 1
arch/arm/Kconfig | 4
arch/arm64/kernel/setup.c | 3
arch/arm64/mm/hugetlbpage.c | 1
arch/hexagon/mm/init.c | 2
arch/ia64/kernel/topology.c | 10
arch/ia64/mm/discontig.c | 11
arch/mips/kernel/topology.c | 5
arch/nds32/mm/init.c | 1
arch/openrisc/mm/init.c | 2
arch/powerpc/include/asm/fadump-internal.h | 5
arch/powerpc/include/asm/nohash/32/hugetlb-8xx.h | 4
arch/powerpc/kernel/fadump.c | 8
arch/powerpc/kernel/sysfs.c | 17
arch/riscv/Kconfig | 4
arch/riscv/kernel/setup.c | 3
arch/s390/kernel/numa.c | 7
arch/sh/kernel/topology.c | 5
arch/sparc/kernel/sysfs.c | 12
arch/sparc/mm/hugetlbpage.c | 1
arch/x86/Kconfig | 4
arch/x86/kernel/cpu/mce/core.c | 8
arch/x86/kernel/topology.c | 5
arch/x86/mm/numa.c | 33
block/bdev.c | 2
block/bfq-iosched.c | 2
drivers/base/init.c | 1
drivers/base/memory.c | 149 +
drivers/base/node.c | 48
drivers/block/drbd/drbd_int.h | 3
drivers/block/drbd/drbd_req.c | 3
drivers/dax/super.c | 2
drivers/of/of_reserved_mem.c | 9
drivers/tty/tty_io.c | 2
drivers/virtio/virtio_mem.c | 9
fs/9p/vfs_inode.c | 2
fs/adfs/super.c | 2
fs/affs/super.c | 2
fs/afs/super.c | 2
fs/befs/linuxvfs.c | 2
fs/bfs/inode.c | 2
fs/btrfs/inode.c | 2
fs/buffer.c | 8
fs/ceph/addr.c | 22
fs/ceph/inode.c | 2
fs/ceph/super.c | 1
fs/ceph/super.h | 1
fs/cifs/cifsfs.c | 2
fs/coda/inode.c | 2
fs/dcache.c | 3
fs/ecryptfs/super.c | 2
fs/efs/super.c | 2
fs/erofs/super.c | 2
fs/exfat/super.c | 2
fs/ext2/ialloc.c | 5
fs/ext2/super.c | 2
fs/ext4/super.c | 2
fs/f2fs/compress.c | 4
fs/f2fs/data.c | 3
fs/f2fs/f2fs.h | 6
fs/f2fs/segment.c | 8
fs/f2fs/super.c | 14
fs/fat/inode.c | 2
fs/freevxfs/vxfs_super.c | 2
fs/fs-writeback.c | 40
fs/fuse/control.c | 17
fs/fuse/dev.c | 8
fs/fuse/file.c | 17
fs/fuse/inode.c | 2
fs/gfs2/super.c | 2
fs/hfs/super.c | 2
fs/hfsplus/super.c | 2
fs/hostfs/hostfs_kern.c | 2
fs/hpfs/super.c | 2
fs/hugetlbfs/inode.c | 2
fs/inode.c | 2
fs/isofs/inode.c | 2
fs/jffs2/super.c | 2
fs/jfs/super.c | 2
fs/minix/inode.c | 2
fs/namespace.c | 2
fs/nfs/inode.c | 2
fs/nfs/write.c | 14
fs/nilfs2/segbuf.c | 16
fs/nilfs2/super.c | 2
fs/ntfs/inode.c | 6
fs/ntfs3/super.c | 2
fs/ocfs2/alloc.c | 2
fs/ocfs2/aops.c | 2
fs/ocfs2/cluster/nodemanager.c | 2
fs/ocfs2/dir.c | 4
fs/ocfs2/dlmfs/dlmfs.c | 2
fs/ocfs2/file.c | 13
fs/ocfs2/inode.c | 2
fs/ocfs2/localalloc.c | 6
fs/ocfs2/namei.c | 2
fs/ocfs2/ocfs2.h | 4
fs/ocfs2/quota_global.c | 2
fs/ocfs2/stack_user.c | 18
fs/ocfs2/super.c | 2
fs/ocfs2/xattr.c | 2
fs/openpromfs/inode.c | 2
fs/orangefs/super.c | 2
fs/overlayfs/super.c | 2
fs/proc/inode.c | 2
fs/qnx4/inode.c | 2
fs/qnx6/inode.c | 2
fs/reiserfs/super.c | 2
fs/romfs/super.c | 2
fs/squashfs/super.c | 2
fs/sysv/inode.c | 2
fs/ubifs/super.c | 2
fs/udf/super.c | 2
fs/ufs/super.c | 2
fs/userfaultfd.c | 5
fs/vboxsf/super.c | 2
fs/xfs/libxfs/xfs_btree.c | 2
fs/xfs/xfs_buf.c | 3
fs/xfs/xfs_icache.c | 2
fs/zonefs/super.c | 2
include/linux/backing-dev-defs.h | 8
include/linux/backing-dev.h | 50
include/linux/cma.h | 14
include/linux/damon.h | 95
include/linux/fault-inject.h | 2
include/linux/fs.h | 21
include/linux/gfp.h | 10
include/linux/highmem-internal.h | 10
include/linux/hugetlb.h | 8
include/linux/kthread.h | 22
include/linux/list_lru.h | 45
include/linux/memcontrol.h | 46
include/linux/memory.h | 12
include/linux/memory_hotplug.h | 132 -
include/linux/migrate.h | 8
include/linux/mm.h | 11
include/linux/mmzone.h | 22
include/linux/nfs_fs_sb.h | 1
include/linux/node.h | 25
include/linux/page-flags.h | 96
include/linux/pageblock-flags.h | 7
include/linux/pagemap.h | 7
include/linux/sched.h | 1
include/linux/sched/sysctl.h | 10
include/linux/shmem_fs.h | 1
include/linux/slab.h | 3
include/linux/swap.h | 6
include/linux/thread_info.h | 5
include/linux/uaccess.h | 2
include/linux/vm_event_item.h | 3
include/linux/vmalloc.h | 4
include/linux/xarray.h | 9
include/ras/ras_event.h | 1
include/trace/events/compaction.h | 26
include/trace/events/writeback.h | 28
include/uapi/linux/userfaultfd.h | 8
ipc/mqueue.c | 2
kernel/dma/contiguous.c | 4
kernel/sched/core.c | 21
kernel/sysctl.c | 2
lib/Kconfig.kfence | 12
lib/kunit/try-catch.c | 3
lib/xarray.c | 10
mm/Kconfig | 6
mm/backing-dev.c | 57
mm/cma.c | 31
mm/cma.h | 1
mm/compaction.c | 60
mm/damon/Kconfig | 19
mm/damon/Makefile | 7
mm/damon/core-test.h | 23
mm/damon/core.c | 190 +
mm/damon/dbgfs-test.h | 103
mm/damon/dbgfs.c | 264 +-
mm/damon/ops-common.c | 133 +
mm/damon/ops-common.h | 16
mm/damon/paddr.c | 62
mm/damon/prmtv-common.c | 133 -
mm/damon/prmtv-common.h | 16
mm/damon/reclaim.c | 11
mm/damon/sysfs.c | 2632 ++++++++++++++++++++++-
mm/damon/vaddr-test.h | 8
mm/damon/vaddr.c | 67
mm/early_ioremap.c | 1
mm/fadvise.c | 5
mm/filemap.c | 17
mm/gup.c | 103
mm/highmem.c | 9
mm/hmm.c | 3
mm/huge_memory.c | 41
mm/hugetlb.c | 23
mm/hugetlb_vmemmap.c | 74
mm/hwpoison-inject.c | 7
mm/internal.h | 19
mm/kfence/Makefile | 2
mm/kfence/core.c | 147 +
mm/kfence/kfence_test.c | 3
mm/ksm.c | 6
mm/list_lru.c | 690 ++----
mm/maccess.c | 6
mm/madvise.c | 18
mm/memcontrol.c | 549 ++--
mm/memory-failure.c | 148 -
mm/memory.c | 116 -
mm/memory_hotplug.c | 136 -
mm/mempolicy.c | 29
mm/memremap.c | 3
mm/migrate.c | 128 -
mm/mlock.c | 1
mm/mmap.c | 5
mm/mmzone.c | 7
mm/mprotect.c | 13
mm/mremap.c | 4
mm/oom_kill.c | 3
mm/page-writeback.c | 12
mm/page_alloc.c | 429 +--
mm/page_io.c | 7
mm/page_table_check.c | 10
mm/ptdump.c | 16
mm/readahead.c | 124 +
mm/rmap.c | 15
mm/shmem.c | 46
mm/slab.c | 39
mm/slab.h | 25
mm/slob.c | 6
mm/slub.c | 42
mm/sparse-vmemmap.c | 70
mm/sparse.c | 2
mm/swap.c | 25
mm/swapfile.c | 1
mm/usercopy.c | 16
mm/userfaultfd.c | 3
mm/vmalloc.c | 102
mm/vmscan.c | 138 -
mm/vmstat.c | 19
mm/workingset.c | 7
mm/zswap.c | 15
net/socket.c | 2
net/sunrpc/rpc_pipe.c | 2
scripts/spelling.txt | 16
tools/testing/selftests/cgroup/cgroup_util.c | 15
tools/testing/selftests/cgroup/cgroup_util.h | 1
tools/testing/selftests/cgroup/test_memcontrol.c | 78
tools/testing/selftests/damon/Makefile | 1
tools/testing/selftests/damon/sysfs.sh | 306 ++
tools/testing/selftests/vm/.gitignore | 1
tools/testing/selftests/vm/Makefile | 7
tools/testing/selftests/vm/hugepage-vmemmap.c | 144 +
tools/testing/selftests/vm/run_vmtests.sh | 11
tools/testing/selftests/vm/userfaultfd.c | 2
tools/testing/selftests/x86/Makefile | 6
264 files changed, 7205 insertions(+), 3090 deletions(-)
^ permalink raw reply [flat|nested] 232+ messages in thread
* incoming
@ 2022-03-23 23:04 Andrew Morton
0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2022-03-23 23:04 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm, patches
Various misc subsystems, before getting into the post-linux-next material.
This is all based on v5.17. I tested applying and compiling against
today's 1bc191051dca28fa6. One patch required an extra whack, all
looks good.
41 patches, based on f443e374ae131c168a065ea1748feac6b2e76613.
Subsystems affected by this patch series:
procfs
misc
core-kernel
lib
checkpatch
init
pipe
minix
fat
cgroups
kexec
kdump
taskstats
panic
kcov
resource
ubsan
Subsystem: procfs
Hao Lee <haolee.swjtu@gmail.com>:
proc: alloc PATH_MAX bytes for /proc/${pid}/fd/ symlinks
David Hildenbrand <david@redhat.com>:
proc/vmcore: fix possible deadlock on concurrent mmap and read
Yang Li <yang.lee@linux.alibaba.com>:
proc/vmcore: fix vmcore_alloc_buf() kernel-doc comment
Subsystem: misc
Bjorn Helgaas <bhelgaas@google.com>:
linux/types.h: remove unnecessary __bitwise__
Documentation/sparse: add hints about __CHECKER__
Subsystem: core-kernel
Miaohe Lin <linmiaohe@huawei.com>:
kernel/ksysfs.c: use helper macro __ATTR_RW
Subsystem: lib
Kees Cook <keescook@chromium.org>:
Kconfig.debug: make DEBUG_INFO selectable from a choice
Rasmus Villemoes <linux@rasmusvillemoes.dk>:
include: drop pointless __compiler_offsetof indirection
Christophe Leroy <christophe.leroy@csgroup.eu>:
ilog2: force inlining of __ilog2_u32() and __ilog2_u64()
Andy Shevchenko <andriy.shevchenko@linux.intel.com>:
bitfield: add explicit inclusions to the example
Feng Tang <feng.tang@intel.com>:
lib/Kconfig.debug: add ARCH dependency for FUNCTION_ALIGN option
Randy Dunlap <rdunlap@infradead.org>:
lib: bitmap: fix many kernel-doc warnings
Subsystem: checkpatch
Joe Perches <joe@perches.com>:
checkpatch: prefer MODULE_LICENSE("GPL") over MODULE_LICENSE("GPL v2")
checkpatch: add --fix option for some TRAILING_STATEMENTS
checkpatch: add early_param exception to blank line after struct/function test
Sagar Patel <sagarmp@cs.unc.edu>:
checkpatch: use python3 to find codespell dictionary
Subsystem: init
Mark-PK Tsai <mark-pk.tsai@mediatek.com>:
init: use ktime_us_delta() to make initcall_debug log more precise
Randy Dunlap <rdunlap@infradead.org>:
init.h: improve __setup and early_param documentation
init/main.c: return 1 from handled __setup() functions
Subsystem: pipe
Andrei Vagin <avagin@gmail.com>:
fs/pipe: use kvcalloc to allocate a pipe_buffer array
fs/pipe.c: local vars have to match types of proper pipe_inode_info fields
Subsystem: minix
Qinghua Jin <qhjin.dev@gmail.com>:
minix: fix bug when opening a file with O_DIRECT
Subsystem: fat
Helge Deller <deller@gmx.de>:
fat: use pointer to simple type in put_user()
Subsystem: cgroups
Sebastian Andrzej Siewior <bigeasy@linutronix.de>:
cgroup: use irqsave in cgroup_rstat_flush_locked().
cgroup: add a comment to cgroup_rstat_flush_locked().
Subsystem: kexec
Jisheng Zhang <jszhang@kernel.org>:
Patch series "kexec: use IS_ENABLED(CONFIG_KEXEC_CORE) instead of #ifdef", v2:
kexec: make crashk_res, crashk_low_res and crash_notes symbols always visible
riscv: mm: init: use IS_ENABLED(CONFIG_KEXEC_CORE) instead of #ifdef
x86/setup: use IS_ENABLED(CONFIG_KEXEC_CORE) instead of #ifdef
arm64: mm: use IS_ENABLED(CONFIG_KEXEC_CORE) instead of #ifdef
Subsystem: kdump
Tiezhu Yang <yangtiezhu@loongson.cn>:
Patch series "Update doc and fix some issues about kdump", v2:
docs: kdump: update description about sysfs file system support
docs: kdump: add scp example to write out the dump file
panic: unset panic_on_warn inside panic()
ubsan: no need to unset panic_on_warn in ubsan_epilogue()
kasan: no need to unset panic_on_warn in end_report()
Subsystem: taskstats
Lukas Bulwahn <lukas.bulwahn@gmail.com>:
taskstats: remove unneeded dead assignment
Subsystem: panic
"Guilherme G. Piccoli" <gpiccoli@igalia.com>:
Patch series "Some improvements on panic_print":
docs: sysctl/kernel: add missing bit to panic_print
panic: add option to dump all CPUs backtraces in panic_print
panic: move panic_print before kmsg dumpers
Subsystem: kcov
Aleksandr Nogikh <nogikh@google.com>:
Patch series "kcov: improve mmap processing", v3:
kcov: split ioctl handling into locked and unlocked parts
kcov: properly handle subsequent mmap calls
Subsystem: resource
Miaohe Lin <linmiaohe@huawei.com>:
kernel/resource: fix kfree() of bootmem memory again
Subsystem: ubsan
Marco Elver <elver@google.com>:
Revert "ubsan, kcsan: Don't combine sanitizer with kcov on clang"
Documentation/admin-guide/kdump/kdump.rst | 10 +
Documentation/admin-guide/kernel-parameters.txt | 5
Documentation/admin-guide/sysctl/kernel.rst | 2
Documentation/dev-tools/sparse.rst | 2
arch/arm64/mm/init.c | 9 -
arch/riscv/mm/init.c | 6 -
arch/x86/kernel/setup.c | 10 -
fs/fat/dir.c | 2
fs/minix/inode.c | 3
fs/pipe.c | 13 +-
fs/proc/base.c | 8 -
fs/proc/vmcore.c | 43 +++----
include/linux/bitfield.h | 3
include/linux/compiler_types.h | 3
include/linux/init.h | 11 +
include/linux/kexec.h | 12 +-
include/linux/log2.h | 4
include/linux/stddef.h | 6 -
include/uapi/linux/types.h | 6 -
init/main.c | 14 +-
kernel/cgroup/rstat.c | 13 +-
kernel/kcov.c | 102 ++++++++---------
kernel/ksysfs.c | 3
kernel/panic.c | 37 ++++--
kernel/resource.c | 41 +-----
kernel/taskstats.c | 5
lib/Kconfig.debug | 142 ++++++++++++------------
lib/Kconfig.kcsan | 11 -
lib/Kconfig.ubsan | 12 --
lib/bitmap.c | 24 ++--
lib/ubsan.c | 10 -
mm/kasan/report.c | 10 -
scripts/checkpatch.pl | 31 ++++-
tools/include/linux/types.h | 5
34 files changed, 313 insertions(+), 305 deletions(-)
^ permalink raw reply [flat|nested] 232+ messages in thread
* incoming
@ 2022-03-25 1:07 Andrew Morton
0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2022-03-25 1:07 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm, patches
This is the material which was staged after willystuff in linux-next.
Everything applied seamlessly on your latest, all looks well.
114 patches, based on 52deda9551a01879b3562e7b41748e85c591f14c.
Subsystems affected by this patch series:
mm/debug
mm/selftests
mm/pagecache
mm/thp
mm/rmap
mm/migration
mm/kasan
mm/hugetlb
mm/pagemap
mm/madvise
selftests
Subsystem: mm/debug
Sean Anderson <seanga2@gmail.com>:
tools/vm/page_owner_sort.c: sort by stacktrace before culling
tools/vm/page_owner_sort.c: support sorting by stack trace
Yinan Zhang <zhangyinan2019@email.szu.edu.cn>:
tools/vm/page_owner_sort.c: add switch between culling by stacktrace and txt
Chongxi Zhao <zhaochongxi2019@email.szu.edu.cn>:
tools/vm/page_owner_sort.c: support sorting pid and time
Shenghong Han <hanshenghong2019@email.szu.edu.cn>:
tools/vm/page_owner_sort.c: two trivial fixes
Yixuan Cao <caoyixuan2019@email.szu.edu.cn>:
tools/vm/page_owner_sort.c: delete invalid duplicate code
Shenghong Han <hanshenghong2019@email.szu.edu.cn>:
Documentation/vm/page_owner.rst: update the documentation
Shuah Khan <skhan@linuxfoundation.org>:
Documentation/vm/page_owner.rst: fix unexpected indentation warns
Waiman Long <longman@redhat.com>:
Patch series "mm/page_owner: Extend page_owner to show memcg information", v4:
lib/vsprintf: avoid redundant work with 0 size
mm/page_owner: use scnprintf() to avoid excessive buffer overrun check
mm/page_owner: print memcg information
mm/page_owner: record task command name
Yixuan Cao <caoyixuan2019@email.szu.edu.cn>:
mm/page_owner.c: record tgid
tools/vm/page_owner_sort.c: fix the instructions for use
Jiajian Ye <yejiajian2018@email.szu.edu.cn>:
tools/vm/page_owner_sort.c: fix comments
tools/vm/page_owner_sort.c: add a security check
tools/vm/page_owner_sort.c: support sorting by tgid and update documentation
tools/vm/page_owner_sort: fix three trivival places
tools/vm/page_owner_sort: support for sorting by task command name
tools/vm/page_owner_sort.c: support for selecting by PID, TGID or task command name
tools/vm/page_owner_sort.c: support for user-defined culling rules
Christoph Hellwig <hch@lst.de>:
mm: unexport page_init_poison
Subsystem: mm/selftests
"Aneesh Kumar K.V" <aneesh.kumar@linux.ibm.com>:
selftest/vm: add util.h and and move helper functions there
Mike Rapoport <rppt@kernel.org>:
selftest/vm: add helpers to detect PAGE_SIZE and PAGE_SHIFT
Subsystem: mm/pagecache
Hugh Dickins <hughd@google.com>:
mm: delete __ClearPageWaiters()
mm: filemap_unaccount_folio() large skip mapcount fixup
Subsystem: mm/thp
Hugh Dickins <hughd@google.com>:
mm/thp: fix NR_FILE_MAPPED accounting in page_*_file_rmap()
Subsystem: mm/rmap
Subsystem: mm/migration
Anshuman Khandual <anshuman.khandual@arm.com>:
Patch series "mm/migration: Add trace events", v3:
mm/migration: add trace events for THP migrations
mm/migration: add trace events for base page and HugeTLB migrations
Subsystem: mm/kasan
Andrey Konovalov <andreyknvl@google.com>:
Patch series "kasan, vmalloc, arm64: add vmalloc tagging support for SW/HW_TAGS", v6:
kasan, page_alloc: deduplicate should_skip_kasan_poison
kasan, page_alloc: move tag_clear_highpage out of kernel_init_free_pages
kasan, page_alloc: merge kasan_free_pages into free_pages_prepare
kasan, page_alloc: simplify kasan_poison_pages call site
kasan, page_alloc: init memory of skipped pages on free
kasan: drop skip_kasan_poison variable in free_pages_prepare
mm: clarify __GFP_ZEROTAGS comment
kasan: only apply __GFP_ZEROTAGS when memory is zeroed
kasan, page_alloc: refactor init checks in post_alloc_hook
kasan, page_alloc: merge kasan_alloc_pages into post_alloc_hook
kasan, page_alloc: combine tag_clear_highpage calls in post_alloc_hook
kasan, page_alloc: move SetPageSkipKASanPoison in post_alloc_hook
kasan, page_alloc: move kernel_init_free_pages in post_alloc_hook
kasan, page_alloc: rework kasan_unpoison_pages call site
kasan: clean up metadata byte definitions
kasan: define KASAN_VMALLOC_INVALID for SW_TAGS
kasan, x86, arm64, s390: rename functions for modules shadow
kasan, vmalloc: drop outdated VM_KASAN comment
kasan: reorder vmalloc hooks
kasan: add wrappers for vmalloc hooks
kasan, vmalloc: reset tags in vmalloc functions
kasan, fork: reset pointer tags of vmapped stacks
kasan, arm64: reset pointer tags of vmapped stacks
kasan, vmalloc: add vmalloc tagging for SW_TAGS
kasan, vmalloc, arm64: mark vmalloc mappings as pgprot_tagged
kasan, vmalloc: unpoison VM_ALLOC pages after mapping
kasan, mm: only define ___GFP_SKIP_KASAN_POISON with HW_TAGS
kasan, page_alloc: allow skipping unpoisoning for HW_TAGS
kasan, page_alloc: allow skipping memory init for HW_TAGS
kasan, vmalloc: add vmalloc tagging for HW_TAGS
kasan, vmalloc: only tag normal vmalloc allocations
kasan, arm64: don't tag executable vmalloc allocations
kasan: mark kasan_arg_stacktrace as __initdata
kasan: clean up feature flags for HW_TAGS mode
kasan: add kasan.vmalloc command line flag
kasan: allow enabling KASAN_VMALLOC and SW/HW_TAGS
arm64: select KASAN_VMALLOC for SW/HW_TAGS modes
kasan: documentation updates
kasan: improve vmalloc tests
kasan: test: support async (again) and asymm modes for HW_TAGS
tangmeng <tangmeng@uniontech.com>:
mm/kasan: remove unnecessary CONFIG_KASAN option
Peter Collingbourne <pcc@google.com>:
kasan: update function name in comments
Andrey Konovalov <andreyknvl@google.com>:
kasan: print virtual mapping info in reports
Patch series "kasan: report clean-ups and improvements":
kasan: drop addr check from describe_object_addr
kasan: more line breaks in reports
kasan: rearrange stack frame info in reports
kasan: improve stack frame info in reports
kasan: print basic stack frame info for SW_TAGS
kasan: simplify async check in end_report()
kasan: simplify kasan_update_kunit_status() and call sites
kasan: check CONFIG_KASAN_KUNIT_TEST instead of CONFIG_KUNIT
kasan: move update_kunit_status to start_report
kasan: move disable_trace_on_warning to start_report
kasan: split out print_report from __kasan_report
kasan: simplify kasan_find_first_bad_addr call sites
kasan: restructure kasan_report
kasan: merge __kasan_report into kasan_report
kasan: call print_report from kasan_report_invalid_free
kasan: move and simplify kasan_report_async
kasan: rename kasan_access_info to kasan_report_info
kasan: add comment about UACCESS regions to kasan_report
kasan: respect KASAN_BIT_REPORTED in all reporting routines
kasan: reorder reporting functions
kasan: move and hide kasan_save_enable/restore_multi_shot
kasan: disable LOCKDEP when printing reports
Subsystem: mm/hugetlb
Mike Kravetz <mike.kravetz@oracle.com>:
Patch series "Add hugetlb MADV_DONTNEED support", v3:
mm: enable MADV_DONTNEED for hugetlb mappings
selftests/vm: add hugetlb madvise MADV_DONTNEED MADV_REMOVE test
userfaultfd/selftests: enable hugetlb remap and remove event testing
Miaohe Lin <linmiaohe@huawei.com>:
mm/huge_memory: make is_transparent_hugepage() static
Subsystem: mm/pagemap
David Hildenbrand <david@redhat.com>:
Patch series "mm: COW fixes part 1: fix the COW security issue for THP and swap", v3:
mm: optimize do_wp_page() for exclusive pages in the swapcache
mm: optimize do_wp_page() for fresh pages in local LRU pagevecs
mm: slightly clarify KSM logic in do_swap_page()
mm: streamline COW logic in do_swap_page()
mm/huge_memory: streamline COW logic in do_huge_pmd_wp_page()
mm/khugepaged: remove reuse_swap_page() usage
mm/swapfile: remove stale reuse_swap_page()
mm/huge_memory: remove stale page_trans_huge_mapcount()
mm/huge_memory: remove stale locking logic from __split_huge_pmd()
Hugh Dickins <hughd@google.com>:
mm: warn on deleting redirtied only if accounted
mm: unmap_mapping_range_tree() with i_mmap_rwsem shared
Anshuman Khandual <anshuman.khandual@arm.com>:
mm: generalize ARCH_HAS_FILTER_PGPROT
Subsystem: mm/madvise
Mauricio Faria de Oliveira <mfo@canonical.com>:
mm: fix race between MADV_FREE reclaim and blkdev direct IO read
Johannes Weiner <hannes@cmpxchg.org>:
mm: madvise: MADV_DONTNEED_LOCKED
Subsystem: selftests
Muhammad Usama Anjum <usama.anjum@collabora.com>:
selftests: vm: remove dependecy from internal kernel macros
Kees Cook <keescook@chromium.org>:
selftests: kselftest framework: provide "finished" helper
Documentation/dev-tools/kasan.rst | 17
Documentation/vm/page_owner.rst | 72 ++
arch/alpha/include/uapi/asm/mman.h | 2
arch/arm64/Kconfig | 2
arch/arm64/include/asm/vmalloc.h | 6
arch/arm64/include/asm/vmap_stack.h | 5
arch/arm64/kernel/module.c | 5
arch/arm64/mm/pageattr.c | 2
arch/arm64/net/bpf_jit_comp.c | 3
arch/mips/include/uapi/asm/mman.h | 2
arch/parisc/include/uapi/asm/mman.h | 2
arch/powerpc/mm/book3s64/trace.c | 1
arch/s390/kernel/module.c | 2
arch/x86/Kconfig | 3
arch/x86/kernel/module.c | 2
arch/x86/mm/init.c | 1
arch/xtensa/include/uapi/asm/mman.h | 2
include/linux/gfp.h | 53 +-
include/linux/huge_mm.h | 6
include/linux/kasan.h | 136 +++--
include/linux/mm.h | 5
include/linux/page-flags.h | 2
include/linux/pagemap.h | 3
include/linux/swap.h | 4
include/linux/vmalloc.h | 18
include/trace/events/huge_memory.h | 1
include/trace/events/migrate.h | 31 +
include/trace/events/mmflags.h | 18
include/trace/events/thp.h | 27 +
include/uapi/asm-generic/mman-common.h | 2
kernel/fork.c | 13
kernel/scs.c | 16
lib/Kconfig.kasan | 18
lib/test_kasan.c | 239 ++++++++-
lib/vsprintf.c | 8
mm/Kconfig | 3
mm/debug.c | 1
mm/filemap.c | 63 +-
mm/huge_memory.c | 109 ----
mm/kasan/Makefile | 2
mm/kasan/common.c | 4
mm/kasan/hw_tags.c | 243 +++++++---
mm/kasan/kasan.h | 76 ++-
mm/kasan/report.c | 516 +++++++++++----------
mm/kasan/report_generic.c | 34 -
mm/kasan/report_hw_tags.c | 1
mm/kasan/report_sw_tags.c | 16
mm/kasan/report_tags.c | 2
mm/kasan/shadow.c | 76 +--
mm/khugepaged.c | 11
mm/madvise.c | 57 +-
mm/memory.c | 129 +++--
mm/memremap.c | 2
mm/migrate.c | 4
mm/page-writeback.c | 18
mm/page_alloc.c | 270 ++++++-----
mm/page_owner.c | 86 ++-
mm/rmap.c | 62 +-
mm/swap.c | 4
mm/swapfile.c | 104 ----
mm/vmalloc.c | 167 ++++--
tools/testing/selftests/kselftest.h | 10
tools/testing/selftests/vm/.gitignore | 1
tools/testing/selftests/vm/Makefile | 1
tools/testing/selftests/vm/gup_test.c | 3
tools/testing/selftests/vm/hugetlb-madvise.c | 410 ++++++++++++++++
tools/testing/selftests/vm/ksm_tests.c | 38 -
tools/testing/selftests/vm/memfd_secret.c | 2
tools/testing/selftests/vm/run_vmtests.sh | 15
tools/testing/selftests/vm/transhuge-stress.c | 41 -
tools/testing/selftests/vm/userfaultfd.c | 72 +-
tools/testing/selftests/vm/util.h | 75 ++-
tools/vm/page_owner_sort.c | 628 +++++++++++++++++++++-----
73 files changed, 2797 insertions(+), 1288 deletions(-)
^ permalink raw reply [flat|nested] 232+ messages in thread
* incoming
@ 2022-04-01 18:20 Andrew Morton
2022-04-01 18:27 ` incoming Andrew Morton
0 siblings, 1 reply; 232+ messages in thread
From: Andrew Morton @ 2022-04-01 18:20 UTC (permalink / raw)
To: Linus Torvalds; +Cc: linux-mm, mm-commits, patches
16 patches, based on e8b767f5e04097aaedcd6e06e2270f9fe5282696.
Subsystems affected by this patch series:
mm/madvise
ofs2
nilfs2
mm/mlock
mm/mfence
mailmap
mm/memory-failure
mm/kasan
mm/debug
mm/kmemleak
mm/damon
Subsystem: mm/madvise
Charan Teja Kalla <quic_charante@quicinc.com>:
Revert "mm: madvise: skip unmapped vma holes passed to process_madvise"
Subsystem: ofs2
Joseph Qi <joseph.qi@linux.alibaba.com>:
ocfs2: fix crash when mount with quota enabled
Subsystem: nilfs2
Ryusuke Konishi <konishi.ryusuke@gmail.com>:
Patch series "nilfs2 lockdep warning fixes":
nilfs2: fix lockdep warnings in page operations for btree nodes
nilfs2: fix lockdep warnings during disk space reclamation
nilfs2: get rid of nilfs_mapping_init()
Subsystem: mm/mlock
Hugh Dickins <hughd@google.com>:
mm/munlock: add lru_add_drain() to fix memcg_stat_test
mm/munlock: update Documentation/vm/unevictable-lru.rst
Sebastian Andrzej Siewior <bigeasy@linutronix.de>:
mm/munlock: protect the per-CPU pagevec by a local_lock_t
Subsystem: mm/kfence
Muchun Song <songmuchun@bytedance.com>:
mm: kfence: fix objcgs vector allocation
Subsystem: mailmap
Kirill Tkhai <kirill.tkhai@openvz.org>:
mailmap: update Kirill's email
Subsystem: mm/memory-failure
Rik van Riel <riel@surriel.com>:
mm,hwpoison: unmap poisoned page before invalidation
Subsystem: mm/kasan
Andrey Konovalov <andreyknvl@google.com>:
mm, kasan: fix __GFP_BITS_SHIFT definition breaking LOCKDEP
Subsystem: mm/debug
Yinan Zhang <zhangyinan2019@email.szu.edu.cn>:
tools/vm/page_owner_sort.c: remove -c option
doc/vm/page_owner.rst: remove content related to -c option
Subsystem: mm/kmemleak
Kuan-Ying Lee <Kuan-Ying.Lee@mediatek.com>:
mm/kmemleak: reset tag when compare object pointer
Subsystem: mm/damon
Jonghyeon Kim <tome01@ajou.ac.kr>:
mm/damon: prevent activated scheme from sleeping by deactivated schemes
.mailmap | 1
Documentation/vm/page_owner.rst | 1
Documentation/vm/unevictable-lru.rst | 473 +++++++++++++++--------------------
fs/nilfs2/btnode.c | 23 +
fs/nilfs2/btnode.h | 1
fs/nilfs2/btree.c | 27 +
fs/nilfs2/dat.c | 4
fs/nilfs2/gcinode.c | 7
fs/nilfs2/inode.c | 167 +++++++++++-
fs/nilfs2/mdt.c | 45 ++-
fs/nilfs2/mdt.h | 6
fs/nilfs2/nilfs.h | 16 -
fs/nilfs2/page.c | 16 -
fs/nilfs2/page.h | 1
fs/nilfs2/segment.c | 9
fs/nilfs2/super.c | 5
fs/ocfs2/quota_global.c | 23 -
fs/ocfs2/quota_local.c | 2
include/linux/gfp.h | 4
mm/damon/core.c | 5
mm/gup.c | 10
mm/internal.h | 6
mm/kfence/core.c | 11
mm/kfence/kfence.h | 3
mm/kmemleak.c | 9
mm/madvise.c | 9
mm/memory.c | 12
mm/migrate.c | 2
mm/mlock.c | 46 ++-
mm/page_alloc.c | 1
mm/rmap.c | 4
mm/swap.c | 4
tools/vm/page_owner_sort.c | 6
33 files changed, 560 insertions(+), 399 deletions(-)
^ permalink raw reply [flat|nested] 232+ messages in thread
* Re: incoming
2022-04-01 18:20 incoming Andrew Morton
@ 2022-04-01 18:27 ` Andrew Morton
0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2022-04-01 18:27 UTC (permalink / raw)
To: Linus Torvalds, linux-mm, mm-commits, patches
Argh, messed up in-reply-to. Let me redo...
^ permalink raw reply [flat|nested] 232+ messages in thread
* incoming
@ 2022-04-01 18:27 Andrew Morton
0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2022-04-01 18:27 UTC (permalink / raw)
To: Linus Torvalds; +Cc: linux-mm, mm-commits, patches
16 patches, based on e8b767f5e04097aaedcd6e06e2270f9fe5282696.
Subsystems affected by this patch series:
mm/madvise
ofs2
nilfs2
mm/mlock
mm/mfence
mailmap
mm/memory-failure
mm/kasan
mm/debug
mm/kmemleak
mm/damon
Subsystem: mm/madvise
Charan Teja Kalla <quic_charante@quicinc.com>:
Revert "mm: madvise: skip unmapped vma holes passed to process_madvise"
Subsystem: ofs2
Joseph Qi <joseph.qi@linux.alibaba.com>:
ocfs2: fix crash when mount with quota enabled
Subsystem: nilfs2
Ryusuke Konishi <konishi.ryusuke@gmail.com>:
Patch series "nilfs2 lockdep warning fixes":
nilfs2: fix lockdep warnings in page operations for btree nodes
nilfs2: fix lockdep warnings during disk space reclamation
nilfs2: get rid of nilfs_mapping_init()
Subsystem: mm/mlock
Hugh Dickins <hughd@google.com>:
mm/munlock: add lru_add_drain() to fix memcg_stat_test
mm/munlock: update Documentation/vm/unevictable-lru.rst
Sebastian Andrzej Siewior <bigeasy@linutronix.de>:
mm/munlock: protect the per-CPU pagevec by a local_lock_t
Subsystem: mm/kfence
Muchun Song <songmuchun@bytedance.com>:
mm: kfence: fix objcgs vector allocation
Subsystem: mailmap
Kirill Tkhai <kirill.tkhai@openvz.org>:
mailmap: update Kirill's email
Subsystem: mm/memory-failure
Rik van Riel <riel@surriel.com>:
mm,hwpoison: unmap poisoned page before invalidation
Subsystem: mm/kasan
Andrey Konovalov <andreyknvl@google.com>:
mm, kasan: fix __GFP_BITS_SHIFT definition breaking LOCKDEP
Subsystem: mm/debug
Yinan Zhang <zhangyinan2019@email.szu.edu.cn>:
tools/vm/page_owner_sort.c: remove -c option
doc/vm/page_owner.rst: remove content related to -c option
Subsystem: mm/kmemleak
Kuan-Ying Lee <Kuan-Ying.Lee@mediatek.com>:
mm/kmemleak: reset tag when compare object pointer
Subsystem: mm/damon
Jonghyeon Kim <tome01@ajou.ac.kr>:
mm/damon: prevent activated scheme from sleeping by deactivated schemes
.mailmap | 1
Documentation/vm/page_owner.rst | 1
Documentation/vm/unevictable-lru.rst | 473 +++++++++++++++--------------------
fs/nilfs2/btnode.c | 23 +
fs/nilfs2/btnode.h | 1
fs/nilfs2/btree.c | 27 +
fs/nilfs2/dat.c | 4
fs/nilfs2/gcinode.c | 7
fs/nilfs2/inode.c | 167 +++++++++++-
fs/nilfs2/mdt.c | 45 ++-
fs/nilfs2/mdt.h | 6
fs/nilfs2/nilfs.h | 16 -
fs/nilfs2/page.c | 16 -
fs/nilfs2/page.h | 1
fs/nilfs2/segment.c | 9
fs/nilfs2/super.c | 5
fs/ocfs2/quota_global.c | 23 -
fs/ocfs2/quota_local.c | 2
include/linux/gfp.h | 4
mm/damon/core.c | 5
mm/gup.c | 10
mm/internal.h | 6
mm/kfence/core.c | 11
mm/kfence/kfence.h | 3
mm/kmemleak.c | 9
mm/madvise.c | 9
mm/memory.c | 12
mm/migrate.c | 2
mm/mlock.c | 46 ++-
mm/page_alloc.c | 1
mm/rmap.c | 4
mm/swap.c | 4
tools/vm/page_owner_sort.c | 6
33 files changed, 560 insertions(+), 399 deletions(-)
^ permalink raw reply [flat|nested] 232+ messages in thread
* incoming
@ 2022-04-08 20:08 Andrew Morton
0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2022-04-08 20:08 UTC (permalink / raw)
To: Linus Torvalds; +Cc: linux-mm, mm-commits, patches
9 patches, based on d00c50b35101b862c3db270ffeba53a63a1063d9.
Subsystems affected by this patch series:
mm/migration
mm/highmem
lz4
mm/sparsemem
mm/mremap
mm/mempolicy
mailmap
mm/memcg
MAINTAINERS
Subsystem: mm/migration
Zi Yan <ziy@nvidia.com>:
mm: migrate: use thp_order instead of HPAGE_PMD_ORDER for new page allocation.
Subsystem: mm/highmem
Max Filippov <jcmvbkbc@gmail.com>:
highmem: fix checks in __kmap_local_sched_{in,out}
Subsystem: lz4
Guo Xuenan <guoxuenan@huawei.com>:
lz4: fix LZ4_decompress_safe_partial read out of bound
Subsystem: mm/sparsemem
Waiman Long <longman@redhat.com>:
mm/sparsemem: fix 'mem_section' will never be NULL gcc 12 warning
Subsystem: mm/mremap
Paolo Bonzini <pbonzini@redhat.com>:
mmmremap.c: avoid pointless invalidate_range_start/end on mremap(old_size=0)
Subsystem: mm/mempolicy
Miaohe Lin <linmiaohe@huawei.com>:
mm/mempolicy: fix mpol_new leak in shared_policy_replace
Subsystem: mailmap
Vasily Averin <vasily.averin@linux.dev>:
mailmap: update Vasily Averin's email address
Subsystem: mm/memcg
Andrew Morton <akpm@linux-foundation.org>:
mm/list_lru.c: revert "mm/list_lru: optimize memcg_reparent_list_lru_node()"
Subsystem: MAINTAINERS
Tom Rix <trix@redhat.com>:
MAINTAINERS: add Tom as clang reviewer
.mailmap | 4 ++++
MAINTAINERS | 1 +
include/linux/mmzone.h | 11 +++++++----
lib/lz4/lz4_decompress.c | 8 ++++++--
mm/highmem.c | 4 ++--
mm/list_lru.c | 6 ------
mm/mempolicy.c | 3 ++-
mm/migrate.c | 2 +-
mm/mremap.c | 3 +++
9 files changed, 26 insertions(+), 16 deletions(-)
^ permalink raw reply [flat|nested] 232+ messages in thread
* incoming
@ 2022-04-15 2:12 Andrew Morton
0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2022-04-15 2:12 UTC (permalink / raw)
To: Linus Torvalds; +Cc: linux-mm, mm-commits, patches
14 patches, based on 115acbb56978941bb7537a97dfc303da286106c1.
Subsystems affected by this patch series:
MAINTAINERS
mm/tmpfs
m/secretmem
mm/kasan
mm/kfence
mm/pagealloc
mm/zram
mm/compaction
mm/hugetlb
binfmt
mm/vmalloc
mm/kmemleak
Subsystem: MAINTAINERS
Joe Perches <joe@perches.com>:
MAINTAINERS: Broadcom internal lists aren't maintainers
Subsystem: mm/tmpfs
Hugh Dickins <hughd@google.com>:
tmpfs: fix regressions from wider use of ZERO_PAGE
Subsystem: m/secretmem
Axel Rasmussen <axelrasmussen@google.com>:
mm/secretmem: fix panic when growing a memfd_secret
Subsystem: mm/kasan
Zqiang <qiang1.zhang@intel.com>:
irq_work: use kasan_record_aux_stack_noalloc() record callstack
Vincenzo Frascino <vincenzo.frascino@arm.com>:
kasan: fix hw tags enablement when KUNIT tests are disabled
Subsystem: mm/kfence
Marco Elver <elver@google.com>:
mm, kfence: support kmem_dump_obj() for KFENCE objects
Subsystem: mm/pagealloc
Juergen Gross <jgross@suse.com>:
mm, page_alloc: fix build_zonerefs_node()
Subsystem: mm/zram
Minchan Kim <minchan@kernel.org>:
mm: fix unexpected zeroed page mapping with zram swap
Subsystem: mm/compaction
Charan Teja Kalla <quic_charante@quicinc.com>:
mm: compaction: fix compiler warning when CONFIG_COMPACTION=n
Subsystem: mm/hugetlb
Mike Kravetz <mike.kravetz@oracle.com>:
hugetlb: do not demote poisoned hugetlb pages
Subsystem: binfmt
Andrew Morton <akpm@linux-foundation.org>:
revert "fs/binfmt_elf: fix PT_LOAD p_align values for loaders"
revert "fs/binfmt_elf: use PT_LOAD p_align values for static PIE"
Subsystem: mm/vmalloc
Omar Sandoval <osandov@fb.com>:
mm/vmalloc: fix spinning drain_vmap_work after reading from /proc/vmcore
Subsystem: mm/kmemleak
Patrick Wang <patrick.wang.shcn@gmail.com>:
mm: kmemleak: take a full lowmem check in kmemleak_*_phys()
MAINTAINERS | 64 ++++++++++++++++++++--------------------
arch/x86/include/asm/io.h | 2 -
arch/x86/kernel/crash_dump_64.c | 1
fs/binfmt_elf.c | 6 +--
include/linux/kfence.h | 24 +++++++++++++++
kernel/irq_work.c | 2 -
mm/compaction.c | 10 +++---
mm/filemap.c | 6 ---
mm/hugetlb.c | 17 ++++++----
mm/kasan/hw_tags.c | 5 +--
mm/kasan/kasan.h | 10 +++---
mm/kfence/core.c | 21 -------------
mm/kfence/kfence.h | 21 +++++++++++++
mm/kfence/report.c | 47 +++++++++++++++++++++++++++++
mm/kmemleak.c | 8 ++---
mm/page_alloc.c | 2 -
mm/page_io.c | 54 ---------------------------------
mm/secretmem.c | 17 ++++++++++
mm/shmem.c | 31 ++++++++++++-------
mm/slab.c | 2 -
mm/slab.h | 2 -
mm/slab_common.c | 9 +++++
mm/slob.c | 2 -
mm/slub.c | 2 -
mm/vmalloc.c | 11 ------
25 files changed, 207 insertions(+), 169 deletions(-)
^ permalink raw reply [flat|nested] 232+ messages in thread
* incoming
@ 2022-04-21 23:35 Andrew Morton
0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2022-04-21 23:35 UTC (permalink / raw)
To: Linus Torvalds; +Cc: mm-commits, linux-mm, patches
13 patches, based on b253435746d9a4a701b5f09211b9c14d3370d0da.
Subsystems affected by this patch series:
mm/memory-failure
mm/memcg
mm/userfaultfd
mm/hugetlbfs
mm/mremap
mm/oom-kill
mm/kasan
kcov
mm/hmm
Subsystem: mm/memory-failure
Naoya Horiguchi <naoya.horiguchi@nec.com>:
mm/hwpoison: fix race between hugetlb free/demotion and memory_failure_hugetlb()
Xu Yu <xuyu@linux.alibaba.com>:
mm/memory-failure.c: skip huge_zero_page in memory_failure()
Subsystem: mm/memcg
Shakeel Butt <shakeelb@google.com>:
memcg: sync flush only if periodic flush is delayed
Subsystem: mm/userfaultfd
Nadav Amit <namit@vmware.com>:
userfaultfd: mark uffd_wp regardless of VM_WRITE flag
Subsystem: mm/hugetlbfs
Christophe Leroy <christophe.leroy@csgroup.eu>:
mm, hugetlb: allow for "high" userspace addresses
Subsystem: mm/mremap
Sidhartha Kumar <sidhartha.kumar@oracle.com>:
selftest/vm: verify mmap addr in mremap_test
selftest/vm: verify remap destination address in mremap_test
selftest/vm: support xfail in mremap_test
selftest/vm: add skip support to mremap_test
Subsystem: mm/oom-kill
Nico Pache <npache@redhat.com>:
oom_kill.c: futex: delay the OOM reaper to allow time for proper futex cleanup
Subsystem: mm/kasan
Vincenzo Frascino <vincenzo.frascino@arm.com>:
MAINTAINERS: add Vincenzo Frascino to KASAN reviewers
Subsystem: kcov
Aleksandr Nogikh <nogikh@google.com>:
kcov: don't generate a warning on vm_insert_page()'s failure
Subsystem: mm/hmm
Alistair Popple <apopple@nvidia.com>:
mm/mmu_notifier.c: fix race in mmu_interval_notifier_remove()
MAINTAINERS | 1
fs/hugetlbfs/inode.c | 9 -
include/linux/hugetlb.h | 6 +
include/linux/memcontrol.h | 5
include/linux/mm.h | 8 +
include/linux/sched.h | 1
include/linux/sched/mm.h | 8 +
kernel/kcov.c | 7 -
mm/hugetlb.c | 10 +
mm/memcontrol.c | 12 ++
mm/memory-failure.c | 158 ++++++++++++++++++++++--------
mm/mmap.c | 8 -
mm/mmu_notifier.c | 14 ++
mm/oom_kill.c | 54 +++++++---
mm/userfaultfd.c | 15 +-
mm/workingset.c | 2
tools/testing/selftests/vm/mremap_test.c | 85 +++++++++++++++-
tools/testing/selftests/vm/run_vmtests.sh | 11 +-
18 files changed, 327 insertions(+), 87 deletions(-)
^ permalink raw reply [flat|nested] 232+ messages in thread
* incoming
@ 2022-04-27 19:41 Andrew Morton
0 siblings, 0 replies; 232+ messages in thread
From: Andrew Morton @ 2022-04-27 19:41 UTC (permalink / raw)
To: Linus Torvalds; +Cc: linux-mm, mm-commits, patches
2 patches, based on d615b5416f8a1afeb82d13b238f8152c572d59c0.
Subsystems affected by this patch series:
mm/kasan
mm/debug
Subsystem: mm/kasan
Zqiang <qiang1.zhang@intel.com>:
kasan: prevent cpu_quarantine corruption when CPU offline and cache shrink occur at same time
Subsystem: mm/debug
Akira Yokosawa <akiyks@gmail.com>:
docs: vm/page_owner: use literal blocks for param description
Documentation/vm/page_owner.rst | 5 +++--
mm/kasan/quarantine.c | 7 +++++++
2 files changed, 10 insertions(+), 2 deletions(-)
^ permalink raw reply [flat|nested] 232+ messages in thread
end of thread, other threads:[~2022-04-27 19:43 UTC | newest]
Thread overview: 232+ messages (download: mbox.gz follow: Atom feed
-- links below jump to the message on this page --
2017-02-18 11:42 incoming Andrew Morton
-- strict thread matches above, loose matches on Subject: below --
2022-04-27 19:41 incoming Andrew Morton
2022-04-21 23:35 incoming Andrew Morton
2022-04-15 2:12 incoming Andrew Morton
2022-04-08 20:08 incoming Andrew Morton
2022-04-01 18:27 incoming Andrew Morton
2022-04-01 18:20 incoming Andrew Morton
2022-04-01 18:27 ` incoming Andrew Morton
2022-03-25 1:07 incoming Andrew Morton
2022-03-23 23:04 incoming Andrew Morton
2022-03-22 21:38 incoming Andrew Morton
2022-03-16 23:14 incoming Andrew Morton
2022-03-05 4:28 incoming Andrew Morton
2022-02-26 3:10 incoming Andrew Morton
2022-02-12 0:27 incoming Andrew Morton
2022-02-12 2:02 ` incoming Linus Torvalds
2022-02-12 5:24 ` incoming Andrew Morton
2022-02-04 4:48 incoming Andrew Morton
2022-01-29 21:40 incoming Andrew Morton
2022-01-29 2:13 incoming Andrew Morton
2022-01-29 4:25 ` incoming Matthew Wilcox
2022-01-29 6:23 ` incoming Andrew Morton
2022-01-22 6:10 incoming Andrew Morton
2022-01-20 2:07 incoming Andrew Morton
2022-01-14 22:02 incoming Andrew Morton
2021-12-31 4:12 incoming Andrew Morton
2021-12-25 5:11 incoming Andrew Morton
2021-12-10 22:45 incoming Andrew Morton
2021-11-20 0:42 incoming Andrew Morton
2021-11-11 4:32 incoming Andrew Morton
2021-11-09 2:30 incoming Andrew Morton
2021-11-05 20:34 incoming Andrew Morton
2021-10-28 21:35 incoming Andrew Morton
2021-10-18 22:14 incoming Andrew Morton
2021-09-24 22:42 incoming Andrew Morton
2021-09-10 3:09 incoming Andrew Morton
2021-09-10 17:11 ` incoming Kees Cook
2021-09-10 20:13 ` incoming Kees Cook
2021-09-09 1:08 incoming Andrew Morton
2021-09-08 22:17 incoming Andrew Morton
2021-09-08 2:52 incoming Andrew Morton
2021-09-08 8:57 ` incoming Vlastimil Babka
2021-09-02 21:48 incoming Andrew Morton
2021-09-02 21:49 ` incoming Andrew Morton
2021-08-25 19:17 incoming Andrew Morton
2021-08-20 2:03 incoming Andrew Morton
2021-08-13 23:53 incoming Andrew Morton
2021-07-29 21:52 incoming Andrew Morton
2021-07-23 22:49 incoming Andrew Morton
2021-07-15 4:26 incoming Andrew Morton
2021-07-08 0:59 incoming Andrew Morton
2021-07-01 1:46 incoming Andrew Morton
2021-07-03 0:28 ` incoming Linus Torvalds
2021-07-03 1:06 ` incoming Linus Torvalds
2021-06-29 2:32 incoming Andrew Morton
2021-06-25 1:38 incoming Andrew Morton
2021-06-16 1:22 incoming Andrew Morton
2021-06-05 3:00 incoming Andrew Morton
2021-05-23 0:41 incoming Andrew Morton
2021-05-15 0:26 incoming Andrew Morton
2021-05-07 1:01 incoming Andrew Morton
2021-05-07 7:12 ` incoming Linus Torvalds
2021-05-05 1:32 incoming Andrew Morton
2021-05-05 1:47 ` incoming Linus Torvalds
2021-05-05 3:16 ` incoming Andrew Morton
2021-05-05 17:10 ` incoming Linus Torvalds
2021-05-05 17:44 ` incoming Andrew Morton
2021-05-06 3:19 ` incoming Anshuman Khandual
2021-04-30 5:52 incoming Andrew Morton
2021-04-23 21:28 incoming Andrew Morton
2021-04-16 22:45 incoming Andrew Morton
2021-04-09 20:26 incoming Andrew Morton
2021-03-25 4:36 incoming Andrew Morton
2021-03-13 5:06 incoming Andrew Morton
2021-02-26 1:14 incoming Andrew Morton
2021-02-26 17:55 ` incoming Linus Torvalds
2021-02-26 19:16 ` incoming Andrew Morton
2021-02-24 19:58 incoming Andrew Morton
2021-02-24 21:30 ` incoming Linus Torvalds
2021-02-24 21:37 ` incoming Linus Torvalds
2021-02-25 8:53 ` incoming Arnd Bergmann
2021-02-25 9:12 ` incoming Andrey Ryabinin
2021-02-25 11:07 ` incoming Walter Wu
2021-02-13 4:52 incoming Andrew Morton
2021-02-09 21:41 incoming Andrew Morton
2021-02-10 19:30 ` incoming Linus Torvalds
2021-02-05 2:31 incoming Andrew Morton
2021-01-24 5:00 incoming Andrew Morton
2021-01-12 23:48 incoming Andrew Morton
2021-01-15 23:32 ` incoming Linus Torvalds
2020-12-29 23:13 incoming Andrew Morton
2020-12-22 19:58 incoming Andrew Morton
2020-12-22 21:43 ` incoming Linus Torvalds
2020-12-18 22:00 incoming Andrew Morton
2020-12-16 4:41 incoming Andrew Morton
2020-12-15 20:32 incoming Andrew Morton
2020-12-15 21:00 ` incoming Linus Torvalds
2020-12-15 22:48 ` incoming Linus Torvalds
2020-12-15 22:49 ` incoming Linus Torvalds
2020-12-15 22:55 ` incoming Andrew Morton
2020-12-15 3:02 incoming Andrew Morton
2020-12-15 3:25 ` incoming Linus Torvalds
2020-12-15 3:30 ` incoming Linus Torvalds
2020-12-15 14:04 ` incoming Konstantin Ryabitsev
2020-12-11 21:35 incoming Andrew Morton
2020-12-06 6:14 incoming Andrew Morton
2020-11-22 6:16 incoming Andrew Morton
2020-11-14 6:51 incoming Andrew Morton
2020-11-02 1:06 incoming Andrew Morton
2020-10-17 23:13 incoming Andrew Morton
2020-10-16 2:40 incoming Andrew Morton
2020-10-16 3:03 ` incoming Andrew Morton
2020-10-13 23:46 incoming Andrew Morton
2020-10-11 6:15 incoming Andrew Morton
2020-10-03 5:20 incoming Andrew Morton
2020-09-26 4:17 incoming Andrew Morton
2020-09-19 4:19 incoming Andrew Morton
2020-09-04 23:34 incoming Andrew Morton
2020-08-21 0:41 incoming Andrew Morton
2020-08-15 0:29 incoming Andrew Morton
2020-08-12 1:29 incoming Andrew Morton
2020-08-07 6:16 incoming Andrew Morton
2020-07-24 4:14 incoming Andrew Morton
2020-07-03 22:14 incoming Andrew Morton
2020-06-26 3:28 incoming Andrew Morton
2020-06-12 0:30 incoming Andrew Morton
2020-06-11 1:40 incoming Andrew Morton
2020-06-09 4:29 incoming Andrew Morton
2020-06-08 4:35 incoming Andrew Morton
2020-06-04 23:45 incoming Andrew Morton
2020-06-03 22:55 incoming Andrew Morton
2020-06-02 20:09 incoming Andrew Morton
2020-06-02 4:44 incoming Andrew Morton
2020-06-02 20:08 ` incoming Andrew Morton
[not found] ` <CAHk-=wgRV=SaiMn3L5u5mG0WfvB2VfEQadtudzDV3KRz5HnFrQ@mail.gmail.com>
2020-06-02 21:38 ` incoming Andrew Morton
2020-05-28 5:20 incoming Andrew Morton
[not found] ` <CAHk-=whQSWcE1WvKxptHdyc9BUXQyxxyAH954=Jb_YSBrNJYDQ@mail.gmail.com>
2020-05-29 20:31 ` incoming Andrew Morton
[not found] ` <CAHk-=wiU-vQVURz62dzitbh2Pk+m_+ipaJU6=z=ES3cd_wKSLQ@mail.gmail.com>
2020-05-29 21:12 ` incoming Andrew Morton
2020-05-14 0:50 incoming Andrew Morton
2020-05-08 1:35 incoming Andrew Morton
2020-04-21 1:13 incoming Andrew Morton
2020-04-12 7:41 incoming Andrew Morton
2020-04-10 21:30 incoming Andrew Morton
2020-04-07 3:02 incoming Andrew Morton
2020-04-02 4:01 incoming Andrew Morton
2020-03-29 2:14 incoming Andrew Morton
2020-03-22 1:19 incoming Andrew Morton
2020-03-06 6:27 incoming Andrew Morton
2020-02-21 4:00 incoming Andrew Morton
2020-02-21 4:03 ` incoming Andrew Morton
2020-02-04 1:33 incoming Andrew Morton
[not found] ` <CAHk-=whog86e4fRY_sxHqAos6spwAi_4aFF49S7h5C4XAZM2qw@mail.gmail.com>
2020-02-04 2:46 ` incoming Andrew Morton
2020-01-31 6:10 incoming Andrew Morton
2020-01-14 0:28 incoming Andrew Morton
2018-02-06 23:34 incoming Andrew Morton
2018-02-01 0:13 incoming Andrew Morton
2018-02-01 0:25 ` incoming Andrew Morton
2018-01-19 0:33 incoming Andrew Morton
2018-01-13 0:52 incoming Andrew Morton
2018-01-05 0:17 incoming Andrew Morton
2017-12-14 23:32 incoming Andrew Morton
2017-11-30 0:09 incoming Andrew Morton
2017-11-17 23:25 incoming Andrew Morton
2017-11-16 1:29 incoming Andrew Morton
2017-11-09 21:38 incoming Andrew Morton
2017-11-02 22:59 incoming Andrew Morton
2017-10-13 22:57 incoming Andrew Morton
2017-10-03 23:14 incoming Andrew Morton
2017-09-13 23:28 incoming Andrew Morton
2017-09-08 23:10 incoming Andrew Morton
[not found] ` <CA+55aFwRXB5_kSuN7o+tqN6Eft6w5oZuLG3B8Rns=0ZZa2ihgA@mail.gmail.com>
[not found] ` <CA+55aFw+z3HDT4s1C41j=d5_0QTSu8NLSSpnk_jxZ39w34xgnA@mail.gmail.com>
2017-09-09 18:09 ` incoming Andrew Morton
2017-09-06 23:17 incoming Andrew Morton
2017-08-31 23:15 incoming Andrew Morton
2017-08-25 22:55 incoming Andrew Morton
2017-08-18 22:15 incoming Andrew Morton
2017-08-10 22:23 incoming Andrew Morton
2017-08-02 20:31 incoming Andrew Morton
2017-07-14 21:46 incoming Andrew Morton
2017-07-12 21:32 incoming Andrew Morton
2017-07-10 22:46 incoming Andrew Morton
2017-07-06 22:34 incoming Andrew Morton
2017-06-23 22:08 incoming Andrew Morton
2017-06-16 21:02 incoming Andrew Morton
2017-06-02 21:45 incoming Andrew Morton
2017-05-12 22:45 incoming Andrew Morton
2017-05-08 22:53 incoming Andrew Morton
2017-05-03 21:50 incoming Andrew Morton
2017-04-20 21:37 incoming Andrew Morton
2017-04-13 21:56 incoming Andrew Morton
2017-04-07 23:04 incoming Andrew Morton
2017-03-31 22:11 incoming Andrew Morton
2017-03-16 23:40 incoming Andrew Morton
2017-03-10 0:15 incoming Andrew Morton
2017-02-27 22:25 incoming Andrew Morton
2017-02-24 22:55 incoming Andrew Morton
2017-02-22 23:38 incoming Andrew Morton
2017-02-08 22:30 incoming Andrew Morton
2017-01-24 23:17 incoming Andrew Morton
2017-01-11 0:57 incoming Andrew Morton
2016-12-20 0:22 incoming Andrew Morton
2016-12-14 23:04 incoming Andrew Morton
2016-12-13 0:40 incoming Andrew Morton
2016-12-07 22:44 incoming Andrew Morton
2016-12-03 1:26 incoming Andrew Morton
2016-11-30 23:53 incoming Andrew Morton
2016-11-10 18:45 incoming Andrew Morton
2016-10-11 20:49 incoming Andrew Morton
2016-10-07 23:53 incoming Andrew Morton
2016-09-30 22:11 incoming Andrew Morton
2016-09-28 22:22 incoming Andrew Morton
2016-09-19 21:43 incoming Andrew Morton
2016-09-01 23:14 incoming Andrew Morton
2016-08-25 22:16 incoming Andrew Morton
2016-08-11 22:32 incoming Andrew Morton
2016-08-04 22:31 incoming Andrew Morton
2016-08-03 20:45 incoming Andrew Morton
2016-08-02 21:01 incoming Andrew Morton
2016-07-28 22:42 incoming Andrew Morton
2016-07-26 22:16 incoming Andrew Morton
2016-07-20 22:44 incoming Andrew Morton
2016-07-14 19:06 incoming Andrew Morton
2016-06-24 21:48 incoming Andrew Morton
2016-06-08 22:33 incoming Andrew Morton
2016-06-03 21:51 incoming Andrew Morton
2016-05-27 21:26 incoming Andrew Morton
2016-05-26 22:15 incoming Andrew Morton
2016-05-23 23:21 incoming Andrew Morton
2016-05-20 23:55 incoming Andrew Morton
2016-05-20 0:07 incoming Andrew Morton
2016-05-12 22:41 incoming Andrew Morton
2016-05-09 23:28 incoming Andrew Morton
2016-05-05 23:21 incoming Andrew Morton
This is a public inbox, see mirroring instructions
for how to clone and mirror all data and code used for this inbox